HHsearch alignment for GI: 254780903 and conserved domain: PRK10604

>PRK10604 sensor protein RstB; Provisional.
Probab=100.00  E-value=0  Score=380.91  Aligned_cols=234  Identities=20%  Similarity=0.328  Sum_probs=204.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999998878999999998767522247899999999860346889938999999999999999999977
Q gi|254780903|r  521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN  600 (766)
Q Consensus       521 ~L~~~~~~l~~~~~~ae~an~~k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~  600 (766)
T Consensus       190 Ei~~La~~FN~Ma~~l~~~~~~~r~f~a~vSHELRTPLt~i~~~lell~~----~~-~~e----~~~l~~~i~~l~~lv~  260 (433)
T PRK10604        190 SFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDN----LS-AAE----SQALNRDIGQLEALIE  260 (433)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCHHHHHHHHHHHHCC----CC-HHH----HHHHHHHHHHHHHHHH
T ss_conf             59999999999999999999999999874024431689999999997049----98-578----9999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCEEEECHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             76778887419830120331699999999999999998479589998089978998689999999998865653468988
Q gi|254780903|r  601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG  680 (766)
Q Consensus       601 diLd~srieag~~~~~~~~~dl~~~i~~~~~~~~~~~~~k~i~l~~~~~~~l~v~~D~~~l~QVl~NLi~NAik~t~~~g  680 (766)
T Consensus       261 ~lL~larl~~~~~~l~~~~~dl~~~i~~~~~~~~~~~~~~~i~l~~~-~~~~~~~~D~~~l~~~l~NLl~NA~kys--~~  337 (433)
T PRK10604        261 ELLTYARLDRPQNELHLSEPDLPAWLSTHLADIQAVTPEKTVRLKTP-HQGDYGALDMRLMERVLDNLLNNALRYS--HS  337 (433)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEECC-CCCCEEEECHHHHHHHHHHHHHHHHHCC--CC
T ss_conf             99999763689787877023699999999999997655996799717-9886698789999999999999998718--99


Q ss_pred             EEEEEEEEECCEEEEEEEECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEE
Q ss_conf             89999999799899999978897897785430465053146755677887616899999999629869999798995299
Q gi|254780903|r  681 KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV  760 (766)
Q Consensus       681 ~I~i~~~~~~~~v~i~V~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf  760 (766)
T Consensus       338 ~v~v~~~~~~~~~~i~V~D~G~GI~~e~~~~IFepFyR~d~sr~~~~gG~GLGLaIvk~Iv~~hgG~i~v~s~~~gGa~f  417 (433)
T PRK10604        338 TVETSLLLDGDQATLIVEDDGPGIAPEERERIFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGSVNCDTSELGGARF  417 (433)
T ss_pred             CEEEEEEEECCEEEEEEEECCCCCCHHHHHHHCCCCEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCEEEE
T ss_conf             78999999999999999977878898999986579452888889999961388999999999819989999669984799


Q ss_pred             EEECCC
Q ss_conf             997359
Q gi|254780903|r  761 TICMPQ  766 (766)
Q Consensus       761 ~i~LP~  766 (766)
T Consensus       418 ~i~LP~  423 (433)
T PRK10604        418 SFSWPV  423 (433)
T ss_pred             EEEECC
T ss_conf             999779