HHsearch alignment for GI: 254780903 and conserved domain: pfam08447

>pfam08447 PAS_3 PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.
Probab=96.11  E-value=0.02  Score=35.38  Aligned_cols=75  Identities=9%  Similarity=0.204  Sum_probs=46.0

Q ss_pred             EEEECHHHHHHHCCCHHHHCCCC--CHHHHCCCHHHHHHHHHH---HCCCCCCCEEEEEEECCC--EEEEECCEEC--CC
Q ss_conf             99701789888399978942897--178816520137899985---211245640589991696--2874223245--69
Q gi|254780903|r  404 LVMCNANYQKAYGLPDHVLVPGN--ARSIIQDAQTRPIIEYRT---SDPERSQDMSKEIKLADS--RWLQINEWCT--HD  474 (766)
Q Consensus       404 i~~~N~~~~~~~g~~~~~~~~~~--~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~e~~~~dg--~~~~i~~~~~--~d  474 (766)
T Consensus         1 v~y~s~~~~~i~G~~~~e~~~~~~~~~~~ihpdD~~~~~~~~~~~~~~~~~~~~~e~R~~~~dG~~~wi~~~~~~~~d~~   80 (90)
T pfam08447         1 IIYWSPRFEEILGYTPEELKSSYEDWLDLVHPEDRERVRRALQEFSLKKGEPYSGEYRIRRKDGEYRWVEARGRPIRDEN   80 (90)
T ss_pred             CEEECHHHHHHHCCCCHHCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEEEEECCC
T ss_conf             99999899998499901107998899987190568899988788886058740468999815993999999999999999


Q ss_pred             CCEE
Q ss_conf             9789
Q gi|254780903|r  475 GGTI  478 (766)
Q Consensus       475 g~~v  478 (766)
T Consensus        81 G~~~   84 (90)
T pfam08447        81 GKPV   84 (90)
T ss_pred             CCEE
T ss_conf             9999