HHsearch alignment for GI: 254780903 and conserved domain: PRK11086

>PRK11086 sensory histidine kinase DcuS; Provisional.
Probab=100.00  E-value=0  Score=351.42  Aligned_cols=192  Identities=21%  Similarity=0.237  Sum_probs=148.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECH
Q ss_conf             99999987675222478999999998603468899389999999999999999999777677888741983012033169
Q gi|254780903|r  543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL  622 (766)
Q Consensus       543 k~efla~isHelrtPL~aI~g~~ell~~~~~~~~~~e~~~~~l~~I~~~~~~l~~lI~diLd~srieag~~~~~~~~~dl  622 (766)
T Consensus       338 ~~e~Lra~sHE~~n~L~~I~Gll~l~~--------~d~~~~~i~~~---~~~~~~~~~~l~~~i~----------~----  392 (541)
T PRK11086        338 YADALRAQSHEFMNKLHVILGLLHLKS--------YDQLEDYILKT---ANNYQEEIGSLLGKIK----------S----  392 (541)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCH--------HHHHHHHHHHH---HHHHHHHHHHHHHHCC----------C----
T ss_conf             999987611666405799988886430--------89999999999---9999999999998611----------6----


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEECCCCEEEECHH---HHHHHHHHHHHHHHHCCC--CCCEEEEEEEEECCEEEEEE
Q ss_conf             9999999999999998479589998089978998689---999999998865653468--98889999999799899999
Q gi|254780903|r  623 IPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR---IIKKILFPILSNSIKFTN--NNGKMMIRTSKIGQCVIITI  697 (766)
Q Consensus       623 ~~~i~~~~~~~~~~~~~k~i~l~~~~~~~l~v~~D~~---~l~QVl~NLi~NAik~t~--~~g~I~i~~~~~~~~v~i~V  697 (766)
T Consensus       393 -p~la~~Llgk~~~a~E~gi~L~i~~~~~l~~~~~~~~~~~l~tVlgNLidNAi~A~~~~~~g~V~v~l~~~~~~l~i~V  471 (541)
T PRK11086        393 -PVIAGFLLGKISRARELGITLIISEDSQLPDSDDEDQVHELITILGNLIENALEAVSNEEGGEISVSLHYRHGWLHIEV  471 (541)
T ss_pred             -HHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCEEEEEE
T ss_conf             -8889999988999996698599706776778886466657999999999999997316899679999998899899999


Q ss_pred             EECCCCCCHHHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEECCC
Q ss_conf             978897897785430465053146755677887616899999999629869999798995299997359
Q gi|254780903|r  698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ  766 (766)
Q Consensus       698 ~D~G~GI~~e~~~~iF~pF~q~~~~~t~~~~GtGLGLaI~k~iVe~hgG~I~v~S~~g~Gttf~i~LP~  766 (766)
T Consensus       472 ~D~G~GI~~e~~~~IFerg~-----St-K~~g~GLGLaIvk~iVe~~gG~I~veS~~g~GT~Fti~LP~  534 (541)
T PRK11086        472 SDDGPGIAPEEIEAIFDKGY-----ST-KGSNRGVGLYLVKQSVENLGGSIAVESEPGIGTQFFVQIPW  534 (541)
T ss_pred             EECCCCCCHHHHHHHCCCCC-----CC-CCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCEEEEEEECC
T ss_conf             97798859779988717987-----41-89991103999999999859989999669993799999606