BLAST/PSIBLAST alignment of GI: 254780903 and GI: 307309665 at iteration 1
>gi|307309665|ref|ZP_07589317.1| multi-sensor signal transduction histidine kinase [Sinorhizobium meliloti BL225C] Length = 775
>gi|307319462|ref|ZP_07598889.1| multi-sensor signal transduction histidine kinase [Sinorhizobium meliloti AK83] Length = 775
>gi|306894834|gb|EFN25593.1| multi-sensor signal transduction histidine kinase [Sinorhizobium meliloti AK83] Length = 775
>gi|306899877|gb|EFN30500.1| multi-sensor signal transduction histidine kinase [Sinorhizobium meliloti BL225C] Length = 775
 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/720 (48%), Positives = 499/720 (69%), Gaps = 2/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK-FDL 106
             ++IP++ + FL+ +A S +  +   +A+ E  + +T  +   A   +FQ    + F  
Sbjct: 53  LKRSIPVLIIAFLLIVAISRMSGIMDEHARMEASSRRTVSLAAAAAAGVFQTGGSELFAE 112

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
             + + E  L + L      +  F+L  + +  VFA +    H IG+ +  I PE++  +
Sbjct: 113 GRRWEVERRLTEFLPAEILDAGIFLLTVRRDGRVFAGTQDGVHLIGRTLSAIAPEVATLQ 172

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
              +   +  AS+D   + +    LP + G++L   S       WR+E++L V  F+ +S
Sbjct: 173 YYGEGASVVRASIDGTEHFIALRQLPDSGGAVLAATSIARFEAAWRDEISLNVTLFAGVS 232

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           A+L+ +L++YY QAK+ ++ D +  E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE
Sbjct: 233 AILMVVLYAYYIQAKRTRDADAVFAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYE 292

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+  +   LSF   ARL+H +++ I  +AR++   + +Q+DQ+F MRHA G  +W++ 
Sbjct: 293 MLGMQGDASVLSFGDAARLMHVEDRGIYRVARAIAKGNERQIDQVFRMRHADGHYVWLRA 352

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT+SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVM
Sbjct: 353 RAQVIRTVSGRTHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVM 412

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN +YQ+A+ LPDHVLVPG  R+I+  A  RP++E R +DP+RS    + E++LAD RWL
Sbjct: 413 CNTHYQQAWQLPDHVLVPGTERTIVHAAAARPVVERRIADPDRSNHSQTSEVQLADERWL 472

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITLLK +Q +LRES+RRL ATI DLS SR  LE+QK ELSIA
Sbjct: 473 QINERRTRDGGLVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRVTLEQQKAELSIA 532

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE AN+ KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY+
Sbjct: 533 NANYQAEKERAEAANRAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYS 592

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DI  SG+HLLN+IN+IL+MSKIE   + I ++  DL P+I E +R     A+ KNI++ 
Sbjct: 593 RDIFESGKHLLNVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAERKNIRVV 652

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP
Sbjct: 653 QQISSGLTMFADRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIP 712

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           K AL+KIGQPFE + +QY +S GG GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 713 KGALQKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTRLHGGTMKIHSAENVGTIISVRIP 772