HHsearch alignment for GI: 254780903 and conserved domain: KOG3559

>KOG3559 consensus.
Probab=96.85  E-value=0.013  Score=36.81  Aligned_cols=180  Identities=12%  Similarity=0.163  Sum_probs=103.7

Q ss_pred             CC-EEEEECCCCEEEECHHHHHHCCCCHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEE-------------
Q ss_conf             74-5989768978999788997729994330589889997608120589999999972489848999-------------
Q gi|254780903|r  266 CG-LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQI-------------  331 (766)
Q Consensus       266 ~G-iWd~D~~~~~i~ws~~~~~llG~~~~e~~~s~~~~~~~vHPdDr~~~~~a~~~~~~~~~~~~~e-------------  331 (766)
T Consensus        89 DGF~fvva~dGkimYISETaSvhLGLSQVE--lTGNsi~eYIH~~D~demna~L~~h~-H~qeyeIErsfflrmkCvlak  165 (598)
T KOG3559          89 DGFIFVVAPDGKIMYISETASVHLGLSQVE--LTGNSIYEYIHPQDHDEMNAVLTAHQ-HLQEYEIERSFFLRMKCVLAK  165 (598)
T ss_pred             CCEEEEEECCCCEEEEECCEEEEECCEEEE--EECCHHHHHHCCCCHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             545999927998899850113452300046--50623766406012578988876432-444300334311234331000


Q ss_pred             ---------EEEECCCCCEEEEEEEEEEEE-ECCC----EEEEEEEEE-----CCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---------998869898899889999998-3796----069999984-----461799999999999999999998544
Q gi|254780903|r  332 ---------FHMRHASGADIWIQVRAQMMR-TISG----GMNIIGIAM-----DLTEKYHLEKRYAEADQRLSKAIECTS  392 (766)
Q Consensus       332 ---------~Ri~~~DG~~~Wi~~r~~~i~-d~~G----~~~~iGi~~-----DITErK~ae~~l~ese~rlr~~ie~~~  392 (766)
T Consensus       166 rnaglt~sg~kvihcSgyl---Kir~y~~~m~p~dscyqn~glvAvG~slP~saiteikl~-----------------sN  225 (598)
T KOG3559         166 RNAGLTCSGYKVIHCSGYL---KIRQYELDMSPNDSCYQNVGLVAVGHSLPPSAITEIKLH-----------------SN  225 (598)
T ss_pred             HCCCCCCCCCCEEEECCCC---EEEEEEECCCCCCCCCCCCEEEEECCCCCCCCCEEEEEC-----------------CC
T ss_conf             0246533686348605760---689965325877451000106995577895411478854-----------------65


Q ss_pred             HHEEEECCCCEEEEECHHHHHHHCCCHHHHCCCCCHHHHCCCHHHHHHHHHHHCCCCC--CCEEEEEEECCCEEEEEC
Q ss_conf             5515883499699701789888399978942897178816520137899985211245--640589991696287422
Q gi|254780903|r  393 EALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS--QDMSKEIKLADSRWLQIN  468 (766)
Q Consensus       393 ~~i~~~D~~g~i~~~N~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~e~~~~dg~~~~i~  468 (766)
T Consensus       226 mFmfraslDlkliF~D~rv~qltgYepqdliektLY~~ih~~D~~~lr~~H~~ll~kGqvtTkYYR~l~k~ggwvwvq  303 (598)
T KOG3559         226 MFMFRASLDLKLIFLDSRVHQLTGYEPQDLIEKTLYHHIHGCDSFHLRCAHHLLLVKGQVTTKYYRFLLKQGGWVWVQ  303 (598)
T ss_pred             EEEEEEECCEEEEEHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCCEEEEE
T ss_conf             079986211578850446788608994225667788875111288998888999861431407889877078539999