RPSBLAST alignment of GI: 254780901 and protein with PDBid: 3dev

>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Length = 320
 Score = 47.0 bits (110), Expect = 1e-05
 Identities = 18/110 (16%), Positives = 36/110 (32%), Gaps = 8/110 (7%)

Query: 340 NQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSF 399
              + +     + Q      +      + +  V++     P         + +  G   +
Sbjct: 195 KDPKLMPFQGYVLQNFELSDSHEYCQIKITNDVLKQFDIQPNEASQFVNTVADISGLKIW 254

Query: 400 AISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVE 449
               +E  +     RS +G  I      A + G    GGGH  A+G++V 
Sbjct: 255 MFGVDEGDQIRCRIRS-KGITIND---VANQFG----GGGHPNASGVSVY 296