RPSBLAST alignment for GI: 254780901 and conserved domain: pfam02272

>gnl|CDD|145431 pfam02272, DHHA1, DHHA1 domain. This domain is often found adjacent to the DHH domain pfam01368 and is called DHHA1 for DHH associated domain. This domain is diagnostic of DHH subfamily 1 members. This domains is also found in alanyl tRNA synthetase, suggesting that this domain may have an RNA binding function. The domain is about 60 residues long and contains a conserved GG motif. Length = 69
 Score = 45.7 bits (109), Expect = 3e-05
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 396 RPSFAISFEEDGKGIGSGRSIEGFDI-GKMVSFAVEEGILVKGGGHAMAAGLTVE 449
           +P    + EEDGK   S RS +G D+ G  +   V E +   GGGH  AAG   +
Sbjct: 2   KPVVLFA-EEDGKVKVSARSSKGLDVKGGELLKEVAEILGGGGGGHPDAAGAGGK 55