HHsearch alignment for GI: 254780903 and conserved domain: KOG3558

>KOG3558 consensus.
Probab=98.43  E-value=2.2e-06  Score=64.08  Aligned_cols=218  Identities=13%  Similarity=0.144  Sum_probs=135.3

Q ss_pred             CCCEEEEECCCCCEEEECCCHHHHCCCCHHHHCCCCHHHHCCCCCCCHHHHHCCCC---------------HHEEEEE--
Q ss_conf             89789999699808997142055519978896076104320544332023211531---------------0000123--
Q gi|254780903|r  127 SESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQ---------------PYHVLSV--  189 (766)
Q Consensus       127 ~~~~i~i~d~~g~i~~~n~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~---------------~~~~~~~--  189 (766)
T Consensus       128 LDGFVm~l~~dG~~lYiSEtVS~yLGLSQvELTG~SvFDfiHP~DheE~~eqL~l~~~~p~~~es~~~~teRsFflRMKs  207 (768)
T KOG3558         128 LDGFVMALTQDGDFLYISETVSIYLGLSQVELTGSSVFDFIHPCDHEEIAEQLGLRLTTPEVKESTDTSTERSFFLRMKS  207 (768)
T ss_pred             CCCEEEEECCCCCEEEEECHHHHHHCCCCEEEECCHHHHCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEE
T ss_conf             24438998167877998203576617110243054132125766789999874335688762324567543257998531


Q ss_pred             ---------ECCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---------3157782599997423210123455655456878----878999999998888999999999999999999
Q gi|254780903|r  190 ---------NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS----IISALLLFILFSYYRQAKKNKENDTILLEANIC  256 (766)
Q Consensus       190 ---------~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~----~~~~~~~~~~~a~~~dit~~r~ae~~l~ese~r  256 (766)
T Consensus       208 TLT~RGRtlnlKSa~yKvlh~tgh~---rv~~~-~sh~s~~~g~~~Pl~~lV~~a~alp-~ps~------------~Eip  270 (768)
T KOG3558         208 TLTKRGRTLNLKSAGYKVLHCTGHL---RVYNN-PSHNSPLCGYKEPLLGLVALAEALP-PPSY------------TEIP  270 (768)
T ss_pred             EECCCCCEEEEECCCEEEEEEEEEE---EECCC-CCCCCCCCCCCCCCHHEEEEECCCC-CCCC------------CCCC
T ss_conf             5516773566501422689886345---40467-7777755576655210045411379-9865------------6666


Q ss_pred             HHHHHHCCCCC--EEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             99997225974--5989768978999788997729994330589889997608120589999999972489848999998
Q gi|254780903|r  257 VETALSRGRCG--LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM  334 (766)
Q Consensus       257 l~~al~~a~~G--iWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~~~~~~e~Ri  334 (766)
T Consensus       271 L-------~~~~FvtRhs~DmkityCedRisdlm~y~PeeLvG--rS~Ye~~Ha~Ds~~v~KSh~dL~~KGQv~TgyYR~  341 (768)
T KOG3558         271 L-------DCHMFVTRHSLDMKITYCEDRISDLMDYEPEELVG--RSCYEFVHALDSDRVRKSHHDLLTKGQVVTGYYRL  341 (768)
T ss_pred             C-------CCCEEEEEEECCEEEEEECHHHHHHHCCCHHHHHC--HHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             5-------77516776414516888735678876479788626--04887633765667788899997547451067788


Q ss_pred             ECCCCCEEEEEEEEEEEEECC-CEE-EEEEEEECCCHH
Q ss_conf             869898899889999998379-606-999998446179
Q gi|254780903|r  335 RHASGADIWIQVRAQMMRTIS-GGM-NIIGIAMDLTEK  370 (766)
Q Consensus       335 ~~~DG~~~Wi~~r~~~i~d~~-G~~-~~iGi~~DITEr  370 (766)
T Consensus       342 lak~GGyvWlQTqATVi~~tkn~q~q~IicVnYVlS~~  379 (768)
T KOG3558         342 LAKNGGYVWLQTQATVIYNTKNPQEQNIICVNYVLSNI  379 (768)
T ss_pred             HHHCCCEEEEEEEEEEEECCCCCCCCEEEEEEEEECCC
T ss_conf             77449769998654798558889851589998661343