HHsearch alignment for GI: 254780903 and conserved domain: KOG0519

>KOG0519 consensus.
Probab=99.92  E-value=5.3e-26  Score=205.64  Aligned_cols=233  Identities=25%  Similarity=0.303  Sum_probs=202.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999887899999--9998767522247899999999860346889938999999999999999999977767
Q gi|254780903|r  526 NAKYQVEKERAETANKTKSE--FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL  603 (766)
Q Consensus       526 ~~~l~~~~~~ae~an~~k~e--fla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~diL  603 (766)
T Consensus       202 ~~~~~~~~~~~e~~~~~~sq~~~~~~~sHeir~p~~~--~~~~~~----~~t~~~~~~~~~~~~~~~~~~~~~s~ln~i~  275 (786)
T KOG0519         202 LVELQKKLASDEAAVWSPSQKGFLATLSHEIRTPLNG--GMLGGL----SDTDLDSDQRLILNTDRVSAKSLLSLLNDIL  275 (786)
T ss_pred             HHHHHHHHCCCCCHHCCCCCHHCCCCCCCEEECCCCC--CCCCEE----ECCCCCHHHHHHHCCCHHHHHCHHHHHHHHH
T ss_conf             5212566512530002742011134456324434445--664122----0344215689874300122000013777764


Q ss_pred             HHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCE--EEECHHHHHHHHHHHHHHHHHCCCCCCE
Q ss_conf             78887419830120331699999999999999998479589998089978--9986899999999988656534689888
Q gi|254780903|r  604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGK  681 (766)
Q Consensus       604 d~srieag~~~~~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~l~--v~~D~~~l~QVl~NLi~NAik~t~~~g~  681 (766)
T Consensus       276 d~~~v~~g~~~l~~~rf~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~p~~v~~de~~~~qv~~n~v~naik~t~~-~~  354 (786)
T KOG0519         276 DLSKVESGKGELVAKRFDLRTLLNFVISLLSELSQAKYAILVLDLSSGVPRNVRGDEARLRQVIANLVSNAIKFTHA-GH  354 (786)
T ss_pred             HHCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCC-CC
T ss_conf             01135323554032234526666777877666551367346520787776420356101100033320144354446-62


Q ss_pred             EEEEEEEEC------------------------------------------------CEEEEEEEECCCCCCHHHHHH-H
Q ss_conf             999999979------------------------------------------------989999997889789778543-0
Q gi|254780903|r  682 MMIRTSKIG------------------------------------------------QCVIITIADTGIGIPKSALEK-I  712 (766)
Q Consensus       682 I~i~~~~~~------------------------------------------------~~v~i~V~D~G~GI~~e~~~~-i  712 (766)
T Consensus       355 i~~~~~~~~~~~~~~~~l~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~l~~~~~~~~~~~~~i~~~~~~~~~  434 (786)
T KOG0519         355 LEESVIAREELSESNDVLLRAKEEAHMAGKARIDFLQKMSHAMRAPRHNIISLLSLLLQDIVLSPDSGLEIQTVMRSSNV  434 (786)
T ss_pred             EEEEEEECHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHEEECCCCCEEEEECCCCHHH
T ss_conf             24666512110046789975457765351556678887413312422042122357665202236664068502330465


Q ss_pred             CCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEECC
Q ss_conf             46505314675567788761689999999962986999979899529999735
Q gi|254780903|r  713 GQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP  765 (766)
Q Consensus       713 F~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf~i~LP  765 (766)
T Consensus       435 ~~~~~q~~~~~~~~~~gt~~~~~i~~~l~~l~~~~~~~~~~~~~~~t~~~~~~  487 (786)
T KOG0519         435 FTSLIQADPDITRLYGGTGLGESIVFSLVELMSGEISDISCISLGKTFSFTLD  487 (786)
T ss_pred             HHHHHCCCHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             55451466100345687645332223288998867432110034752223312