BLAST/PSIBLAST alignment of GI: 254780903 and GI: 222085322 at iteration 1
>gi|222085322|ref|YP_002543852.1| two-component sensor histidine kinase protein [Agrobacterium radiobacter K84] Length = 771
>gi|221722770|gb|ACM25926.1| two-component sensor histidine kinase protein [Agrobacterium radiobacter K84] Length = 771
 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/720 (51%), Positives = 501/720 (69%), Gaps = 3/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + IP++ + FL+ +A S    + T + +      Q + +   A    F N+   F   
Sbjct: 50  LKRVIPVLIVSFLMVVAASHFFSMVTEHGRMAASARQATSLSIAAAAAAFSNDASLFRAG 109

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
            + +AE  L   L + R    +F+LL Q +  VF SS   S+YIG  I +  PE+S  RS
Sbjct: 110 DRDEAERKLSTYLPQDRLDPGAFVLLVQASGRVFGSSAAGSNYIGLTISDFFPEVSAIRS 169

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGS-ILIINSRVPLLRLWREEVTLEVVFFSIIS 226
                 + E  +D  PY+  +++L  + G  +L   S   + +LWR+E+TL V  F+ IS
Sbjct: 170 FGDHAGVIETMIDGAPYYA-AISLIGDKGDFVLSAASMEQIDKLWRDELTLNVTLFAGIS 228

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ++LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+F +++F  SRSMY+
Sbjct: 229 SILLVILYAYYTQVKRTRDADEIFLESNMRVETALSRGRCGLWDFDFASREFFWSRSMYD 288

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P  ++ LSF    RL+H D+  +  +ARS+T  +  Q+DQI  +RHA G  +W++ 
Sbjct: 289 MLGLPAADRPLSFADAERLMHPDDNSLHTLARSITRGNAGQVDQILRIRHAKGHYVWMRA 348

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT SG +++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVM
Sbjct: 349 RAQVIRTNSGRVHMIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVM 408

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN ++Q+AYGLP+ VLVPG  R+++  A  RPIIE R  DP RS    + E++LAD RWL
Sbjct: 409 CNDHFQQAYGLPNGVLVPGTERAVVNAAAARPIIERRIVDPGRSNHSQTTEVQLADERWL 468

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDIT LK NQ +LRES+RRL ATINDLS SRQILERQK ELS A
Sbjct: 469 QINERRTRDGGLVSVGTDITQLKRNQERLRESERRLMATINDLSASRQILERQKAELSTA 528

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N  Y  EKERAE ANK KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS +Y EYA
Sbjct: 529 NTNYLAEKERAEAANKAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSSRYNEYA 588

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DIH SG+HLLN+IN+IL+MSKIE   I +  +  DL P+I E +RL    A  KNI +E
Sbjct: 589 KDIHDSGKHLLNVINDILDMSKIEAGHIKLSCEKIDLAPLIEECLRLTSIPAACKNIHVE 648

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           + I S +   AD+R +K+IL  +LSNS+KFTNN G++ +RT K+   V++TIADTGIGIP
Sbjct: 649 QSISSGIKLTADRRAMKQILLNLLSNSVKFTNNGGRIAVRTRKVDDAVVLTIADTGIGIP 708

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           KSAL KIGQPFE + +QY +S GG GLGLAIS +LT LH GR++I S+EG GT++ I +P
Sbjct: 709 KSALSKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTLLHHGRMRIRSREGIGTVIAIRIP 768