RPSBLAST alignment for GI: 254780901 and conserved domain: pfam01368

>gnl|CDD|144819 pfam01368, DHH, DHH family. It is predicted that this family of proteins all perform a phosphoesterase function. It included the single stranded DNA exonuclease RecJ. Length = 156
 Score =  130 bits (330), Expect = 7e-31
 Identities = 57/169 (33%), Positives = 82/169 (48%), Gaps = 19/169 (11%)

Query: 88  AIYNSEKIMIFGDY--DVDGAASVALMMRFLSHCSVNANMYIPDRIVDG--YGPNPSLME 143
           AI   EKI+I G Y  D DG  S A +   L       +  +P R ++G  YG +  ++E
Sbjct: 1   AIKEGEKILIVGHYNPDADGIGSAAALALALKRLGAEKDYVVPPREIEGKFYGLSDEIVE 60

Query: 144 KFINEG--AQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLD 201
               E   A L+ITVD GST+ + ++ A   GIDVIVIDHH+    ++P    +NP    
Sbjct: 61  DIAEEKGKADLLITVDTGSTAREEIELAKLLGIDVIVIDHHEPPENDLPPI--INPA--- 115

Query: 202 DLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
           DL     L A+    LV   +  +  + N+        +L DL+AL  V
Sbjct: 116 DLGPYIDLSASSTAELVAEALLGLELKLNR--------NLADLLALGIV 156