BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780903|ref|YP_003065316.1| two-component sensor histidine
kinase protein [Candidatus Liberibacter asiaticus str. psy62]
         (766 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040580|gb|ACT57376.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 766

 Score = 1582 bits (4097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/766 (100%), Positives = 766/766 (100%)

Query: 1   MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL 60
           MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL
Sbjct: 1   MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL 60

Query: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120
           VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL
Sbjct: 61  VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL 120

Query: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180
           AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD
Sbjct: 121 AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD 180

Query: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240
           QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA
Sbjct: 181 QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA 240

Query: 241 KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300
           KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR
Sbjct: 241 KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR 300

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
           AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI
Sbjct: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH
Sbjct: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
           VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV
Sbjct: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN
Sbjct: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN
Sbjct: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI
Sbjct: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI 660

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH
Sbjct: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
Sbjct: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766


>gi|315122620|ref|YP_004063109.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496022|gb|ADR52621.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 709

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/709 (70%), Positives = 602/709 (84%)

Query: 58  VFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLG 117
           +FLV +A SSIIKV T+YAQQE+M +QT+L+LTE+IE +F+N++++F   S+KKAES+L 
Sbjct: 1   MFLVLVAASSIIKVNTKYAQQEQMIHQTTLLLTESIESLFKNSSVQFKPESKKKAESILN 60

Query: 118 QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEA 177
           + L K +  S++FILLAQ N LVFASST NS YIG+KI EIIPEL    S SKT Q SE 
Sbjct: 61  EFLLKIQPFSKAFILLAQSNGLVFASSTDNSPYIGEKISEIIPELHPLTSMSKTAQTSEV 120

Query: 178 SLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYY 237
            L Q+PYHV S+ LP+N G +L+ NS++PLL  WR EVTLEV+FF+ ISA+LLF+L SYY
Sbjct: 121 FLSQEPYHVSSILLPNNDGLVLVANSKLPLLHFWRTEVTLEVIFFASISAILLFLLCSYY 180

Query: 238 RQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           +Q K  +ENDT LLEAN C+ETALSRGRCG+W+FN  +KKFHLS+SM EI+GIP  +KTL
Sbjct: 181 KQIKSTEENDTNLLEANTCIETALSRGRCGIWDFNLASKKFHLSQSMCEILGIPATHKTL 240

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
           SFR IARL+H+D K+I +IARS+T  H  QLD+IF + +++G D+WI+VRAQ+M T+SGG
Sbjct: 241 SFRTIARLVHFDGKEIYDIARSITKGHSTQLDKIFRVHYSTGRDVWIKVRAQVMNTLSGG 300

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
           MN+IGIAMD+TE+Y+LEKRYAE DQRLSKAIECTSE+ VLWDKNDRLVMCNA YQ+ YGL
Sbjct: 301 MNVIGIAMDVTEQYYLEKRYAEVDQRLSKAIECTSESFVLWDKNDRLVMCNAKYQQVYGL 360

Query: 418 PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
           PDHVL+PG  RSII +AQ  P++EY TSDP+R Q++SKEIKL DSRWLQINEW T D GT
Sbjct: 361 PDHVLIPGTKRSIINEAQINPVVEYYTSDPKRLQNISKEIKLVDSRWLQINEWHTPDAGT 420

Query: 478 ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
           ISVGTDIT LK NQ +LRES+RRLKATINDLSTSRQILERQKTELSIANAKYQ EKERAE
Sbjct: 421 ISVGTDITQLKRNQKKLRESERRLKATINDLSTSRQILERQKTELSIANAKYQTEKERAE 480

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            AN+ KSEFLAKMSHELRTPLNAILGFSE+IK E FG+LGSVKYYEY +DIH SG+HLLN
Sbjct: 481 MANRAKSEFLAKMSHELRTPLNAILGFSEIIKGETFGKLGSVKYYEYVKDIHDSGKHLLN 540

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNAD 657
           +INNILEMSKIE+E I+I+K+N +LIPIINE ++ I SSAQ KNI IEK I  ELF NAD
Sbjct: 541 LINNILEMSKIESEHIAINKKNTNLIPIINESLQSIASSAQKKNIMIEKNISPELFCNAD 600

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
           +RIIKKIL PI SNSIKFTNN GKM+++TS++   VIIT+ADTGIGIPKSAL+K+G+PFE
Sbjct: 601 ERIIKKILTPIFSNSIKFTNNGGKMIVQTSRVNDSVIITVADTGIGIPKSALKKVGKPFE 660

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            LHNQYDQ+ GG GLGLAISDALTNLHGG+L+I+SQEG+GT++ I MP+
Sbjct: 661 QLHNQYDQNTGGSGLGLAISDALTNLHGGKLEILSQEGEGTVIKIGMPK 709


>gi|86356937|ref|YP_468829.1| two-component sensor histidine kinase protein [Rhizobium etli CFN
           42]
 gi|86281039|gb|ABC90102.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CFN 42]
          Length = 767

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/755 (49%), Positives = 520/755 (68%), Gaps = 7/755 (0%)

Query: 17  GNRQKITVSSKQAFKRAYTS------IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ + +       ++ HL        +TIP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRNSLSGHAASEPLLRHLPKAELILKRTIPALIVAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           +   YA+ E      + +       +F + +  FD     +A++ L + L + R  S +F
Sbjct: 71  MMNEYARLEASARHATALSAATASAVFADASQIFDSGDIGQAQTRLAKYLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + ++WREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLEEISQVWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KTL F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTLGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIANGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQEAYGLPDSVLVPGTERSI 430

Query: 431 IQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
           +  A  RP+IE R +D + S   + E++LAD RWLQINE  T DGG +SVGTDITL+K +
Sbjct: 431 VNAAAARPVIERRVADADGS-GRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKRH 489

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           Q +LRES+RRL ATI DLS SRQ LE QK ELS ANA YQ EKERAE ANK KSEFLA M
Sbjct: 490 QERLRESERRLMATIGDLSASRQTLELQKAELSTANANYQAEKERAEAANKAKSEFLANM 549

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE 
Sbjct: 550 SHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIEA 609

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILS 670
             + + ++  DL+P+I E +R     A  KNI IE++I S L   AD+R +K++L  +LS
Sbjct: 610 GHLKLHRERIDLVPLIEESLRFTAIPAAEKNIVIEQRISSGLTLTADRRAMKQVLLNLLS 669

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT++ G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S GG 
Sbjct: 670 NAVKFTDDGGRIAVRTRRVDGAVFVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGGS 729

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 730 GLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 764


>gi|209548532|ref|YP_002280449.1| multi-sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534288|gb|ACI54223.1| multi-sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 769

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/756 (48%), Positives = 519/756 (68%), Gaps = 7/756 (0%)

Query: 17  GNRQKITVSSKQAFKRAYTS------IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ + +       ++ HL        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRDSLSGHATSEPLLRHLPKAELLLKRAIPALIVAFLFVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F + +  FD     +A++ L + L + R  S +F
Sbjct: 71  MVSEYSRLEASARHATALSAATASAVFADTSEIFDSGDIAEAQARLARFLPQDRLDSGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P++     
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVPHYAEITL 190

Query: 191 LPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTIL 250
           + +  G I+   S   + RLWRE++ L V  F+ IS++LL IL++YY Q K+ ++ D I 
Sbjct: 191 MGNAGGYIVAATSLDEISRLWREQLALNVTLFAGISSILLVILYAYYTQVKRARDADDIF 250

Query: 251 LEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN 310
           LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+
Sbjct: 251 LESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDD 310

Query: 311 KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEK 370
             + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG +++IGIAMD+TE+
Sbjct: 311 GGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRVHLIGIAMDVTEQ 370

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSI 430
           + L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI
Sbjct: 371 HRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSI 430

Query: 431 IQDAQTRPIIEYRTSDPER-SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
           +  A  RP+IE R +D +      + E++LAD RWLQINE  T DGG +SVGTDITL+K 
Sbjct: 431 VNAAAARPVIERRIADADGPGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKR 490

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +Q +LRES+RRL ATI DLS SRQ LE QK+ELS ANA YQ EKERAE ANK KSEFLA 
Sbjct: 491 HQERLRESERRLMATIGDLSASRQTLEIQKSELSTANANYQAEKERAEAANKAKSEFLAN 550

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKIE
Sbjct: 551 MSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKIE 610

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPIL 669
              + +  +  DL+P+I E +R     A  KNI I+++I S L   AD+R +K++L  +L
Sbjct: 611 AGHLRLHCERIDLVPLIEESLRFTAIPAAEKNIVIDQRISSGLTLTADRRAMKQVLLNLL 670

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN++KFT+N G++ +RT +I   V++TIADTGIGIP+SAL KIGQPFE + +QY +S GG
Sbjct: 671 SNAVKFTDNGGRIAVRTRRIDGAVLVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKGG 730

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 731 SGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 766


>gi|327193951|gb|EGE60826.1| putative two-component sensor histidine kinase protein [Rhizobium
           etli CNPAF512]
          Length = 769

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/757 (48%), Positives = 519/757 (68%), Gaps = 9/757 (1%)

Query: 17  GNRQKITVSSKQAFKRAYTS------IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ + +       ++ HL        + IP + + FL  +A S    
Sbjct: 11  GGRLRVDFDGLKAWRDSLSGHPTSEPLLRHLPKAELILKRAIPALIIAFLSVVAASHFFG 70

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F +    FD     +A++ L + L + R    +F
Sbjct: 71  MMSEYSRLEASARHATALSAATASAVFADAADIFDSGDITQAQARLARYLPQDRLDDGAF 130

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P H   + 
Sbjct: 131 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVP-HYAEIT 189

Query: 191 LPHNSGSILIINSRVP-LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
           L  N+G  ++  + +  + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I
Sbjct: 190 LMGNAGGFVVAATSLEEVGRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDI 249

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
            LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D
Sbjct: 250 FLESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPD 309

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           +  + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE
Sbjct: 310 DGGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTE 369

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RS
Sbjct: 370 QHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERS 429

Query: 430 IIQDAQTRPIIEYRTSDPERSQ-DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           I+  A  RP+IE R +D + S    + E++LAD RWLQINE  T DGG +SVGTDITL+K
Sbjct: 430 IVNAAAARPVIERRIADADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMK 489

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SRQ LE QK ELS ANA YQ EKERAE ANK KSEFLA
Sbjct: 490 RHQERLRESERRLMATIGDLSASRQTLELQKAELSTANANYQAEKERAEAANKAKSEFLA 549

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA+DIH SG+HLLN+IN+IL+MSKI
Sbjct: 550 NMSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYARDIHDSGKHLLNVINDILDMSKI 609

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + + ++  DL+P+I E +R     A  KNI IE++I S +   AD+R +K++L  +
Sbjct: 610 EAGHLRLHRERIDLVPLIEESLRFTAIPAAEKNIVIEQRICSGMALMADRRAMKQVLLNL 669

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFT+N G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S G
Sbjct: 670 LSNAVKFTDNGGRIAVRTRRVDGAVTVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKG 729

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 730 GSGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 766


>gi|190891008|ref|YP_001977550.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652]
 gi|190696287|gb|ACE90372.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 652]
          Length = 761

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/757 (48%), Positives = 520/757 (68%), Gaps = 9/757 (1%)

Query: 17  GNRQKITVSSKQAFKRAYTS------IISHLFSFFSSFNQTIPMISMVFLVFIATSSIIK 70
           G R ++     +A++ + +       ++ HL        + IP + + FL  +A S    
Sbjct: 3   GGRLRVDFDGLKAWRDSLSGHPTSEPLLRHLPKAELILKRAIPALIVAFLSVVAASHFFG 62

Query: 71  VTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF 130
           + + Y++ E      + +       +F + +  FD     +A++ L + L + R    +F
Sbjct: 63  MMSEYSRLEASARHATALSAATASAVFADASDIFDSGDITQAQARLARYLPQDRLDDGAF 122

Query: 131 ILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVN 190
           +LL Q +  VFA++T    ++G  +G+  PE+S  R       + E ++   P H   + 
Sbjct: 123 VLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFGDRAGVIETTIGGVP-HYAEIT 181

Query: 191 LPHNSGSILIINSRVP-LLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
           L  N+G  ++  + +  + RLWREE+ L V  F+ IS++LL IL++YY Q K+ ++ D I
Sbjct: 182 LMGNAGGFVVAATSLEEVGRLWREELALNVTLFAGISSILLVILYAYYTQVKRARDADDI 241

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
            LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D
Sbjct: 242 FLESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPD 301

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE 369
           +  + EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE
Sbjct: 302 DGGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTE 361

Query: 370 KYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS 429
           ++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RS
Sbjct: 362 QHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERS 421

Query: 430 IIQDAQTRPIIEYRTSDPERSQ-DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           I+  A  RP+IE R +D + S    + E++LAD RWLQINE  T DGG +SVGTDITL+K
Sbjct: 422 IVNAAAARPVIERRIADADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMK 481

Query: 489 HNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLA 548
            +Q +LRES+RRL ATI DLS SRQ LE QK+ELS ANA YQ EKERAE ANK KSEFLA
Sbjct: 482 RHQERLRESERRLMATIGDLSASRQTLEIQKSELSTANANYQAEKERAEAANKAKSEFLA 541

Query: 549 KMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKI 608
            MSHELRTPLNAILGFSE+++ ++FG LGS KY EYA+DIH SG+HLLN+I++IL+MSKI
Sbjct: 542 NMSHELRTPLNAILGFSEILQNQMFGPLGSAKYDEYARDIHDSGKHLLNVISDILDMSKI 601

Query: 609 ETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPI 668
           E   + + ++  DL+P+I E +R     A  KNI I+++I S L   AD+R +K++L  +
Sbjct: 602 EAGHLKLHRERIDLVPLIEESLRFTAIPAAEKNILIDQRISSGLTLTADRRAMKQVLLNL 661

Query: 669 LSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           LSN++KFT+N G++ +RT ++   V +TIADTGIGIP+SAL KIGQPFE + +QY +S G
Sbjct: 662 LSNAVKFTDNGGRIAVRTRRVDGAVTVTIADTGIGIPRSALSKIGQPFEQVQSQYAKSKG 721

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAIS +LT LHGGR+KI S+E  GT++++ +P
Sbjct: 722 GSGLGLAISRSLTALHGGRMKIRSREAVGTVISLRIP 758


>gi|241203816|ref|YP_002974912.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857706|gb|ACS55373.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 769

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/720 (50%), Positives = 505/720 (70%), Gaps = 3/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + IP + + FL  +A S    + + Y + E      + +       +F + +  FD  
Sbjct: 48  LKRAIPALIVAFLSVVAASHFFGMMSEYGRLEASARHATALSAATASAVFADASDIFDSG 107

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
               A++ L + L + R  S +F+LL Q +  VFA++T    ++G  +G+  PE+S  R 
Sbjct: 108 DITGAQARLAKYLPQDRLDSGAFVLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRR 167

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP-LLRLWREEVTLEVVFFSIIS 226
                 + E ++   P H   + L  N+G  ++  + +  + RLWREE+ L V  F+ IS
Sbjct: 168 FGDRAGVIETTIGGVP-HYAEITLMGNAGGYIVAATSLDEIGRLWREELALNVTLFAGIS 226

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ++LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+
Sbjct: 227 SILLVILYAYYTQVKRARDADDIFLESNLRVETALSRGRCGLWDFDFENREFFWSRSMYD 286

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P  +KT+ F   ARL+H D+  + EIAR++      Q+DQIF MRHA G  +W++ 
Sbjct: 287 MLGLPGSDKTMGFGEAARLMHPDDGGLYEIARAIGKGASGQVDQIFRMRHAGGHYVWMRA 346

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++R+ SG M++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVM
Sbjct: 347 RAQVIRSNSGRMHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVM 406

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ-DMSKEIKLADSRWL 465
           CN ++Q+AYGLPD VLVPG  RS +  A  RP+IE R SD + S    + E++LAD RWL
Sbjct: 407 CNTHFQQAYGLPDSVLVPGTERSTVNAAAARPVIERRISDADGSGYSRTTEVQLADERWL 466

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITL+K +Q +LRES+RRL ATI DLS SRQ LE QK+ELS A
Sbjct: 467 QINERRTRDGGRVSVGTDITLMKRHQERLRESERRLMATIGDLSASRQTLEIQKSELSTA 526

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N+ YQ EKERAE ANK KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA
Sbjct: 527 NSNYQAEKERAEAANKAKSEFLANMSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYA 586

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DIH SG+HLLN+IN+IL+MSKIE   + +  +  DL+P+I E +R     A  KNI IE
Sbjct: 587 RDIHDSGKHLLNVINDILDMSKIEAGHVRLHCERIDLVPLIEESLRFTAMPAAEKNIVIE 646

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFT+N G++ +RT ++   V++TIADTGIGIP
Sbjct: 647 QRICSGLTLMADRRAMKQVLLNLLSNAVKFTDNGGRIAVRTRRVDGAVVVTIADTGIGIP 706

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +SAL KIGQPFE + +QY +S GG GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 707 RSALSKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 766


>gi|116251211|ref|YP_767049.1| two component sensor histidine kinase transcriptional regulatory
           protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255859|emb|CAK06940.1| putative two component sensor histidine kinase transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 769

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/720 (50%), Positives = 503/720 (69%), Gaps = 3/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + IP + + FL  +A S    + + Y + E      + +       +F +    FD  
Sbjct: 48  LKRAIPALIVAFLSVVAASHFFGMMSEYGRLEASARHATALSAATASAVFADAADIFDSG 107

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
               A++ L + L + R  S +F+LL Q +  VFA++T    ++G  +G+  PE+S  R 
Sbjct: 108 DITGAQARLAKYLPQDRLDSGAFVLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRR 167

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLL-RLWREEVTLEVVFFSIIS 226
                 + E ++   P H   + L  N+G  ++  + +  + RLWREE+ L V  F+ IS
Sbjct: 168 FGDRADVIETTIGGVP-HYAEITLMGNAGGYIVAATSLDEIDRLWREELALNVTLFAGIS 226

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ++LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+
Sbjct: 227 SILLVILYAYYTQVKRARDADDIFLESNLRVETALSRGRCGLWDFDFENREFFWSRSMYD 286

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P  +KT+ F   ARL+H D+  + EIAR++      Q+DQIF MRHA G  +W++ 
Sbjct: 287 MLGLPGSDKTMGFGEAARLMHPDDGGLYEIARAIGKGSSGQVDQIFRMRHAGGHYVWMRA 346

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++R+ SG M++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVM
Sbjct: 347 RAQVIRSNSGRMHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVM 406

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ-DMSKEIKLADSRWL 465
           CN ++Q+AYGLPD VLVPG  RS +  A  RP+IE R SD + S    + E++LAD RWL
Sbjct: 407 CNTHFQQAYGLPDSVLVPGTERSTVNAAAARPVIERRISDADGSGYSRTTEVQLADERWL 466

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITL+K +Q +LRES+RRL ATI DLS SRQ LE QK+ELS A
Sbjct: 467 QINERRTRDGGRVSVGTDITLMKRHQERLRESERRLMATIGDLSASRQTLEIQKSELSTA 526

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE ANK KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS+KY EYA
Sbjct: 527 NANYQAEKERAEAANKAKSEFLANMSHELRTPLNAILGFSEILQNQMFGPLGSLKYDEYA 586

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DIH SG+HLLN+IN+IL+MSKIE   + +  +  DL+P+I E +R     A  KNI IE
Sbjct: 587 RDIHDSGKHLLNVINDILDMSKIEAGHVRLHCERIDLVPLIEESLRFTAMPAAEKNIVIE 646

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFT+N G++ +RT ++   V +TIADTGIGIP
Sbjct: 647 QRICSGLTLMADRRAMKQVLLNLLSNAVKFTDNGGRIALRTRRVDGAVFVTIADTGIGIP 706

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +SAL KIGQPFE + +QY +S GG GLGLAIS +LT+LHGGR+KI S+E  GT++++ +P
Sbjct: 707 RSALSKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTSLHGGRMKIRSREAVGTVISLRIP 766


>gi|222085322|ref|YP_002543852.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
 gi|221722770|gb|ACM25926.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
          Length = 771

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/720 (51%), Positives = 501/720 (69%), Gaps = 3/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + IP++ + FL+ +A S    + T + +      Q + +   A    F N+   F   
Sbjct: 50  LKRVIPVLIVSFLMVVAASHFFSMVTEHGRMAASARQATSLSIAAAAAAFSNDASLFRAG 109

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
            + +AE  L   L + R    +F+LL Q +  VF SS   S+YIG  I +  PE+S  RS
Sbjct: 110 DRDEAERKLSTYLPQDRLDPGAFVLLVQASGRVFGSSAAGSNYIGLTISDFFPEVSAIRS 169

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGS-ILIINSRVPLLRLWREEVTLEVVFFSIIS 226
                 + E  +D  PY+  +++L  + G  +L   S   + +LWR+E+TL V  F+ IS
Sbjct: 170 FGDHAGVIETMIDGAPYYA-AISLIGDKGDFVLSAASMEQIDKLWRDELTLNVTLFAGIS 228

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ++LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+F +++F  SRSMY+
Sbjct: 229 SILLVILYAYYTQVKRTRDADEIFLESNMRVETALSRGRCGLWDFDFASREFFWSRSMYD 288

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P  ++ LSF    RL+H D+  +  +ARS+T  +  Q+DQI  +RHA G  +W++ 
Sbjct: 289 MLGLPAADRPLSFADAERLMHPDDNSLHTLARSITRGNAGQVDQILRIRHAKGHYVWMRA 348

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT SG +++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKNDRLVM
Sbjct: 349 RAQVIRTNSGRVHMIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRLVM 408

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN ++Q+AYGLP+ VLVPG  R+++  A  RPIIE R  DP RS    + E++LAD RWL
Sbjct: 409 CNDHFQQAYGLPNGVLVPGTERAVVNAAAARPIIERRIVDPGRSNHSQTTEVQLADERWL 468

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDIT LK NQ +LRES+RRL ATINDLS SRQILERQK ELS A
Sbjct: 469 QINERRTRDGGLVSVGTDITQLKRNQERLRESERRLMATINDLSASRQILERQKAELSTA 528

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N  Y  EKERAE ANK KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS +Y EYA
Sbjct: 529 NTNYLAEKERAEAANKAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSSRYNEYA 588

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DIH SG+HLLN+IN+IL+MSKIE   I +  +  DL P+I E +RL    A  KNI +E
Sbjct: 589 KDIHDSGKHLLNVINDILDMSKIEAGHIKLSCEKIDLAPLIEECLRLTSIPAACKNIHVE 648

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           + I S +   AD+R +K+IL  +LSNS+KFTNN G++ +RT K+   V++TIADTGIGIP
Sbjct: 649 QSISSGIKLTADRRAMKQILLNLLSNSVKFTNNGGRIAVRTRKVDDAVVLTIADTGIGIP 708

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           KSAL KIGQPFE + +QY +S GG GLGLAIS +LT LH GR++I S+EG GT++ I +P
Sbjct: 709 KSALSKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTLLHHGRMRIRSREGIGTVIAIRIP 768


>gi|150395865|ref|YP_001326332.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           medicae WSM419]
 gi|150027380|gb|ABR59497.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           medicae WSM419]
          Length = 772

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/720 (48%), Positives = 501/720 (69%), Gaps = 2/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK-FDL 106
             ++IP++ + FL+ +A S +  +   +A+ E  + +T  +   A     Q +  + F  
Sbjct: 50  LKRSIPVLIIAFLLIVAISRMSGMMDEHARMEASSRRTVSLTAAAAAGALQPDGPEIFTD 109

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
             + + E  L + L      +   +L  + +  VFAS+   +H +G+ +  + PE++  +
Sbjct: 110 VRRWEIEQRLTEFLPADMLDAGIILLTVRRDGRVFASTQDGAHLVGRTLSAVAPEVATLQ 169

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
              +   +  AS+D   + +    LPH+ G++L   S       WR+E++L V  F+ +S
Sbjct: 170 YYGEGAGIVRASVDGVDHFIALRQLPHSGGAVLAATSIASFEAAWRDEISLNVTLFAGVS 229

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           A+L+ +L++YY QAK+ ++ D I  E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE
Sbjct: 230 AILMVVLYAYYIQAKRARDADAIFAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYE 289

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P +   LSF   ARL+H D++ I  +AR++     +Q+DQ+F MRHA G  +W++ 
Sbjct: 290 MLGMPGDASVLSFGDAARLMHVDDRGIYRVARAIARGSERQIDQVFRMRHADGHYVWLRA 349

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT+SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVM
Sbjct: 350 RAQVIRTVSGRTHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVM 409

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN ++Q+A+ LPDHVLVPG  R+I+Q A  RP++E R +DP+RS    + E++LAD RWL
Sbjct: 410 CNTHFQQAWQLPDHVLVPGTERTIVQAAAARPVVERRIADPDRSNHSQTSEVQLADERWL 469

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITLLK +Q +LRES+RRL ATI DLS SR  LE+QK ELS+A
Sbjct: 470 QINERRTRDGGLVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRITLEQQKAELSVA 529

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE AN+ KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY+
Sbjct: 530 NANYQAEKERAEAANRAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYS 589

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DI  SG+HLLN+IN+IL+MSKIE   + I ++  DL P+I E +R     A+ KNI++ 
Sbjct: 590 RDIFESGKHLLNVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAEQKNIRVV 649

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           +++ S L   AD+R +K++L  +LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP
Sbjct: 650 QQVSSGLTMFADRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIP 709

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + AL+KIGQPFE + +QY +S GG GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 710 RDALQKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTRLHGGSIKIHSTENVGTIISVRIP 769


>gi|307309665|ref|ZP_07589317.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
 gi|307319462|ref|ZP_07598889.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306894834|gb|EFN25593.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306899877|gb|EFN30500.1| multi-sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
          Length = 775

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/720 (48%), Positives = 499/720 (69%), Gaps = 2/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK-FDL 106
             ++IP++ + FL+ +A S +  +   +A+ E  + +T  +   A   +FQ    + F  
Sbjct: 53  LKRSIPVLIIAFLLIVAISRMSGIMDEHARMEASSRRTVSLAAAAAAGVFQTGGSELFAE 112

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
             + + E  L + L      +  F+L  + +  VFA +    H IG+ +  I PE++  +
Sbjct: 113 GRRWEVERRLTEFLPAEILDAGIFLLTVRRDGRVFAGTQDGVHLIGRTLSAIAPEVATLQ 172

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
              +   +  AS+D   + +    LP + G++L   S       WR+E++L V  F+ +S
Sbjct: 173 YYGEGASVVRASIDGTEHFIALRQLPDSGGAVLAATSIARFEAAWRDEISLNVTLFAGVS 232

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           A+L+ +L++YY QAK+ ++ D +  E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE
Sbjct: 233 AILMVVLYAYYIQAKRTRDADAVFAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYE 292

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+  +   LSF   ARL+H +++ I  +AR++   + +Q+DQ+F MRHA G  +W++ 
Sbjct: 293 MLGMQGDASVLSFGDAARLMHVEDRGIYRVARAIAKGNERQIDQVFRMRHADGHYVWLRA 352

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT+SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVM
Sbjct: 353 RAQVIRTVSGRTHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVM 412

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN +YQ+A+ LPDHVLVPG  R+I+  A  RP++E R +DP+RS    + E++LAD RWL
Sbjct: 413 CNTHYQQAWQLPDHVLVPGTERTIVHAAAARPVVERRIADPDRSNHSQTSEVQLADERWL 472

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITLLK +Q +LRES+RRL ATI DLS SR  LE+QK ELSIA
Sbjct: 473 QINERRTRDGGLVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRVTLEQQKAELSIA 532

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE AN+ KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY+
Sbjct: 533 NANYQAEKERAEAANRAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYS 592

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DI  SG+HLLN+IN+IL+MSKIE   + I ++  DL P+I E +R     A+ KNI++ 
Sbjct: 593 RDIFESGKHLLNVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAERKNIRVV 652

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP
Sbjct: 653 QQISSGLTMFADRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIP 712

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           K AL+KIGQPFE + +QY +S GG GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 713 KGALQKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTRLHGGTMKIHSAENVGTIISVRIP 772


>gi|15964778|ref|NP_385131.1| putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|15073956|emb|CAC45597.1| Putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
          Length = 772

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/720 (48%), Positives = 499/720 (69%), Gaps = 2/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIK-FDL 106
             ++IP++ + FL+ +A S +  +   +A+ E  + +T  +   A   +FQ    + F  
Sbjct: 50  LKRSIPVLIIAFLLIVAISRMSGIMDEHARMEASSRRTVSLAAAAAAGVFQTGGSELFAE 109

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
             + + E  L + L      +  F+L  + +  VFA +    H IG+ +  I PE++  +
Sbjct: 110 GRRWEVERRLTEFLPAEILDAGIFLLTVRRDGRVFAGTQDGVHLIGRTLSAIAPEVATLQ 169

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
              +   +  AS+D   + +    LP + G++L   S       WR+E++L V  F+ +S
Sbjct: 170 YYGEGASVVRASIDGTEHFIALRQLPDSGGAVLAATSIARFEAAWRDEISLNVTLFAGVS 229

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           A+L+ +L++YY QAK+ ++ D +  E+N+ VETALSRGRCGLW+F+ DN++   SRSMYE
Sbjct: 230 AILMVVLYAYYIQAKRTRDADAVFAESNLRVETALSRGRCGLWDFDLDNRRLFWSRSMYE 289

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+  +   LSF   ARL+H +++ I  +AR++   + +Q+DQ+F MRHA G  +W++ 
Sbjct: 290 MLGMQGDASVLSFGDAARLMHVEDRGIYRVARAIAKGNERQIDQVFRMRHADGHYVWLRA 349

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT+SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVM
Sbjct: 350 RAQVIRTVSGRTHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKHDRLVM 409

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN +YQ+A+ LPDHVLVPG  R+I+  A  RP++E R +DP+RS    + E++LAD RWL
Sbjct: 410 CNTHYQQAWQLPDHVLVPGTERTIVHAAAARPVVERRIADPDRSNHSQTSEVQLADERWL 469

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QINE  T DGG +SVGTDITLLK +Q +LRES+RRL ATI DLS SR  LE+QK ELSIA
Sbjct: 470 QINERRTRDGGLVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRVTLEQQKAELSIA 529

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE AN+ KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS KY+EY+
Sbjct: 530 NANYQAEKERAEAANRAKSEFLANMSHELRTPLNAILGFSEILQDQMFGPLGSEKYHEYS 589

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DI  SG+HLLN+IN+IL+MSKIE   + I ++  DL P+I E +R     A+ KNI++ 
Sbjct: 590 RDIFESGKHLLNVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAERKNIRVV 649

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP
Sbjct: 650 QQISSGLTMFADRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIP 709

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           K AL+KIGQPFE + +QY +S GG GLGLAIS +LT LHGG +KI S E  GTI+++ +P
Sbjct: 710 KGALQKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTRLHGGTMKIHSAENVGTIISVRIP 769


>gi|227821363|ref|YP_002825333.1| two component sensor kinase [Sinorhizobium fredii NGR234]
 gi|227340362|gb|ACP24580.1| two component sensor kinase [Sinorhizobium fredii NGR234]
          Length = 775

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/720 (48%), Positives = 502/720 (69%), Gaps = 2/720 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             ++IP++ + FL+ +A S +  +   +A+ E  + +T  +   A    FQ +  +    
Sbjct: 53  LKRSIPVLIIAFLLIVALSRMSGIMDEHARMEASSRRTVSLAATAATAAFQADGSELFAD 112

Query: 108 SQK-KAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
            Q+ + E  L + L      +  F+L  + +  +FAS+   +H+IG+ +  I P+++  +
Sbjct: 113 GQRWETERRLAEYLPAELLDTGMFLLTVRRDGRIFASTQDGAHFIGRTLTSIAPDIASLQ 172

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
              +      A++D   + V  + +P ++G +L           WR++V+L V  F+ IS
Sbjct: 173 YCGEGSGAIRATIDGVEHLVALMQVPASAGVVLAATPVAQFEAAWRDDVSLNVTLFAGIS 232

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           A+LL +L++YY QAK+ ++ D++  E+N+ VETALSRGRCGLW+F+  N++   SRSMYE
Sbjct: 233 AILLVVLYAYYIQAKRARDADSVFAESNLRVETALSRGRCGLWDFDLANRRLFWSRSMYE 292

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           ++G+P ++  LSF   ARL+H +++ +  +AR++     +Q+DQ+F MRHA G  +W++ 
Sbjct: 293 MLGMPGDSSVLSFGDAARLMHPEDRGVYRVARAIAKGSERQIDQVFRMRHADGHYVWLRA 352

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT+SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDK+DRLVM
Sbjct: 353 RAQVIRTVSGKTHLIGIAMDVTEQHRLAQRYAEADQRLTDAIECTSEAFVLWDKHDRLVM 412

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS-QDMSKEIKLADSRWL 465
           CN +YQ+AY LPDHVLVPG  R+++  A  RP++E R +DP+RS    + E++LAD RWL
Sbjct: 413 CNTHYQQAYQLPDHVLVPGTERAVVHAAAARPVVERRVADPDRSNHSQTSEVQLADERWL 472

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QIN+  T DGG +SVGTDITLLK +Q +LRES+RRL ATI DLS SR  LERQK ELS+A
Sbjct: 473 QINDRRTRDGGLVSVGTDITLLKRHQVRLRESERRLMATIGDLSASRITLERQKAELSVA 532

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           NA YQ EKERAE AN+ KSEFLA MSHELRTPLNAILGFSE+++ ++FG LGS KY EY+
Sbjct: 533 NANYQAEKERAEAANRAKSEFLANMSHELRTPLNAILGFSEILQNQMFGPLGSEKYDEYS 592

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +DIH SG+HLLN+IN+IL+MSKIE   + I ++  DL P+I E +R     A+ KNI++ 
Sbjct: 593 RDIHESGKHLLNVINDILDMSKIEAGHMRITRERIDLAPLIEETLRFTTIPAEQKNIRVV 652

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           ++I S L   AD+R +K++L  +LSN++KFTN  G++ +R  K+   V +TIAD+GIGIP
Sbjct: 653 QEISSGLTMFADRRAMKQVLLNLLSNAVKFTNEGGRISLRARKVRGAVTLTIADSGIGIP 712

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + AL+KIG PFE + +QY +S GG GLGLAIS +LT LHGGR+KI S E  GTI+++ +P
Sbjct: 713 RYALQKIGHPFEQVQSQYAKSKGGSGLGLAISRSLTRLHGGRMKIHSAEKVGTIISVRIP 772


>gi|15888325|ref|NP_354006.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
 gi|15155995|gb|AAK86791.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
          Length = 778

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/717 (47%), Positives = 490/717 (68%), Gaps = 3/717 (0%)

Query: 52  IPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKK 111
           IP++ + FLV +A S ++ +   Y + E+    ++ +     +    NN+  F    + +
Sbjct: 54  IPILILAFLVVVAASRMLGIAAEYGRMEEAARHSTALTALTAKAALLNNDTIFTAQDRTR 113

Query: 112 AESMLGQLLAKTRFLSESFILLAQPNELVFASSTKN-SHYIGKKIGEIIPELSRSRSRSK 170
           AE+ L   L        + +LL+  N  +FA + K  S Y+G  +  ++PE++  +    
Sbjct: 114 AEASLVAALPSGSLADGTMVLLSGSNGRIFAGAGKEASLYVGTSLPALLPEIAIVQRFPG 173

Query: 171 TVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLL 230
           T    E ++D Q ++   +    +   ++   S  P+   WR E+ + V  F+ IS++LL
Sbjct: 174 TPGTIETNIDGQQHYATMIPFGDDGAMVIAARSLQPIRSFWRSEIAMNVTLFAGISSILL 233

Query: 231 FILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGI 290
            +L++YY Q K+ ++ D I  E+N+ VETALSRGRCGLW+F+  +++   S S+YEI+G+
Sbjct: 234 VVLYAYYMQVKRARDADDIFAESNLRVETALSRGRCGLWDFDLSSRRMFWSGSLYEILGL 293

Query: 291 PYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQM 350
           P +   LSF   AR++H ++  + E+AR+V   +++Q+DQIF MRH+ G  +W++ RAQ+
Sbjct: 294 PPKAAPLSFSDAARMMHSEDGNLYELARAVGCGNLRQIDQIFRMRHSKGHYVWLRARAQV 353

Query: 351 MRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
           +RT + G  +IGIAMD+TE++ L +RYAEADQRL+ AIE TSEA VLWDKNDRLVMCN +
Sbjct: 354 IRT-NNGPRVIGIAMDVTEQHRLAQRYAEADQRLADAIESTSEAFVLWDKNDRLVMCNIH 412

Query: 411 YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ-DMSKEIKLADSRWLQINE 469
           YQKAYGLPD VLV G  +S +  A  RP++E R +DP++S    + E++LAD RWLQINE
Sbjct: 413 YQKAYGLPDSVLVAGTEKSTVYAAAARPVVERRVADPDQSGLSRTTEVQLADDRWLQINE 472

Query: 470 WCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKY 529
             T DGG +SVGTDITLLK +Q +LR+S+RRL ATI DLS S+  LERQKTELS ANA Y
Sbjct: 473 RRTRDGGLVSVGTDITLLKRHQERLRDSERRLMATIGDLSASQHKLERQKTELSDANANY 532

Query: 530 QVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIH 589
             EKERA+ AN+ KSEFLA MSHELRTPLNAILGFSE+++ E+FG +GS KY EYA+DIH
Sbjct: 533 LAEKERAQAANRAKSEFLANMSHELRTPLNAILGFSEILQNEMFGPVGSPKYSEYARDIH 592

Query: 590 YSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP 649
            SG+HLLN+IN+IL+MSKIE   + I+++  DL P+I E +RL    A+ KNI +++K+ 
Sbjct: 593 DSGKHLLNVINDILDMSKIEAGHMRINRETIDLAPLIEETLRLTAIQAEQKNITVQQKVC 652

Query: 650 SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSAL 709
           + L    D+R +K+I+  ILSN++KFT + G++ +RT      +I+TIADTGIGIP  AL
Sbjct: 653 AGLTMQGDRRAMKQIMLNILSNAVKFTGDGGRIALRTHVHEAAMILTIADTGIGIPAQAL 712

Query: 710 EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           +KIGQPFE + +QY +S GG GLGLAIS +L  LHGG +KI S EG+GT+VTI +P 
Sbjct: 713 QKIGQPFEQVQSQYAKSQGGSGLGLAISRSLVKLHGGTMKIRSCEGRGTVVTIIIPH 769


>gi|325292361|ref|YP_004278225.1| two component sensor kinase [Agrobacterium sp. H13-3]
 gi|325060214|gb|ADY63905.1| two component sensor kinase [Agrobacterium sp. H13-3]
          Length = 775

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/722 (48%), Positives = 492/722 (68%), Gaps = 5/722 (0%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + IP++ + FLV IA S ++ +   Y++ E+    ++ +     +    NN I F   
Sbjct: 47  LKRLIPILILAFLVVIAASRMLGIVAEYSRMEEAARHSTALTALTAKAALINNGIVFASQ 106

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH-YIGKKIGEIIPELSRSR 166
            + +AE+ L   L        + +LL+  N  +FA + K +  YIG  +  ++PE++  +
Sbjct: 107 ERARAEASLAAALPSGSLADGTMVLLSGSNGRIFAGAGKGATLYIGTSLPALLPEIAIVQ 166

Query: 167 SRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIIS 226
                    E ++D QP++   +    + G ++   S  P+   WR E+ + V  F+ IS
Sbjct: 167 RFPGAPGTIETNIDNQPHYATMIPFGDDGGMVIAARSLEPIRSFWRSEIAMNVTLFAGIS 226

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ++LL +L++YY Q K+ ++ D I  E+N+ VETALSRGRCGLW+F+   ++   S S+YE
Sbjct: 227 SILLVVLYAYYMQVKRARDADDIFAESNLRVETALSRGRCGLWDFDLSTRRMFWSGSLYE 286

Query: 287 IMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQV 346
           I+G P +   LSF   AR++H ++  + E+AR+V    ++Q+DQIF MRHA G  +W++ 
Sbjct: 287 ILGRPPKAAPLSFSDAARMMHSEDGNLYELARAVGCGDLRQIDQIFRMRHAKGHYVWLRA 346

Query: 347 RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM 406
           RAQ++RT + G  +IGIAMD+TE++ L +RYAEADQRL+ AIE TSEA VLWDKNDRLVM
Sbjct: 347 RAQVIRT-NNGPRVIGIAMDVTEQHRLAQRYAEADQRLADAIESTSEAFVLWDKNDRLVM 405

Query: 407 CNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLADSRW 464
           CN +YQKAYGLPD VLV G  +S +Q A  RP++E R +DP++S  +S+  E++LAD RW
Sbjct: 406 CNTHYQKAYGLPDSVLVAGTEKSAVQAAAARPVVERRVADPDQS-GLSRMTEVQLADDRW 464

Query: 465 LQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSI 524
           LQINE  T DGG +SVGTDITLLK +Q +LR+S+RRL ATI DLS S+  LERQKTELS 
Sbjct: 465 LQINERRTRDGGLVSVGTDITLLKRHQERLRDSERRLMATIGDLSASQHKLERQKTELSD 524

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           ANA Y  EKERA+ AN  KSEFLA MSHELRTPLNAILGFS++++ E+FG +GS KY EY
Sbjct: 525 ANANYLAEKERAQAANLAKSEFLANMSHELRTPLNAILGFSDILQNEMFGPVGSPKYSEY 584

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
           A+DIH SG+HLLN+IN+IL+MSKIE   + I+++  DL P+I E +RL    A+ KNI +
Sbjct: 585 ARDIHDSGKHLLNVINDILDMSKIEAGHMRINRETIDLAPLIEETLRLTAIQAEQKNITV 644

Query: 645 EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
           ++K+ + L    D+R +K+I+  +LSN++KFT N G++ +RT      +I+TIADTGIGI
Sbjct: 645 QQKVCAGLTMQGDRRAMKQIMLNLLSNAVKFTGNGGRVALRTHVHQAAMILTIADTGIGI 704

Query: 705 PKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           P  AL+KIGQPFE + +QY +S GG GLGLAIS +L  LHGG +KI S EG+GT+VTI +
Sbjct: 705 PAEALDKIGQPFEQVQSQYAKSQGGSGLGLAISRSLVRLHGGTMKIRSCEGRGTVVTIII 764

Query: 765 PQ 766
           P 
Sbjct: 765 PH 766


>gi|222148029|ref|YP_002548986.1| two component sensor kinase [Agrobacterium vitis S4]
 gi|221735017|gb|ACM35980.1| two component sensor kinase [Agrobacterium vitis S4]
          Length = 790

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/724 (48%), Positives = 494/724 (68%), Gaps = 7/724 (0%)

Query: 46  SSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEK-MTNQTSLMLTEAIEIIFQNNNIKF 104
           ++  Q IP++ + FL+ IA +  + + + YA+ E  + + T++M + A   +     +  
Sbjct: 48  AALRQVIPILVVAFLIVIAMARGMGLVSEYARMESAIRHSTAMMASAAAAALSSGPELPA 107

Query: 105 DLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSR 164
           +L  + KAE+++ + L       ESF+LL  P   V ASS   S ++G +I  + P+++ 
Sbjct: 108 ELG-RDKAEALIKRFLPPNLLDDESFVLLLDPEGRVVASSGNGSSFVGMQIMALFPQVAV 166

Query: 165 SRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILII--NSRVPLLRLWREEVTLEVVFF 222
            R+     Q      D   +  ++V  P  +   L++  +S       WR E+ L V  F
Sbjct: 167 LRNFGD--QTGAVETDINGFRHIAVLTPTGTDGALVLAAHSLKSAADYWRAELALNVTLF 224

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
           S IS +L+ IL++Y+ QAK+ +E   + +++N  VETALSRGRCGLW+F+  ++K   SR
Sbjct: 225 SAISLILMGILYAYFAQAKRARETSDVFVDSNRRVETALSRGRCGLWDFDLASRKLVWSR 284

Query: 283 SMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
           SM++I+G+P  N+ L F   ARL+H D+  +  +AR++     + +DQ+F MRHA+G  +
Sbjct: 285 SMFDILGLPPSNEPLGFADAARLMHPDDGNLYALARTIGRDGDRHIDQVFRMRHANGHYV 344

Query: 343 WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           W++ RAQ++RT SG  ++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKND
Sbjct: 345 WLRARAQVIRTSSGSPHVIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKND 404

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQDMSKEIKLAD 461
           RLVMCNA++Q  YGLPD VLVPG  R+++  A  RPII+ R +DP  +    + E++LAD
Sbjct: 405 RLVMCNAHFQHVYGLPDSVLVPGVERAVVDAAAARPIIQRRIADPSAKGSSRTTELQLAD 464

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            RWLQINE  T DGG +SVGTDITLLK +Q +LRE +RRL ATI DLS+S++ LERQK E
Sbjct: 465 ERWLQINERRTRDGGLVSVGTDITLLKRHQERLREQERRLMATIGDLSSSQKKLERQKAE 524

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
           LS AN KY  EK+RAE ANK KSEFLA MSHELRTPLNAILGFSE++   +FG +GS KY
Sbjct: 525 LSEANEKYLAEKQRAEAANKAKSEFLANMSHELRTPLNAILGFSEILSTGMFGPIGSPKY 584

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
            EYA+DIH SG+HLLN+IN+IL+MSKIE   + +  +N D   +I+E +RL   SA+ KN
Sbjct: 585 GEYARDIHDSGKHLLNVINDILDMSKIEAGHMLLKCENVDFASLIDETLRLTTISAKDKN 644

Query: 642 IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           I IE++I S L   AD+R +K+IL  ILSN++KFTN  G++ +R  KI   V + ++DTG
Sbjct: 645 IAIEQRIASGLAMTADRRALKQILLNILSNAVKFTNEGGRISVRAHKIDGAVRLLVSDTG 704

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGIPK A+ KIGQPFE + +QY +S GG GLGLAIS +L  LHGG L+I S+EGKGT+V+
Sbjct: 705 IGIPKQAISKIGQPFEQVQSQYAKSKGGSGLGLAISRSLIMLHGGSLRIRSREGKGTVVS 764

Query: 762 ICMP 765
           I +P
Sbjct: 765 INVP 768


>gi|163759100|ref|ZP_02166186.1| putative sensor histidine kinase transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162283504|gb|EDQ33789.1| putative sensor histidine kinase transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 795

 Score =  612 bits (1577), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 318/777 (40%), Positives = 491/777 (63%), Gaps = 20/777 (2%)

Query: 1   MENMQNILANYGLYY---PGNRQ----KITVSSKQAFKRAYTSII-SHLFSFFSSFNQTI 52
           M + Q+I A  G  +   PG R+    +++  +K   + AY  +I +  F       + I
Sbjct: 1   MADAQSISAAEGSSHVQKPGARRSSGRQLSGHAKLFAQPAYDGLINAEPF-----LKRLI 55

Query: 53  PMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQK-- 110
           P++ + FL+ +AT+  + +      ++++ +    M   ++       +I  D  ++K  
Sbjct: 56  PVLIVAFLLVVATARFLNINE---NRDQLFSAAEQMTALSLAAASAALSIDTDPVAKKLR 112

Query: 111 -KAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRS 169
            + E+ L + L         ++L+      +FA++   +H +G  +  ++ E S      
Sbjct: 113 WETEARLNRALGAMPEDQGRYLLVIDAEARIFAATAGGNHLVGTVLSSLLSESSPLWLFG 172

Query: 170 KTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALL 229
           +   +     D +        LP  +G++L +     +   WR+ V++ V  F   S++L
Sbjct: 173 ERAGVQSIRFDGEDSLAALTRLPDGAGALLSLTPVKTMNDAWRQSVSVNVTLFIATSSIL 232

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
           L IL++Y+ QA + +E D+I  E+   V+ ALSRGRCGLW+++    + + SRSMYEI+G
Sbjct: 233 LVILYAYFSQAGRAQEADSIYHESQRRVDMALSRGRCGLWDWDMARGRLYWSRSMYEILG 292

Query: 290 IPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQ 349
           +   +  +SF   ++L+H D+  + EIAR V    +KQ+D +F MRHA+G  +W++ RAQ
Sbjct: 293 LKPRDTVISFGEASQLVHPDDGDLYEIARKVASGDIKQVDHLFRMRHANGHYLWMRARAQ 352

Query: 350 MMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNA 409
           ++   S   ++IGIAMD+TE++ L++R  EADQRL  AIE TSEA VLWD+++RLV+ N 
Sbjct: 353 VVDPTSAETHLIGIAMDVTEQHRLQQRTMEADQRLFDAIESTSEAFVLWDRDERLVLWNK 412

Query: 410 NYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP-ERSQDMSKEIKLADSRWLQIN 468
           +YQ+ +GLP  +L PG  R +++ A TRP++E R + P  R    + E++L D RWLQIN
Sbjct: 413 HYQEIHGLPADILAPGTPRPVVEKAATRPVVERRLAVPCARDSAQTFEVQLGDGRWLQIN 472

Query: 469 EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
           E  T DGG +SVGTDIT LK NQ +LR+S++RL ATI DL++S+  L+R+  ELS  N  
Sbjct: 473 ERKTRDGGLVSVGTDITPLKRNQERLRDSEKRLMATIGDLTSSQAELKRKAAELSELNMD 532

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
           YQVE ERAE A++ KSEFLA MSHELRTPLNAI+GFSEV++  +FG LGS KY EYA DI
Sbjct: 533 YQVETERAEAASRAKSEFLANMSHELRTPLNAIIGFSEVLQARMFGPLGSDKYGEYADDI 592

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
           H SG HLL +IN+IL+M+KIE  ++ +++++ DL P++ E +RL+   A+ K+I+++++I
Sbjct: 593 HNSGIHLLTVINDILDMAKIEAGQMQLEREDVDLAPLLKETLRLVAIQAEQKDIRVDQRI 652

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
            ++L  NAD+R +K+IL  +LSN++KFT   GK+++R  K    V +TI DTGIGIPK+ 
Sbjct: 653 SAKLSLNADRRAMKQILLNLLSNAVKFTEPGGKILVRARKTSCAVTLTIEDTGIGIPKAL 712

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           L +IGQPFE + NQ+ +S GG GLGLAIS +L  LHGG +K+ S EG GTIV++ +P
Sbjct: 713 LNRIGQPFEQVQNQFSKSTGGSGLGLAISRSLAELHGGAMKVRSIEGMGTIVSVRVP 769


>gi|153009989|ref|YP_001371204.1| multi-sensor signal transduction histidine kinase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561877|gb|ABS15375.1| multi-sensor signal transduction histidine kinase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 784

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 277/651 (42%), Positives = 412/651 (63%), Gaps = 13/651 (1%)

Query: 122 KTRFLSESFILLA--QPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           ++R LS S + LA   P   V A S   S   GK +  I+ E       ++   + +  L
Sbjct: 123 RSRGLSSSGMTLAVIDPQSSVVAISGPISDLSGKPVDTILTEAQPLFLFAERAGVLKVML 182

Query: 180 DQQP-YHVLS--VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
             +P +  LS  + LP+   S++ +     +   WR  V+L V  F+  + ++  IL++Y
Sbjct: 183 QGEPAFGALSKPMTLPY---SVIAVEPESTIFAEWRRAVSLNVTLFAGTTGVMFAILYAY 239

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
           + QA + +E D +  +    ++ AL RGRCGLW+++    + + SRSMYE++G   ++  
Sbjct: 240 FSQAARAREADDLSGQIQRRIDLALGRGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAV 299

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG 356
           L F  +A +I+ ++  +  IA       +  +D++F MRHA G+ +W++VRA++     G
Sbjct: 300 LPFGDVAAIINTEDGDLYSIAEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EG 357

Query: 357 GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
            ++++GIA D++E++   ++ AEAD R+ +AIE  SEA +LWD N+RLVM N+ + +  G
Sbjct: 358 DLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENISEAFILWDSNNRLVMANSKFSEYAG 417

Query: 417 LPDHVLVPGNARSIIQDAQTRPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHD 474
           LP   L PG  R+ + DA TRP   E R ++   R+   + E +L+D RWLQ+NE  T D
Sbjct: 418 LPVWTLKPGVPRNEV-DAHTRPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQD 476

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GG +S+GTDIT LK +Q +L +S+RRL ATI+DLS +R+    +  ELS    KY  EKE
Sbjct: 477 GGLVSIGTDITQLKLHQERLVDSERRLMATIHDLSIARKGERDRVRELSELARKYGQEKE 536

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
           RAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  
Sbjct: 537 RAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNF 596

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
           LLN+IN+IL+MSKIE    S+D++  DL P+INE +R+I   A  KNI +  +I   +  
Sbjct: 597 LLNVINDILDMSKIEAGHFSLDREQIDLCPLINETVRMISLQADEKNIAVNTRIEEAMQL 656

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R IK++L  +LSN++KFT+  G++ +R  K G  + +TI DTG+GIPKSA++KIGQ
Sbjct: 657 YADRRAIKQVLINLLSNAVKFTSYGGQITVRARKTGSALFMTIQDTGVGIPKSAIKKIGQ 716

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           PFE + NQ+ ++  G GLGLAI+ +L  LHGG L+I S EG GT+V++C+P
Sbjct: 717 PFEQVENQFTKTHTGSGLGLAITRSLAELHGGWLRIRSTEGVGTVVSVCIP 767


>gi|239831458|ref|ZP_04679787.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
           3301]
 gi|239823725|gb|EEQ95293.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
           3301]
          Length = 783

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 274/651 (42%), Positives = 413/651 (63%), Gaps = 13/651 (1%)

Query: 122 KTRFLSESFILLA--QPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASL 179
           ++R LS   + LA       V A+S       GK +  I+ +       ++   + + +L
Sbjct: 123 RSRGLSSPGMTLAVIDGQSSVVAASGPGPDISGKPLDTILSDAQPLFLFAERAGVLKVTL 182

Query: 180 DQQP-YHVLS--VNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSY 236
             +P +  LS  ++LP+   SI+ +     +   WR  V+L V  F+  + ++  IL++Y
Sbjct: 183 QAEPAFGALSKPLSLPY---SIIAVEPESTIFAEWRRAVSLNVTLFAGTTGVMFAILYAY 239

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
           + QA + +E D +  +    ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  
Sbjct: 240 FSQAARAREADDLSGQIQRRIDLALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAV 299

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG 356
           L F  +A +I+ ++  +  IA       +  +D++F MRHA G+ +W++VRA++     G
Sbjct: 300 LPFGDVAAIINTEDGDLYSIAEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EG 357

Query: 357 GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG 416
            ++++GIA D++E++   ++ AEAD R+ +AIE  SEA +LWD N+RLVM N+ + +  G
Sbjct: 358 DLHLVGIAFDVSEQHRFAQQTAEADMRIREAIENISEAFILWDSNNRLVMANSKFSEYAG 417

Query: 417 LPDHVLVPGNARSIIQDAQTRPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHD 474
           LP   L PG  R+ + DA TRP   E R ++   R+   + E +L+D RWLQ+NE  T D
Sbjct: 418 LPVWTLKPGVPRNEV-DAHTRPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQD 476

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GG +S+GTDIT LK +Q +L +S+RRL ATI+DLS +R+    +  ELS    KY  EKE
Sbjct: 477 GGLVSIGTDITQLKLHQERLVDSERRLMATIHDLSIARKGERDRVRELSELARKYGQEKE 536

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
           RAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  
Sbjct: 537 RAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNF 596

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
           LLN+IN+IL+MSKIE    S+D++  DL P+INE +R+I   A  KNI +  +I   +  
Sbjct: 597 LLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVRMISLQADEKNIAVNTRIEDAMQL 656

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R IK++L  +LSN++KFT+  G++ +R  K G  + +TI DTG+GIPKSA++KIGQ
Sbjct: 657 YADRRAIKQVLINLLSNAVKFTSYGGQITVRARKTGSALFMTIQDTGVGIPKSAIKKIGQ 716

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           PFE + NQ+ ++  G GLGLAI+ +L  LHGG L+I S EG GT+V++C+P
Sbjct: 717 PFEQVENQFTKTHTGSGLGLAITRSLAELHGGWLRIRSTEGVGTVVSVCIP 767


>gi|294851985|ref|ZP_06792658.1| two-component system protein [Brucella sp. NVSL 07-0026]
 gi|294820574|gb|EFG37573.1| two-component system protein [Brucella sp. NVSL 07-0026]
          Length = 798

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 380/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 214 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSRQIQRR 273

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 274 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 333

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 334 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQ 391

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP  +L PG  R+ + DA T
Sbjct: 392 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWMLKPGVPRNEV-DAHT 450

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 451 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 510

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 511 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 570

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 571 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 630

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 631 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 690

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 691 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 750

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 751 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 781


>gi|225627123|ref|ZP_03785161.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
 gi|225617958|gb|EEH15002.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
          Length = 798

 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 214 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 273

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 274 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 333

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 334 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQ 391

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 392 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 450

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 451 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 510

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 511 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 570

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 571 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 630

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 631 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 690

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 691 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 750

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 751 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 781


>gi|237815075|ref|ZP_04594073.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
 gi|237789912|gb|EEP64122.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
          Length = 798

 Score =  522 bits (1344), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 214 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 273

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 274 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 333

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 334 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEI--ASEGDLHLVGIAFDVSEQHRFAQQ 391

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 392 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 450

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 451 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 510

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 511 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 570

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 571 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 630

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 631 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 690

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 691 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 750

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 751 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 781


>gi|306842114|ref|ZP_07474784.1| PAS domain S-box-containing protein [Brucella sp. BO2]
 gi|306287787|gb|EFM59215.1| PAS domain S-box-containing protein [Brucella sp. BO2]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|306845222|ref|ZP_07477798.1| PAS domain S-box-containing protein [Brucella sp. BO1]
 gi|306274381|gb|EFM56188.1| PAS domain S-box-containing protein [Brucella sp. BO1]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|254713753|ref|ZP_05175564.1| PAS domain S-box-containing protein [Brucella ceti M644/93/1]
 gi|254717189|ref|ZP_05179000.1| PAS domain S-box-containing protein [Brucella ceti M13/05/1]
 gi|261219005|ref|ZP_05933286.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M13/05/1]
 gi|261321495|ref|ZP_05960692.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M644/93/1]
 gi|260924094|gb|EEX90662.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M13/05/1]
 gi|261294185|gb|EEX97681.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M644/93/1]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|17987608|ref|NP_540242.1| sensory transduction protein kinase [Brucella melitensis bv. 1 str.
           16M]
 gi|23501503|ref|NP_697630.1| sensory box histidine kinase [Brucella suis 1330]
 gi|62289578|ref|YP_221371.1| histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|148559697|ref|YP_001258609.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
 gi|161618591|ref|YP_001592478.1| multi-sensor signal transduction histidine kinase [Brucella canis
           ATCC 23365]
 gi|225852141|ref|YP_002732374.1| PAS domain S-box-containing protein [Brucella melitensis ATCC
           23457]
 gi|254688899|ref|ZP_05152153.1| PAS domain S-box-containing protein [Brucella abortus bv. 6 str.
           870]
 gi|254697031|ref|ZP_05158859.1| PAS domain S-box-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701410|ref|ZP_05163238.1| PAS domain S-box-containing protein [Brucella suis bv. 5 str. 513]
 gi|254703955|ref|ZP_05165783.1| PAS domain S-box-containing protein [Brucella suis bv. 3 str. 686]
 gi|254707666|ref|ZP_05169494.1| PAS domain S-box-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|254709750|ref|ZP_05171561.1| PAS domain S-box-containing protein [Brucella pinnipedialis B2/94]
 gi|254729930|ref|ZP_05188508.1| PAS domain S-box-containing protein [Brucella abortus bv. 4 str.
           292]
 gi|256031240|ref|ZP_05444854.1| PAS domain S-box-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|256044318|ref|ZP_05447222.1| PAS domain S-box-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113155|ref|ZP_05454032.1| PAS domain S-box-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|256254648|ref|ZP_05460184.1| PAS domain S-box-containing protein [Brucella ceti B1/94]
 gi|256257147|ref|ZP_05462683.1| PAS domain S-box-containing protein [Brucella abortus bv. 9 str.
           C68]
 gi|256264347|ref|ZP_05466879.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|256369055|ref|YP_003106563.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260168376|ref|ZP_05755187.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|260563672|ref|ZP_05834158.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260566796|ref|ZP_05837266.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|260754384|ref|ZP_05866732.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 6 str. 870]
 gi|260757603|ref|ZP_05869951.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 4 str. 292]
 gi|260761429|ref|ZP_05873772.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260883409|ref|ZP_05895023.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 9 str. C68]
 gi|261221823|ref|ZP_05936104.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           B1/94]
 gi|261315163|ref|ZP_05954360.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M163/99/10]
 gi|261317281|ref|ZP_05956478.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis B2/94]
 gi|261751949|ref|ZP_05995658.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 5 str. 513]
 gi|261754607|ref|ZP_05998316.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 3 str. 686]
 gi|261757836|ref|ZP_06001545.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|265988319|ref|ZP_06100876.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M292/94/1]
 gi|265990730|ref|ZP_06103287.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265994568|ref|ZP_06107125.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 3 str. Ether]
 gi|297247993|ref|ZP_06931711.1| two-component system, PleD family, sensor histidine kinase PleC
           [Brucella abortus bv. 5 str. B3196]
 gi|17983316|gb|AAL52506.1| sensory transduction protein kinase [Brucella melitensis bv. 1 str.
           16M]
 gi|23347410|gb|AAN29545.1| sensory box histidine kinase [Brucella suis 1330]
 gi|62195710|gb|AAX74010.1| histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|148370954|gb|ABQ60933.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
 gi|161335402|gb|ABX61707.1| multi-sensor signal transduction histidine kinase [Brucella canis
           ATCC 23365]
 gi|225640506|gb|ACO00420.1| PAS domain S-box-containing protein [Brucella melitensis ATCC
           23457]
 gi|255999215|gb|ACU47614.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260153688|gb|EEW88780.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|260156314|gb|EEW91394.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|260667921|gb|EEX54861.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 4 str. 292]
 gi|260671861|gb|EEX58682.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|260674492|gb|EEX61313.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 6 str. 870]
 gi|260872937|gb|EEX80006.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 9 str. C68]
 gi|260920407|gb|EEX87060.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           B1/94]
 gi|261296504|gb|EEY00001.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis B2/94]
 gi|261304189|gb|EEY07686.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M163/99/10]
 gi|261737820|gb|EEY25816.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|261741702|gb|EEY29628.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 5 str. 513]
 gi|261744360|gb|EEY32286.1| multi-sensor signal transduction histidine kinase [Brucella suis
           bv. 3 str. 686]
 gi|262765681|gb|EEZ11470.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263001514|gb|EEZ14089.1| multi-sensor signal transduction histidine kinase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094621|gb|EEZ18419.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660516|gb|EEZ30777.1| multi-sensor signal transduction histidine kinase [Brucella
           pinnipedialis M292/94/1]
 gi|297175162|gb|EFH34509.1| two-component system, PleD family, sensor histidine kinase PleC
           [Brucella abortus bv. 5 str. B3196]
 gi|326408641|gb|ADZ65706.1| PAS domain S-box-containing protein [Brucella melitensis M28]
 gi|326538363|gb|ADZ86578.1| PAS domain S-box-containing protein [Brucella melitensis M5-90]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|254693380|ref|ZP_05155208.1| PAS domain S-box-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261213630|ref|ZP_05927911.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 3 str. Tulya]
 gi|260915237|gb|EEX82098.1| multi-sensor signal transduction histidine kinase [Brucella abortus
           bv. 3 str. Tulya]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|254718765|ref|ZP_05180576.1| PAS domain S-box-containing protein [Brucella sp. 83/13]
 gi|265983743|ref|ZP_06096478.1| multi-sensor signal transduction histidine kinase [Brucella sp.
           83/13]
 gi|264662335|gb|EEZ32596.1| multi-sensor signal transduction histidine kinase [Brucella sp.
           83/13]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|82699508|ref|YP_414082.1| PAS domain-containing protein [Brucella melitensis biovar Abortus
           2308]
 gi|189023837|ref|YP_001934605.1| sensory box histidine kinase [Brucella abortus S19]
 gi|260545661|ref|ZP_05821402.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
 gi|82615609|emb|CAJ10596.1| PAS domain:PAC motif:ATP-binding region, ATPase-like:Histidine
           kinase A, N-terminal:Bacterial sensor protein,
           C-terminal:Hist [Brucella melitensis biovar Abortus
           2308]
 gi|189019409|gb|ACD72131.1| sensory box histidine kinase [Brucella abortus S19]
 gi|260097068|gb|EEW80943.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|256060749|ref|ZP_05450912.1| PAS domain S-box-containing protein [Brucella neotomae 5K33]
 gi|261324738|ref|ZP_05963935.1| multi-sensor signal transduction histidine kinase [Brucella
           neotomae 5K33]
 gi|261300718|gb|EEY04215.1| multi-sensor signal transduction histidine kinase [Brucella
           neotomae 5K33]
          Length = 783

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|163842891|ref|YP_001627295.1| PAS domain-containing protein [Brucella suis ATCC 23445]
 gi|163673614|gb|ABY37725.1| PAS domain S-box [Brucella suis ATCC 23445]
          Length = 783

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIALEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 435

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 436 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 495

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 496 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 555

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 556 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 615

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 616 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 675

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 676 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 735

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 736 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 766


>gi|306840195|ref|ZP_07472975.1| PAS domain S-box-containing protein [Brucella sp. NF 2653]
 gi|306404726|gb|EFM61025.1| PAS domain S-box-containing protein [Brucella sp. NF 2653]
          Length = 769

 Score =  521 bits (1342), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/571 (45%), Positives = 379/571 (66%), Gaps = 5/571 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 185 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 244

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 245 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 304

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 305 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 362

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQT 436
            AEAD R+ +AIE  SEA VLWD N+RLVM N+ + +  GLP   L PG  R+ + DA T
Sbjct: 363 TAEADMRIREAIENISEAFVLWDANNRLVMANSKFSEYAGLPVWTLKPGVPRNEV-DAHT 421

Query: 437 RPI-IEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
           RP   E R ++   R+   + E +L+D RWLQ+NE  T DGG +S+GTDIT LK +Q +L
Sbjct: 422 RPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQDGGMVSIGTDITQLKLHQERL 481

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +S+RRL AT++DLS +R+    +  ELS    KY +EKERAE AN+ KSEFLA MSHEL
Sbjct: 482 VDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKERAEAANRAKSEFLANMSHEL 541

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  LLN+IN+IL+MSKIE    S
Sbjct: 542 RTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNFLLNVINDILDMSKIEAGHFS 601

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIK 674
           +D++  DL P+INE +R+I   A+ KNI +E +I   +   AD+R IK++L  +LSN++K
Sbjct: 602 LDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMELYADRRAIKQVLINLLSNAVK 661

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQPFE + NQ+ ++  G GLGL
Sbjct: 662 FTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQPFEQVENQFTKTHTGSGLGL 721

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           AIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 722 AISRSLAELHGGWLRIRSTERVGTVVSVCIP 752


>gi|110633259|ref|YP_673467.1| multi-sensor signal transduction histidine kinase [Mesorhizobium
           sp. BNC1]
 gi|110284243|gb|ABG62302.1| multi-sensor signal transduction histidine kinase [Chelativorans
           sp. BNC1]
          Length = 774

 Score =  518 bits (1335), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 268/595 (45%), Positives = 393/595 (66%), Gaps = 6/595 (1%)

Query: 172 VQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLF 231
           VQ+ EA+     Y  +S+ LP   G+ + +  +  +   WR  V+L V  F++ + +L+ 
Sbjct: 176 VQIGEATW----YAAVSL-LPGGDGAAVALAPQDQVFGAWRSTVSLNVTLFALTAGVLMA 230

Query: 232 ILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIP 291
           IL++Y+ QA + +  D I  EA+  V+ AL RG+CGLW+++    K + S SMYE++G  
Sbjct: 231 ILYAYFSQAARAQAADRIYREAHQRVDLALVRGKCGLWDWDMARGKMYWSASMYEMLGYE 290

Query: 292 YENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM 351
             +  LSF  +A L+H D+  +  +A  +  + V+Q+DQ+F MRHA+G  IWI+ RAQ++
Sbjct: 291 AADVMLSFGDVASLLHPDDSDLFAVANRIVAREVEQVDQVFRMRHANGQWIWIRARAQVV 350

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY 411
              +  +++IGIA+D+TE+  L ++   ADQRL  AIE  +E+ VLWD ++RLVMCN+ Y
Sbjct: 351 DPDAPEIHLIGIAVDVTEQRTLVQQSEAADQRLRTAIENITESFVLWDASERLVMCNSRY 410

Query: 412 QKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR-TSDPERSQDMSKEIKLADSRWLQINEW 470
            +  GL    +VPG  R  I+        E R T     S+ ++ E +LAD RWLQ+ E 
Sbjct: 411 LQDTGLDPSEIVPGLPRQEIESRMKATRYERRLTGSNNASEGITYERQLADGRWLQVTEL 470

Query: 471 CTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
            T DGGT+SVGTDIT LK +Q +L ES+RRL ATI+DLS +R+  + +  EL   N KY 
Sbjct: 471 KTRDGGTVSVGTDITQLKQHQEKLVESERRLMATIHDLSLARRAEQERGQELVELNRKYM 530

Query: 531 VEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHY 590
            E ERAE+AN+ KSEFLA MSHELRTPLNAI+GFSE++++ +FG LGS +Y EY  DI+ 
Sbjct: 531 RETERAESANRAKSEFLANMSHELRTPLNAIIGFSELMQQGLFGPLGSERYQEYVNDIYS 590

Query: 591 SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPS 650
           SG +LL +IN+IL+MSKIE  + SI +++ DL  +I E +R++   A  KNI++   +P+
Sbjct: 591 SGTYLLGVINDILDMSKIEAGQFSIHRESIDLSEVIRETMRVVTLQAGKKNIELTSDVPA 650

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
            L  +AD+R +K+IL  +L N++KFT   G++ +R   +   +++TI DTG GIP+ AL+
Sbjct: 651 SLSLHADRRAVKQILINLLFNAVKFTGQGGRVTLRARVVSNSLMLTIKDTGCGIPREALK 710

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           K+G+PFE + NQY +S  G GLGLAIS +LT LHGG L+I S EG GTIV+I +P
Sbjct: 711 KLGRPFEQVENQYSRSHNGSGLGLAISRSLTELHGGALRIRSTEGVGTIVSIRLP 765


>gi|90420832|ref|ZP_01228737.1| putative histidine kinase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334807|gb|EAS48579.1| putative histidine kinase [Aurantimonas manganoxydans SI85-9A1]
          Length = 782

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 267/728 (36%), Positives = 434/728 (59%), Gaps = 19/728 (2%)

Query: 47  SFNQTIPMISMVFLVFIATSSIIKVTT----RYAQQE----KMTNQTSLMLTEAIEIIFQ 98
           +  ++IP++    + F+A +++I++ T    R A +E     +T  T+LM  E+  I   
Sbjct: 48  ALRRSIPIL---IVSFLALAAVIRLATLVEERMALEEGAVRDLTIATALMRAESHAIEAD 104

Query: 99  NNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
            + +         A     +LL   RF      +++  + ++ A+     + +G  +  +
Sbjct: 105 GDGVALAADLLASALPA--ELLRHGRF-----AVVSDSDGMIVAAMPGFENLVGGDLKRL 157

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLE 218
           I E        +   + +     +P  V S  L  N G +  +     LL  WR  V++ 
Sbjct: 158 IGEHQELLMFGERAGVQDTRFGSEPALVASARLADNQGILTFVQRETDLLSEWRHSVSVN 217

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           V  F++ S ++L +L++Y+RQA + ++ D + LE +  V+TALSRG CGLW+++    + 
Sbjct: 218 VTLFALTSTIMLVVLYAYFRQATRAQDADALYLETHQRVDTALSRGHCGLWDWDIARGRM 277

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS 338
           + SRSMYEI+ +   +  L+F  IA L+H D+  + E+AR V    +  LD++F MRH  
Sbjct: 278 YWSRSMYEILDLCPRDSVLAFGDIAPLMHPDDGSLFEVARQVAAGKITSLDRVFRMRHRD 337

Query: 339 GADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLW 398
           G+ +W++ RA++ RT    +++IG+A+D++E+  L +R  EA+ +L+ AIE  SE  VL 
Sbjct: 338 GSYVWLRARAEVSRTAENEVHLIGVAVDVSEQQELARRTDEANTQLNNAIENISETFVLC 397

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQDMSKEI 457
           D  DRLV+CN+ Y++ +GL +  +  G   + +     +PI  +  + P   S + + E 
Sbjct: 398 DSQDRLVLCNSKYRETFGLTEADVARGTPLATVMAKARKPIDSHAVTSPTFASGERASEA 457

Query: 458 KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILER 517
            L D RWL ++E  T D G +S+GTD+T LK +QA+L +S+RRL A I+DLS +R+  ER
Sbjct: 458 LLPDGRWLLLSERRTADDGFVSIGTDVTQLKLHQARLSDSERRLMAVIDDLSIARRDAER 517

Query: 518 QKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
           +  +L+  N  Y  EKERAETA+  K+ FLA MSHELRTPLNAILGFSE++++  FG +G
Sbjct: 518 KAVQLTEMNQNYAAEKERAETASSAKTTFLANMSHELRTPLNAILGFSEIMRQGTFGPIG 577

Query: 578 SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
             KY EYA+DIH SG +LL +IN+IL+M+KIE  ++ ++ +  DL  I  E  ++I   A
Sbjct: 578 CPKYGEYAEDIHQSGHYLLKLINDILDMAKIEAGRLVLNHETVDLSEIATETGKIIEVQA 637

Query: 638 QSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITI 697
             K I ++  +P  +    D+R  K+I+  +LSN++KFT+N G + ++   +G   +ITI
Sbjct: 638 DQKAICLDADVPERMELTVDRRATKQIVLNLLSNAVKFTDNGGTVKMKLRTVGDAALITI 697

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
           AD G+GIP++AL+ +G+PFE + N+  ++  G GLGLAI+ +L  L GGR++I SQ G+G
Sbjct: 698 ADNGMGIPRAALKSLGKPFEQIENELTRTNKGTGLGLAIARSLVALQGGRMRISSQVGEG 757

Query: 758 TIVTICMP 765
           TIV I +P
Sbjct: 758 TIVAIRLP 765


>gi|319784548|ref|YP_004144024.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170436|gb|ADV13974.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 773

 Score =  490 bits (1262), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 252/556 (45%), Positives = 368/556 (66%), Gaps = 1/556 (0%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           WR+ V+L V  F + + +L+ IL++Y+ QA + +  D I LEA+  ++ AL RGRCGLW+
Sbjct: 206 WRKTVSLNVTLFVLTAGVLIVILYAYFGQAARAQAADRIYLEAHQRIDMALVRGRCGLWD 265

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           ++    K + SRSMY+++G       LSF  + ++IH ++  + E+A  +  + +  +DQ
Sbjct: 266 WDMVRGKMYWSRSMYDMLGYKPCETMLSFGEVDQIIHPEDGDLFELANRIVAREIDHIDQ 325

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           +F MRHA G  +W++ RAQ++   +  + +IGIA+D+TE+ HL  R   AD RL  AIE 
Sbjct: 326 VFRMRHADGQWVWMRARAQVIDPEAPEIQLIGIAVDVTEQRHLALRSEAADLRLRTAIEN 385

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            +E+ VLWD    L+MCN+ YQ+  GL D  ++PG AR+ +++       E R +     
Sbjct: 386 INESFVLWDSTQHLIMCNSKYQQDNGLSDRDVMPGTARAALEERMLAFASERRLAHTSGL 445

Query: 451 QDMSK-EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
           Q  +  E +LAD RWLQ+NE  T DGG +SVG+DIT +K +Q +L +S+RRL ATI+DLS
Sbjct: 446 QGGATFERQLADGRWLQVNELKTRDGGIVSVGSDITQIKLHQEKLVDSERRLMATIHDLS 505

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            +R+  E +  EL   N KY  E ERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+++
Sbjct: 506 LARRAEEERSRELVDLNRKYMKETERAEAANRAKSEFLANMSHELRTPLNAIIGFSELME 565

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
           + +FG LGS +Y EYA DI+ SG++LL +IN+IL+MSKIE  + S+D++  DL P+I+E 
Sbjct: 566 QGLFGPLGSERYEEYATDINSSGKYLLGVINDILDMSKIEAGQFSLDREEIDLGPLISET 625

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           +R++   A  K I +E +I   L   AD+R IK+I+  +LSN++KFT + G + +R    
Sbjct: 626 VRVVSLQAAQKAISVETRIADALTLVADRRAIKQIVINLLSNAVKFTGHGGHISVRARNT 685

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              +++TI D G GIPK AL K+G+PFE + NQ+ +S  G GLGLAIS +L  L GG LK
Sbjct: 686 SGALVLTIEDNGCGIPKEALGKLGRPFEQVQNQFSKSHAGSGLGLAISRSLAELQGGALK 745

Query: 750 IISQEGKGTIVTICMP 765
           I S EG GTIV++ +P
Sbjct: 746 IRSSEGVGTIVSVRIP 761


>gi|260462368|ref|ZP_05810576.1| PAS/PAC sensor signal transduction histidine kinase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031862|gb|EEW33130.1| PAS/PAC sensor signal transduction histidine kinase [Mesorhizobium
           opportunistum WSM2075]
          Length = 773

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 251/556 (45%), Positives = 366/556 (65%), Gaps = 1/556 (0%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           WR+ V+L V  F + + +L+ IL++Y+ QA + +  D I LEA+  ++ AL RGRCGLW+
Sbjct: 206 WRKTVSLNVTLFVLTAGVLIIILYAYFGQAARAQAADRIYLEAHQRIDMALVRGRCGLWD 265

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           ++    K + SRSMY+++G       LSF  +  +IH ++  + E+A  +  + +  +DQ
Sbjct: 266 WDMVRGKMYWSRSMYDMLGYEPCETMLSFGEVDEIIHPEDGDLFELANRIVAREIDHIDQ 325

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           +F MRHA G  +W++ RAQ+M   +  + +IGIA+D+TE+ HL  R   AD RL  AIE 
Sbjct: 326 VFRMRHADGQWVWMRARAQVMDPEAPEIQLIGIAVDVTEQRHLALRSEAADLRLRTAIEN 385

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            +E+ VLWD   RL+MCN+ YQ+  GL D  ++PG  R  +++       E R ++    
Sbjct: 386 INESFVLWDSAQRLIMCNSKYQQDNGLSDRDVMPGVTRVSLEERMLAFASERRLANTNGP 445

Query: 451 QDMSK-EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
           Q  +  E +L+D RWLQ+NE  T DGG +SVG+DIT +K +Q +L +S+RRL ATI+DLS
Sbjct: 446 QGGATFERQLSDGRWLQVNELKTRDGGIVSVGSDITQIKLHQEKLVDSERRLMATIHDLS 505

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
            +R+  E +  EL   N KY  E ERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+++
Sbjct: 506 LARRAEEERSRELVDLNRKYMKETERAEAANRAKSEFLANMSHELRTPLNAIIGFSELME 565

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
           + +FG LGS +Y EYA DI+ SG++LL +IN+IL+MSKIE  + S+D++  DL P+I+E 
Sbjct: 566 QGLFGPLGSSRYEEYATDINSSGKYLLGVINDILDMSKIEAGQFSLDQEQIDLGPLISET 625

Query: 630 IRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           +R++   A  K I +E +I   L   AD+R IK+I+  +LSN++KFT   G + +R    
Sbjct: 626 VRVVSLQAAQKAITVETRIADALTLFADRRAIKQIVINLLSNAVKFTGQGGHISVRARNT 685

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              +++TI D G GIPK AL K+G+PFE + NQ+ ++  G GLGLAIS +L  L GG LK
Sbjct: 686 SGALVLTIEDNGCGIPKEALGKLGRPFEQVQNQFSKNHAGSGLGLAISRSLAELQGGALK 745

Query: 750 IISQEGKGTIVTICMP 765
           I S EG GTIV++ +P
Sbjct: 746 IRSTEGVGTIVSVRIP 761


>gi|298290750|ref|YP_003692689.1| multi-sensor signal transduction histidine kinase [Starkeya novella
           DSM 506]
 gi|296927261|gb|ADH88070.1| multi-sensor signal transduction histidine kinase [Starkeya novella
           DSM 506]
          Length = 770

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 236/589 (40%), Positives = 367/589 (62%), Gaps = 3/589 (0%)

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
           D  P      NLP     ++++      L  W+ +  L V   S   A+LL + F+++ Q
Sbjct: 164 DGSPALATVRNLPGVPYQLVVVQPLAGALATWQSDTILTVTLLSTTGAVLLILGFAFHWQ 223

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
           A + +E D I       ++TALSRGRCGLW+++    +   S SM+E++G    ++ +SF
Sbjct: 224 ASRAREADGIYDTVRARIDTALSRGRCGLWDWDMGRGRMFWSESMFEMLGFEPRDELISF 283

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GM 358
             +A L+H D+  + +IA+ +  K  + +D++F M+HA G  +W++ RA+++   +G   
Sbjct: 284 GEVASLVHTDDTNLYDIAKEIADKPGRTIDRVFRMKHADGHWVWLRARAEVVPQDNGEPP 343

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
           +++GIA+D+TE+  L +R A AD RL  AIE  SE+ VLWD ++RLVMCN+ +Q  +G  
Sbjct: 344 HLVGIAVDVTEERRLAERTATADMRLRDAIESISESFVLWDASNRLVMCNSKFQSLHGFG 403

Query: 419 DHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGG 476
           D  + PG     +     +P++       +R ++ ++  E +L   RWL++ E  T DGG
Sbjct: 404 DANVAPGTEFETVAALARQPVVRIPLRPEDRPEEGARAFEAQLEGGRWLKVTERRTKDGG 463

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
            +SVGTDIT LK ++ +L ES++RL A + DL  S+Q LE Q  +L+     Y  EK +A
Sbjct: 464 YVSVGTDITALKRHEERLMESEKRLMALVADLRKSQQTLEMQALQLAELAQNYADEKTKA 523

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E AN+ KSEFLA MSHELRTPLNAI+GFSE+++  +FG LGS KY EY +DI  SG++LL
Sbjct: 524 EDANRAKSEFLANMSHELRTPLNAIIGFSELMESGLFGPLGSDKYNEYCRDIRDSGRYLL 583

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA 656
           ++IN+IL+MS+IE  ++ ++ Q  +L  ++ + IR++   A  K I +       +   A
Sbjct: 584 DVINDILDMSRIEAGRMHLNLQPVELDEVVTDSIRVMSVRADEKQITVAADTDGAVSLEA 643

Query: 657 DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPF 716
           DKR +K+I   +LSN+IKFT  NG++ +RT +  +  ++ I D+GIGIPK+AL KIG+PF
Sbjct: 644 DKRALKQITLNLLSNAIKFTPENGRVSVRTRRSARAALLVIEDSGIGIPKAALAKIGKPF 703

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           E + +Q+ ++  G GLGLAI+ +L  LHGG ++I S EG GT V I +P
Sbjct: 704 EQVESQFTKTHKGSGLGLAIAKSLVELHGGTMRIRSSEGVGTTVIIRLP 752


>gi|254472050|ref|ZP_05085451.1| multi-sensor signal transduction histidine kinase [Pseudovibrio sp.
           JE062]
 gi|211959252|gb|EEA94451.1| multi-sensor signal transduction histidine kinase [Pseudovibrio sp.
           JE062]
          Length = 744

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 278/735 (37%), Positives = 427/735 (58%), Gaps = 38/735 (5%)

Query: 54  MISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAE 113
           +I  + +VFIA ++I +        E ++ +    LT    +I        D++ Q+K  
Sbjct: 5   IIPALCIVFIACTAIFRGLEIAYNYESVSQKAQDDLT----LIATALTASIDVSEQEKGS 60

Query: 114 SMLGQLLAKTRFLSESF----------ILLAQPNELVFASSTKNSHYIGKKI----GEII 159
             +G   A  R LSE+           ILL  PN  + AS+       G KI    G+  
Sbjct: 61  --VGLTSALQRALSEALPPRATSQSRQILLTDPNGTIVASAPTRPDMEGLKITSFLGDTQ 118

Query: 160 PELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEV 219
           P ++    R+  + ++E + D     V   +LP+  G + I+     +   WR E++  V
Sbjct: 119 P-MTFFGKRAGVLTINEGTKDATRATVH--HLPNKLGMVAIMQPEDAIFSSWRAELSANV 175

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
             F   S +LL I+++Y+ QA + ++ D I       ++ AL+RGRCGL++++    +  
Sbjct: 176 TIFVATSMVLLVIIYAYFAQATRAQQADGIYAATRSRIDAALNRGRCGLFDWDLSRGRVF 235

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
            S S+YE++G+   N  + F  I  L H D+  + ++A+S+       +D+ + MRH  G
Sbjct: 236 WSASLYEMLGMDPRNDIMGFAEIQSLTHPDDVDLYDLAKSLLDTGKSNVDRQWRMRHIDG 295

Query: 340 ADIWIQVRAQMMRTISGGMN---IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
           + +W++VRA++      G N   +IGI MD+TE+  L ++   AD RL  AIE  SEA V
Sbjct: 296 SWVWLRVRAEVQ--TDAGTNEPHLIGICMDVTEQKMLAEQSRTADLRLRDAIENISEAFV 353

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ----D 452
           LWD ++ LVMCN+NY+K + LPDHV+  G   + +  + ++PII    S+PE       D
Sbjct: 354 LWDADNHLVMCNSNYRKLHQLPDHVVQAGTPYATVMSSASQPII----SEPEEGDHIDSD 409

Query: 453 M--SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
           M  S ++++   RWLQ++E  T DGG +SVGTDIT LK  + +L ES+R   ATI DL  
Sbjct: 410 MESSYKVEMEGGRWLQVSERRTKDGGFVSVGTDITELKRKEEKLLESERGHMATIADLRQ 469

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           SRQ LE Q  +L     KY  EK RAE AN+ KSEFLA +SHELRTPLNAI+GFSE++ +
Sbjct: 470 SRQKLELQAQQLVELTEKYADEKTRAEDANQAKSEFLANISHELRTPLNAIIGFSEIMDQ 529

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
            +FG+LGS KY EY +DIH SG +LLN+IN+IL+MSKIE  +I +  ++  +  I+ +  
Sbjct: 530 GMFGDLGSDKYKEYCKDIHSSGNYLLNVINDILDMSKIEAGRIELSVEDVQIQQIVQDAA 589

Query: 631 RLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           R+I ++A  KNIK+  +    +   AD+R +K+IL  +L+NS+KFT  NG++ +   K+G
Sbjct: 590 RIISATAAEKNIKVVNENLPHMHLQADRRAVKQILLNLLANSVKFTPENGEVRVSARKVG 649

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
               + I D GIGI K  ++++ +PF  + NQ+ ++  G GLGLAI+ +L+ LHGG ++I
Sbjct: 650 AFAELKITDNGIGIAKKDIDRLAKPFVQVENQFTKTHKGSGLGLAIARSLSELHGGYMEI 709

Query: 751 ISQEGKGTIVTICMP 765
            S+ GKGT VTI +P
Sbjct: 710 DSEVGKGTEVTIKLP 724


>gi|158424746|ref|YP_001526038.1| PAS protein [Azorhizobium caulinodans ORS 571]
 gi|158331635|dbj|BAF89120.1| PAS protein [Azorhizobium caulinodans ORS 571]
          Length = 763

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 266/741 (35%), Positives = 414/741 (55%), Gaps = 48/741 (6%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + +P + + FLV +   ++++V T          Q+ L            +N K DLA
Sbjct: 38  LRRIVPALIITFLVVLGIGALVQVHTH--------RQSVL------------DNAKDDLA 77

Query: 108 SQKKAES-MLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSR 166
            Q  A +  L   L  +   + S +L A P     A+S     Y+    G +I     S 
Sbjct: 78  LQALATAEGLNHRLNGSLANTGSALLAALPPR---ATSGGRRIYVTDPSGRVIAAAPESA 134

Query: 167 SRSKTVQMSEASLDQQPYHVLS-------------------VNLPHNSGSILIINSRVPL 207
            R     +++     QP  V +                    NL    G I+ +      
Sbjct: 135 PR--VTSLADLMDPSQPLTVFAERAGVLEIAVGDTQMLATVRNLNPPLGQIVYLQPMNRA 192

Query: 208 LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCG 267
           L +W +  TL +  F+   A+LL + FS++ QA + +E D I     + ++TAL+RGRCG
Sbjct: 193 LAVWSDSTTLTITLFATTGAVLLILGFSFHWQASRAREADHIYDTVRMRIDTALNRGRCG 252

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           +W+++    + + S +M+EI+G+   ++ LSF  IA+L+H D+  + E+A+ +  +    
Sbjct: 253 MWDWDMARGRMYWSDTMFEILGLERRDELLSFGEIAKLVHPDDGNLYELAQELAERPGAS 312

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSK 386
           +D++F MR A G  +W+++RA++++     G ++IGIAMD+TE   L +R   AD RL  
Sbjct: 313 VDRVFRMRTARGDFVWLRMRAEVVQQAGEDGPHLIGIAMDVTEAQRLAERTVTADMRLRD 372

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           AIE  SEA VLWD  +RLV+CN+ +Q  + LPD  +V G     I      P+       
Sbjct: 373 AIESISEAFVLWDSQNRLVLCNSKFQTLHELPDDAIVAGTPFETIATVGRHPVTRTPLKP 432

Query: 447 PERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
            ++ ++ S+  E +L++ RWL+I E  T DGG +SVGTDIT LK ++ +L ++++RL A 
Sbjct: 433 EDKPEEGSRAFEAQLSNGRWLKIAERRTKDGGYVSVGTDITPLKRHEERLMDNEKRLMAL 492

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           + DL  S+Q LE Q  +L+    KY  EK RAE AN+ KSEFLA MSHELRTPLNAI+GF
Sbjct: 493 VADLRKSQQTLEHQAQQLAELAEKYSEEKTRAEDANRAKSEFLANMSHELRTPLNAIIGF 552

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           SE+++  +FG LGS KY EY  DI  SG +LL++IN+IL+MSKIE  ++ ++ ++  L  
Sbjct: 553 SEIMESGMFGPLGSDKYREYCSDIKGSGTYLLDVINDILDMSKIEAGRMQLELEDIRLDE 612

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
           II + +R+       K + +  ++ +      D+R +K+IL  +LSN++KFT   G + +
Sbjct: 613 IIADAMRVTAVKGDEKQLDMTAQVGAGQVMRGDRRALKQILLNLLSNAVKFTPEGGHVAV 672

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           R    G   +I I DTGIGIP+ AL KIG+PFE + +Q+ ++  G GLGLAI+ +L  LH
Sbjct: 673 RAKVNGGAAVIAIEDTGIGIPRHALNKIGRPFEQVESQFTKTHKGSGLGLAIAKSLAELH 732

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG ++I S EG GT V + +P
Sbjct: 733 GGSMRIRSTEGAGTTVVVRLP 753


>gi|85715377|ref|ZP_01046359.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
 gi|85697798|gb|EAQ35673.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
          Length = 788

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 264/767 (34%), Positives = 437/767 (56%), Gaps = 56/767 (7%)

Query: 26  SKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQT 85
           +K A++R        L +      + +P + + FLV I   ++++V  +  Q++ MT   
Sbjct: 24  AKPAYRR--------LLTAEPVLRRAVPALIIAFLVTICVGALVQVIDQTRQKQAMTKHD 75

Query: 86  SLMLT-------EAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNE 138
            L L        E   +++Q+       AS ++ +++L +L+      +   I++   ++
Sbjct: 76  LLALADLLAERLEHAGVVYQDRP-----ASIERFQNLLPKLIPSWGVAAGRHIIVTGADQ 130

Query: 139 LVFAS-----STKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPH 193
            V A      ++  S  I + IG               +  S A     P  V  + L  
Sbjct: 131 RVLARIPIGITSSESSRILELIG---------------ITQSPALHGMSPASVADIVLLD 175

Query: 194 NSGSILIINSRVPLL----------RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKN 243
            SG++ +  +   LL           +WR +  L +   +    ++L + F+++ Q+ + 
Sbjct: 176 GSGALAVQRAIRSLLGQVTVIQEADAVWRPDTALSITLSATTGFVVLILGFAFHWQSTRA 235

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
           +E D I       ++TAL+RGRCGLW+++    +   S+SM+ ++G+   +  L+F  ++
Sbjct: 236 REGDLINDAVRGRIDTALNRGRCGLWDWDLSRGRIFWSQSMFTLLGLESRSDLLAFGEVS 295

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI 363
            L++ ++  + EIA  +    +  +DQ F MRH+SG  IW++VR ++ +  SGG ++IGI
Sbjct: 296 SLVNSEDIDLFEIADELISGKIDHIDQSFRMRHSSGHWIWLRVRCELSQNASGGAHLIGI 355

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
           A+D+TE+  L ++  EAD RL  AIE   EA VLWD +DRLV+CN+++Q+ + LPD  +V
Sbjct: 356 AVDVTEQKSLAEKSVEADLRLRDAIESIPEAFVLWDADDRLVLCNSHFQRLHKLPDSAVV 415

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPER----SQDMSKEIKLADSRWLQINEWCTHDGGTIS 479
            G     + +    P  E R   PE     S+  + +++LAD  WL I+E  T DGG +S
Sbjct: 416 VGTPYETVVEVGRMP--EIRARQPETGTVTSEAHTFDVQLADGNWLHISERRTKDGGYVS 473

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           VGTDIT +K ++ +L E+  RL+AT+ DL  ++  LERQ  +L+    KY  +K RAE A
Sbjct: 474 VGTDITRIKEHEQKLVENDLRLRATVIDLKRTQATLERQALKLADLAQKYADQKNRAEDA 533

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N+ KS+FLA MSHELRTPLNAI+GFSE++   +FG LGS KY EY +DI  SGQ+LL +I
Sbjct: 534 NRAKSKFLANMSHELRTPLNAIIGFSEIMSNGMFGTLGSKKYSEYCRDILTSGQYLLEVI 593

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR 659
           N++L+MSKIE  ++++D +  DL  +++E +R++      K++  + +    +   AD+R
Sbjct: 594 NDVLDMSKIEAGRMNLDMEAFDLTGVLDESLRVVSGRTSDKSLTFDLRNNDGISIVADRR 653

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            +K+IL  +LSN+IKFT + G++M R+      + +TIADTGIGI   AL K+G+PFE +
Sbjct: 654 AVKQILVNLLSNAIKFTPDGGRIMARSKIFENFITLTIADTGIGIASHALRKLGKPFEQV 713

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            +Q  ++  G GLGLAI+ +L NLH G +K+ S+ G GT+V + +P+
Sbjct: 714 ESQLTKTHAGSGLGLAIAKSLVNLHNGSMKLRSKPGVGTVVRVTLPR 760


>gi|299133557|ref|ZP_07026751.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
 gi|298591393|gb|EFI51594.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
          Length = 812

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 238/574 (41%), Positives = 362/574 (63%), Gaps = 5/574 (0%)

Query: 195 SGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEAN 254
           SGS++++ ++      WR +  L++   +    ++L + F+++ Q+ + +E+D I     
Sbjct: 186 SGSVIVMQAQNAAS--WRSDTALQITLSATTGFVVLILGFAFHWQSTRARESDLINDAVR 243

Query: 255 ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC 314
             ++TAL+RGRCGLW+++    +   S+SM+ ++G+   N  L+F  +  L+H ++  + 
Sbjct: 244 GRIDTALNRGRCGLWDWDLSRGRIFWSQSMFTMLGLESRNDLLAFGEVNALVHSEDIDLM 303

Query: 315 EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHL 373
            IA  +    +  +DQ F MRHA G  IW+ VR ++    S GG ++IGIA+D+TE+  L
Sbjct: 304 AIADQLLSGQISHIDQTFRMRHADGHWIWLCVRCELTEAGSNGGCHLIGIALDITEQKSL 363

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
             R  EAD RL  AIE   EA VLWD  +RLV+CN+++Q+ + LPD  +  G     + +
Sbjct: 364 AARSVEADLRLRDAIETIPEAFVLWDSENRLVLCNSHFQRLHKLPDSAVTAGTPYETVIE 423

Query: 434 AQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
               P I  R +D E S   S+  E +L D  WL I+E  T DGG +SVGTDIT +K ++
Sbjct: 424 VGHMPEIRARVADTEISAPGSRTFEAQLNDGSWLNISERRTKDGGFVSVGTDITQIKRHE 483

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
            +L ++  RL A + DL  S+  LE+Q  EL+    KY  EK RAE AN+TKS+FLA MS
Sbjct: 484 QRLVDNDLRLTAYVVDLKRSQAALEQQARELADLAQKYAEEKRRAEEANQTKSKFLANMS 543

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAI+GFSEV+ + +FG LGS +Y EY QDI  SG +LL++IN++L+MSKIE  
Sbjct: 544 HELRTPLNAIIGFSEVMGRGMFGPLGSGRYQEYCQDILTSGNYLLDVINDVLDMSKIEAG 603

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           ++ +D +  DL   ++E  R+  S A  K + ++ +I   +   AD+R +K+IL  +LSN
Sbjct: 604 RMKLDPEKLDLAETVSESTRVASSWADGKRLTLDSRIDGAIPIVADRRAMKQILVNLLSN 663

Query: 672 SIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
           ++KFT + G++++R+  IG  V++TIADTGIGIPK AL ++G PFE + +Q  +S  G G
Sbjct: 664 AVKFTPDGGRIVVRSRIIGDRVMVTIADTGIGIPKEALARLGCPFEQVESQLTKSYHGSG 723

Query: 732 LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LGLAI+ +L  LH G +K+ SQ   GT+V I +P
Sbjct: 724 LGLAIAKSLVQLHSGSMKLRSQLHIGTVVRINLP 757


>gi|148254533|ref|YP_001239118.1| two-component sensor histidine kinase [Bradyrhizobium sp. BTAi1]
 gi|146406706|gb|ABQ35212.1| putative two-component sensor histidine kinase with a ATP-binding
           domain (C-term) [Bradyrhizobium sp. BTAi1]
          Length = 774

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/588 (39%), Positives = 366/588 (62%), Gaps = 5/588 (0%)

Query: 182 QPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAK 241
           +P   +S  +    G ++II  +  L  +W  +  L V   +    ++L + F+++ Q+ 
Sbjct: 176 RPAFAISQLIKALPGRVVIIQEK--LEPIWGSDAALSVTLSATTGFVVLILGFAFHWQST 233

Query: 242 KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
           + +E D I       ++TAL+RGRCGLW+++    +   S SM+E++G+      L+F  
Sbjct: 234 RAREGDLINDAVRGRIDTALNRGRCGLWDWDLSRGRIFWSNSMFEMLGLDNRTDLLTFGE 293

Query: 302 IARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNI 360
           +  L++ D+  +  IA  +    + Q+DQ F MRH  G  IW++VR ++ + T + G+++
Sbjct: 294 VNALVNSDDIDLFAIADQLVAGDIHQIDQSFRMRHTEGHWIWLRVRCELSQGTTASGLHL 353

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           IGIA+D+TE+  L ++  EAD RL  AIE  SEA VLWD N+RLV+CN+++QK + LPD 
Sbjct: 354 IGIAVDITEQKSLAEKTVEADLRLRDAIETISEAFVLWDANNRLVLCNSHFQKLHKLPDS 413

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTI 478
            ++PG +   + +    P I  R  D  +    ++  E +L D  WL I+E  T DGG +
Sbjct: 414 AVIPGTSYETVIEVGKMPEIRTRLHDHSQQSPGARTFEAQLDDGSWLHISERRTKDGGYV 473

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
           SVGTDIT +K ++ +L ++  RL+AT+ DL  S+  LERQ  EL+    KY  EK RAE 
Sbjct: 474 SVGTDITRIKEHEQKLVDNDLRLRATVIDLQRSQSALERQAIELADLAEKYSQEKTRAEE 533

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           AN+TKS+FLA MSHELRTPLNAI+GFSE++   +FG LGS KY EY  DI  SGQ+LL +
Sbjct: 534 ANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGMFGSLGSEKYQEYCHDILTSGQYLLEV 593

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADK 658
           IN+IL+MSKIE  ++ +D +  DL   + E +R++   AQ K + ++  I   +   AD+
Sbjct: 594 INDILDMSKIEAGRMKLDMEPLDLAKTLAESLRVVSGRAQDKRLVLDADIEGNIPIVADR 653

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R  K+I+  +LSN++KFT   G++ +R+      V++ IADTGIGIP  +L ++G+PFE 
Sbjct: 654 RATKQIMVNLLSNAVKFTPEGGRVTMRSRVFDDKVVLIIADTGIGIPAQSLARLGRPFEQ 713

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           + +Q  ++  G GLGLAI+ +LT LHGG +++ S+   GT+V + +P+
Sbjct: 714 VESQMTKTYHGSGLGLAIARSLTQLHGGSMRLRSRIESGTVVRVTLPR 761


>gi|75675393|ref|YP_317814.1| Signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
 gi|74420263|gb|ABA04462.1| signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
          Length = 779

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 251/747 (33%), Positives = 430/747 (57%), Gaps = 52/747 (6%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLT-------EAIEIIFQNN 100
             + +P + + FLV I   ++++V  +  Q++ MT    L L        E   +I Q+ 
Sbjct: 38  LRRAVPTLIIAFLVTICIGALVQVIDQTRQKQAMTKHDLLALADLLAERLEHAGVIDQDR 97

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIP 160
                 AS ++ +++L +L+ +    +   +++   ++ V A                +P
Sbjct: 98  P-----ASIERLQNLLPKLIPQWSIATGRHVIVTGVDQRVLAR---------------VP 137

Query: 161 ELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIIN--SRVPLLRL-------- 210
             + S   S+ +++   S+ Q P  +L    P +   I++++  S + + R+        
Sbjct: 138 VGAASGESSRMLEL--ISITQSP--ILRGAAPASVADIVLLDGSSVLAVQRVVRSLLGQV 193

Query: 211 ---------WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETAL 261
                    WR +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL
Sbjct: 194 TVIQEVNAAWRPDTALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTAL 253

Query: 262 SRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVT 321
           +RGRCGLW+++    +   S+SM+ ++G+   +  L+F  ++ L++ D+  + E+A  + 
Sbjct: 254 NRGRCGLWDWDLSRGRIFWSQSMFTMLGMESRSDLLTFGEVSSLVNSDDIDLFEVADQLI 313

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEAD 381
              +  +DQ F MRH+SG  IW++VR ++ +  +GG ++IGIA+D+TE+  L ++  EAD
Sbjct: 314 SGKIGHIDQSFRMRHSSGHWIWLRVRCELSQNANGGAHLIGIAVDVTEQKSLAEKSIEAD 373

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE 441
            RL  AIE   EA VLWD +DRLV+CN+++Q+ + LPD  +  G     + +    P I 
Sbjct: 374 LRLRDAIESIPEAFVLWDADDRLVLCNSHFQRLHKLPDSAVAVGTPYETVVEVGRMPEIR 433

Query: 442 YRTSDPERS--QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
            R S+      +  + +++LAD  WL ++E  T DGG +SVGTDIT +K ++ +L E+  
Sbjct: 434 ARHSETGTVTLKAHTFDVQLADGNWLHVSERRTKDGGYVSVGTDITRIKEHEQKLVENDL 493

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           RL+AT+ DL  ++  LE+Q  +L+    KY  EK RAE AN+ KS+FLA MSHELRTPLN
Sbjct: 494 RLRATVIDLKRTQATLEQQAIKLADLAQKYADEKNRAEDANRAKSKFLANMSHELRTPLN 553

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AI+GFSE++   +FG LGS KY EY +DI  SGQ+LL +IN++L+MSKIE  + ++D + 
Sbjct: 554 AIIGFSEIMSNGMFGTLGSTKYSEYCRDILTSGQYLLEVINDVLDMSKIEAGRTNLDMET 613

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679
            DL  +++E +R++      K +  + +   ++   AD+R +K+I+  +LSN++KFT  +
Sbjct: 614 LDLTGVLDESLRVVSGRTSDKGLTFDVRSDDDISIIADRRAVKQIMVNLLSNAVKFTPAS 673

Query: 680 GKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
           G++M R+      V +TIADTGIGI   AL ++G+PFE + +Q  ++  G GLGLAI+ +
Sbjct: 674 GRIMARSKVFENSVTLTIADTGIGIAPHALRRLGKPFEQVESQLTKTHAGSGLGLAIAKS 733

Query: 740 LTNLHGGRLKIISQEGKGTIVTICMPQ 766
           L NLH G ++I S+ G GT+V + +P+
Sbjct: 734 LVNLHSGSMRIRSKPGAGTVVRVTLPR 760


>gi|90423355|ref|YP_531725.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
 gi|90105369|gb|ABD87406.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
          Length = 775

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/576 (40%), Positives = 360/576 (62%), Gaps = 9/576 (1%)

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G ++II   V    +WR +  L +   +    ++L + F+++ Q+ + +E D I      
Sbjct: 191 GQVVIIQENVE--PIWRSDTALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRG 248

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
            ++TAL+RGRCGLW+++    +   S+SM+ ++G+   +  L+F  +  L+  D+  +  
Sbjct: 249 RIDTALNRGRCGLWDWDLSRGRIFWSQSMFTMLGLESRSDLLTFGEVNALVKSDDIDLFA 308

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLE 374
           IA  +    + Q+D  F M+HA+G  IW++VR ++ +     G ++IGIA+D+TE   L 
Sbjct: 309 IANQLITGTISQIDHTFRMQHANGHWIWLRVRCELSQGAGDAGTHLIGIAVDITEHKSLA 368

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           +R  EAD RL  AIE   EA VLWD  +RLV+CN+++Q+ + LPD  + PG +   + + 
Sbjct: 369 ERTVEADLRLRDAIETIPEAFVLWDAENRLVLCNSHFQRLHKLPDSAVTPGTSYETVVEV 428

Query: 435 QTRPIIEYRTSDPERSQDMSK----EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
            T P  E RT  PE           E +L + +WL I+E  T DGG ++VGTDIT +K +
Sbjct: 429 GTMP--EARTRLPEAGHHPPGARTFEAQLDNGKWLHISERRTKDGGYVAVGTDITRIKEH 486

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           + +L E+  RL+AT+ DL  S+  LERQ  EL     KY  EK RAE AN+TKS+FLA M
Sbjct: 487 EQKLVENDLRLRATVVDLKRSQATLERQAVELVDLAQKYSEEKNRAEDANQTKSKFLANM 546

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHELRTPLNAI+GFSE++   +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE 
Sbjct: 547 SHELRTPLNAIIGFSEIMGSGMFGSLGSEKYQEYCHDILTSGHYLLEVINDILDMSKIEA 606

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILS 670
            ++ +D +  DL   ++E +R++   A +K + +   I +++   AD+R IK+IL  +LS
Sbjct: 607 GRMKLDLEPFDLATTLSESLRVVSGRADNKQLMLRADIDNDIPVLADRRAIKQILVNLLS 666

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT + G++ +R     + +++ IADTGIGI K +L ++GQPFE + +Q  ++  G 
Sbjct: 667 NAVKFTPDGGRVTVRGRVFEEQIVLLIADTGIGIAKQSLRRLGQPFEQVESQLTKTYHGS 726

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           GLGLAI+ +LTNLHGG +++ SQ G GT+V + +P+
Sbjct: 727 GLGLAIAKSLTNLHGGSMRLRSQLGVGTVVRVALPR 762


>gi|27378251|ref|NP_769780.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
 gi|27351398|dbj|BAC48405.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
          Length = 776

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/560 (39%), Positives = 355/560 (63%), Gaps = 3/560 (0%)

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
           +W  +  L V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW
Sbjct: 204 IWGSDAALSVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRGRIDTALNRGRCGLW 263

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           +++    +   S+SM+ ++G+   N+ L+F  +  L+  D+  + EIA  +  + +  +D
Sbjct: 264 DWDLSRGRIFWSQSMFSMLGLDGRNELLTFGEVNALVKSDDIDLFEIADQLISEKIDHID 323

Query: 330 QIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           Q F M+H  G  IW++VR +         +++IGIA+D+TE+  L +R  EAD RL  AI
Sbjct: 324 QTFRMQHVDGHWIWLRVRCEKTSGATDSSVHLIGIAVDITEQKSLAERTVEADLRLRDAI 383

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE 448
           E   EA VLWD +DRLV+CN+++Q+ + LPD  ++PG +   + +    P +  R ++  
Sbjct: 384 ETIPEAFVLWDASDRLVLCNSHFQRLHKLPDSAVIPGTSYETVLEVGRMPEVRTRHNETA 443

Query: 449 RSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
                ++  E +L D  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+ 
Sbjct: 444 AQGPGARTFEAQLDDGSWLHISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATVI 503

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  S+  LERQ  EL+    KYQ EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE
Sbjct: 504 DLKRSQAALERQTNELADLAEKYQREKTRAEEANQTKSKFLANMSHELRTPLNAIIGFSE 563

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++   +FGELGS KY EY QDI  SG +LL +IN+IL+MSKIE  ++ +D +  DL   +
Sbjct: 564 IMGSGLFGELGSEKYQEYCQDILTSGHYLLEVINDILDMSKIEAGRMKLDMEELDLARTL 623

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            E +R++   AQ K++ ++  I   +   AD+R  K+I+  +LSN++KFT + G++++R+
Sbjct: 624 AESLRVVSGRAQDKHLTLDADIEKSISVVADRRATKQIIVNLLSNAVKFTPDGGRIVVRS 683

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            ++   +++ IADTGIGI   +L ++G+PFE + +Q  ++  G GLGLAI+ +L  LHGG
Sbjct: 684 RQLDDRIVLMIADTGIGIAPHSLARLGRPFEQVESQLTKTYHGSGLGLAIARSLAQLHGG 743

Query: 747 RLKIISQEGKGTIVTICMPQ 766
            +++ S+   GT+V + +P+
Sbjct: 744 SMRLRSKIDVGTVVRVTLPR 763


>gi|146341839|ref|YP_001206887.1| two-component sensor histidine kinase [Bradyrhizobium sp. ORS278]
 gi|146194645|emb|CAL78670.1| putative two-component sensor histidine kinase with a ATP-binding
           domain (C-term) [Bradyrhizobium sp. ORS278]
          Length = 774

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/574 (39%), Positives = 357/574 (62%), Gaps = 5/574 (0%)

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G +++I  +  L  +W  +  L +   +    ++L + F+++ Q+ + +E D I      
Sbjct: 190 GRVVVIQEK--LEPIWGSDAALSITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRG 247

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
            ++TAL+RGRCGLW+++    +   S SM+ ++G+      L+F  +  L++ D+  +  
Sbjct: 248 RIDTALNRGRCGLWDWDLSRGRIFWSNSMFAMLGLDNRTDLLTFGEVNALVNSDDIDLFA 307

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLE 374
           IA  +    ++ +DQ F MRH  G  IW++VR ++ + T   G+++IGIA+D+TE+  L 
Sbjct: 308 IADQLVAGELRHIDQSFRMRHTEGHWIWLRVRCELSQGTTDSGLHLIGIAVDVTEQKSLV 367

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           ++  EAD RL  AIE  SEA VLWD N+RLV+CN+++QK + LPD  + PG +   + + 
Sbjct: 368 EKTVEADLRLRDAIETISEAFVLWDSNNRLVLCNSHFQKLHKLPDSAVTPGTSYETVIEV 427

Query: 435 QTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
              P I  R  D  +     +  E +L D  WL I+E  T DGG +SVGTDIT +K ++ 
Sbjct: 428 GKMPEIRTRLHDNSQQAQGGRTFEAQLDDGSWLHISERRTKDGGYVSVGTDITRIKEHEQ 487

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +L ++  RL+AT+ DL  S+  LERQ  EL+    KY  EK RAE AN+TKS+FLA MSH
Sbjct: 488 KLVDNDLRLRATVIDLQRSQSALERQAIELADLAEKYSQEKTRAEEANQTKSKFLANMSH 547

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI+GFSE++   +FG LGS KY EY  DI  SGQ+LL +IN+IL+MSKIE  +
Sbjct: 548 ELRTPLNAIIGFSEIMGSGMFGSLGSEKYQEYCHDILTSGQYLLEVINDILDMSKIEAGR 607

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNS 672
           + +D +  DL   + E +R++   AQ K++ ++  I   +   AD+R  K+I+  +LSN+
Sbjct: 608 MKLDMEPLDLAKTLAESLRVVSGRAQDKSLVLDADIEGNIPVIADRRATKQIMVNLLSNA 667

Query: 673 IKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           +KFT   G++ +R+      V++ IADTGIGIP  +L ++G+PFE + +Q  ++  G GL
Sbjct: 668 VKFTPEGGRVTMRSRVFEDKVVLIIADTGIGIPAQSLARLGRPFEQVESQMTKTYHGSGL 727

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           GLAI+ +L  LHGG +++ S+   GT+V + +P+
Sbjct: 728 GLAIARSLAQLHGGSMRLRSRLEHGTVVRVTLPR 761


>gi|192290539|ref|YP_001991144.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
 gi|192284288|gb|ACF00669.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
          Length = 769

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 249/726 (34%), Positives = 422/726 (58%), Gaps = 10/726 (1%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI-EIIFQNNNIKFDL 106
             + +P++ + FLV I   + +++  +  Q+    N+    L + I E +     ++ D 
Sbjct: 38  LRRAVPLLIIAFLVTIFFGAAVQIIEQSKQKRGAMNRDLSALADLIAERLEHIGVVRLDR 97

Query: 107 -ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH-YIGKKIGEIIPELSR 164
            AS ++ +++L  L+          +++   ++ + A     +   +  +  EI+   S 
Sbjct: 98  PASIERLQNLLPGLIPTWGIAPGRHVIVTSADQRILARVPIGTEPSVDNRFLEILGAASL 157

Query: 165 SRSRSKTVQMSEASLDQQPYHVLSVNLPHN-SGSILIINSRVPLLRLWREEVTLEVVFFS 223
           ++S  ++  +SE +L      + ++++  +  G ++II        L R +  L+V   +
Sbjct: 158 TKSGQQS-SISEITLPGGASALATMHVVKSLPGQVVIIQEDTG--SLLRSDTALQVTLSA 214

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
               ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++    +   S+S
Sbjct: 215 TTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDWDLSRGRIFWSQS 274

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
           M+ I+G+   N  L+F  +  L+  ++  +  IA  +    V  +D  F MRHA G  IW
Sbjct: 275 MFTILGLESRNDLLTFGEVNALVKGEDIDLFAIADELMAGRVDHIDHSFQMRHAHGHWIW 334

Query: 344 IQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           +++R ++ +       ++IGIA+D+TE+  L +R  EAD RL  AIE   EA VLWD  +
Sbjct: 335 LRMRCELTQEAGATEKHLIGIAVDITEQKSLAERSVEADLRLRDAIETIPEAFVLWDAEN 394

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLA 460
           RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D       ++  E +L 
Sbjct: 395 RLVLCNSHFQRLHKLPDSAVTPGTSYETILEVGRMPQLRTRLCDNGAVMPGARTFEAQLD 454

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
           D  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL  ++  LE+Q  
Sbjct: 455 DGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADLKITQSKLEKQAL 514

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++   +FG LGS K
Sbjct: 515 ELADLARKYADEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGMFGTLGSEK 574

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E ++++   A+ K
Sbjct: 575 YQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLAKTIGESVKVVAGRAEHK 634

Query: 641 NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADT 700
           ++++  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R    G  +++ IADT
Sbjct: 635 HLELRSELNDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRGHVAGGSIVLMIADT 694

Query: 701 GIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           GIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +++ S  G GT+V
Sbjct: 695 GIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSMRLRSTLGAGTVV 754

Query: 761 TICMPQ 766
            + +P+
Sbjct: 755 MVSLPR 760


>gi|316934884|ref|YP_004109866.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
 gi|315602598|gb|ADU45133.1| PAS/PAC sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
          Length = 769

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 249/732 (34%), Positives = 428/732 (58%), Gaps = 22/732 (3%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQT----SLMLTEAIEIIFQNNNIK 103
             + +P++ + FLV I   + +++  +  Q+    N+     + +L E +E I     ++
Sbjct: 38  LRRAVPLLIIAFLVTIFCGAAVQIIEQSKQKRGAMNRDLGALADLLAERLEHI---GVVR 94

Query: 104 FDL-ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFAS-STKNSHYIGKKIGEII-- 159
            D  AS ++ +++L  L+      +   +++   ++ + A      +  +  +  E++  
Sbjct: 95  LDRPASIERLQNLLPALIPSWGIAAGRHVIVTSADQRILARVPIGGAPAVDNRFFEVLGA 154

Query: 160 PELSRSRSRSKTVQ--MSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
             L+++  +   V+  +   +      HV+  +LP   G ++I+        + R +  L
Sbjct: 155 AALTKAGQQGGIVEIVLPGGASALATMHVVK-SLP---GQVVIVQEDTG--SVLRSDTAL 208

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
           +V   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++    +
Sbjct: 209 QVTLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDWDLSRGR 268

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
              S+SM+ I+G+   N  L+F  +  L+  ++  + EIA  +    V  +D+ F MRHA
Sbjct: 269 IFWSQSMFTILGLESRNDLLTFGEVNALVKGEDIDLFEIADELVAGRVDHIDRSFQMRHA 328

Query: 338 SGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
            G  IW+++R ++ +   S   ++IGIA+D+TE+  L +R  EAD RL  AIE   EA V
Sbjct: 329 QGHWIWLRMRCELSQEAGSADKHLIGIAVDITEQKSLAERSVEADLRLRDAIETIPEAFV 388

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK- 455
           LWD  +RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D       ++ 
Sbjct: 389 LWDAENRLVLCNSHFQRLHKLPDSAVSPGTSYETILEVGRMPQLRTRLCDNGGVAPGART 448

Query: 456 -EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
            E +L D +WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL  ++  
Sbjct: 449 FEAQLDDGKWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADLKITQTK 508

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           LE+Q  +L+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++   +FG
Sbjct: 509 LEKQAHQLADLARKYGDEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGMFG 568

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E ++++ 
Sbjct: 569 TLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLSKTIGESLKVVA 628

Query: 635 SSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
             A+ K++ +  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R+   G  ++
Sbjct: 629 GRAEHKHLDLRAEVGDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRSRIAGDSIV 688

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           + IADTGIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +++ S  
Sbjct: 689 LMIADTGIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSMRLRSTL 748

Query: 755 GKGTIVTICMPQ 766
           G+GT+V + +P+
Sbjct: 749 GEGTVVMVSLPR 760


>gi|39935007|ref|NP_947283.1| sensor histidine kinase pleC [Rhodopseudomonas palustris CGA009]
 gi|39648858|emb|CAE27379.1| sensor histidine kinase, possible pleC [Rhodopseudomonas palustris
           CGA009]
          Length = 779

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 249/726 (34%), Positives = 422/726 (58%), Gaps = 10/726 (1%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI-EIIFQNNNIKFDL 106
             + +P++ + FLV I   + +++  +  Q+    N+    L + I E +     ++ D 
Sbjct: 48  LRRAVPLLIIAFLVTIFFGAAVQIIEQSKQKRGAMNRDLSALADLIAERLEHIGVVRLDR 107

Query: 107 -ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSH-YIGKKIGEIIPELSR 164
            AS ++ +++L  L+          +++   ++ + A     +   +  +  EI+   S 
Sbjct: 108 PASIERLQNLLPGLIPTWGIAPGRHVIVTSADQRILARVPIGTEPSVDNRFLEILGAASL 167

Query: 165 SRSRSKTVQMSEASLDQQPYHVLSVNLPHN-SGSILIINSRVPLLRLWREEVTLEVVFFS 223
           ++S  ++  +SE +L      + ++++  +  G ++II        L R +  L+V   +
Sbjct: 168 TKSGQQS-SISEITLPGGASALATMHVVKSLPGQVVIIQEDTG--SLLRSDTALQVTLSA 224

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
               ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++    +   S+S
Sbjct: 225 TTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDWDLSRGRIFWSQS 284

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
           M+ I+G+   N  L+F  +  L+  ++  +  IA  +    V  +D  F MRHA G  IW
Sbjct: 285 MFTILGLESRNDLLTFGEVNALVKGEDIDLFAIADELMAGRVDHIDHSFQMRHAHGHWIW 344

Query: 344 IQVRAQMMRTISGG-MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           +++R ++ +       ++IGIA+D+TE+  L +R  EAD RL  AIE   EA VLWD  +
Sbjct: 345 LRMRCELTQEAGATEKHLIGIAVDITEQKSLAERSVEADLRLRDAIETIPEAFVLWDAEN 404

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLA 460
           RLV+CN+++Q+ + LPD  + PG +   I +    P +  R  D       ++  E +L 
Sbjct: 405 RLVLCNSHFQRLHKLPDSAVTPGTSYETILEVGRMPQLRTRLCDNGAVMPGARTFEAQLD 464

Query: 461 DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKT 520
           D  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL  ++  LE+Q  
Sbjct: 465 DGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADLKITQSKLEKQAL 524

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++   +FG LGS K
Sbjct: 525 ELADLARKYADEKRRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGMFGTLGSEK 584

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   I E ++++   A+ K
Sbjct: 585 YQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEPLDLAKTIGESVKVVAGRAEHK 644

Query: 641 NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADT 700
           ++++  ++  ++   AD+R IK+IL  +LSN++KFT + G++ +R    G  +++ IADT
Sbjct: 645 HLELRSELNDQIPIVADRRAIKQILINLLSNAVKFTPDAGRVTVRGHLAGGSIVLMIADT 704

Query: 701 GIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           GIGIP  +L ++GQPFE + +Q  +S  G GLGLAI+ +L NLHGG +++ S  G GT+V
Sbjct: 705 GIGIPPQSLRRLGQPFEQVESQLTKSYHGSGLGLAIAKSLVNLHGGSMRLRSTLGAGTVV 764

Query: 761 TICMPQ 766
            + +P+
Sbjct: 765 MVSLPR 770


>gi|115523964|ref|YP_780875.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
 gi|115517911|gb|ABJ05895.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
          Length = 771

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 256/734 (34%), Positives = 424/734 (57%), Gaps = 26/734 (3%)

Query: 47  SFNQTIPMISMVFLVFIATSSIIKVT--TRYAQQEKMTNQTSL--MLTEAIEIIFQNNNI 102
           +  + +P + + FL+ I   +++++   TR  +     +  +L  ++TE I+ I  +   
Sbjct: 37  ALRRAVPTLIIAFLLTIFVGALVQIIDQTRDKRSAMSRDLAALADLITERIDRIAADRT- 95

Query: 103 KFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFA-----SSTKNSHYIGKKIGE 157
               A+  + +  L  L+    F +   I++   N+ V A     ++  ++  I + +G 
Sbjct: 96  ----ATPGQLQGALQGLIPAWGFAAGRHIIVVDANQRVIARVPPNATIGDASRILEVLGA 151

Query: 158 IIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTL 217
             P L+ S  +S  V ++  S   +  H +   +    G +++I     L  +W     L
Sbjct: 152 TQP-LTTSGLQSGVVDLTLPS--GRTIHAVQRIVRALPGQVVVIQE--DLGSIWGSNTAL 206

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
            +   +    ++L + F+++ Q+ + +E D I       ++TAL  GRCGLW+++    +
Sbjct: 207 SITLSATTGFVVLILGFAFHWQSTRAREGDAINDAVRGRIDTALDSGRCGLWDWDLSRGR 266

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
              SRSM+ ++G+   +  L+F  +  L+  D+  +  IA  +    + Q+D  F M HA
Sbjct: 267 IFWSRSMFTMLGLESRSDLLTFGEVNALVKSDDIDLFAIANQLILGEITQIDHTFRMLHA 326

Query: 338 SGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
           +G  IW++VR ++       G+++IGIA+D+TE   L +R  EAD RL  AIE   EA V
Sbjct: 327 NGHWIWLRVRCEIGEGGGDAGLHLIGIAVDITEHKSLAERTVEADLRLRDAIETIPEAFV 386

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPE--RSQDMS 454
           LWD  +RLV+CN+++Q+ + LPD  + PG +   + +  + P  E RT  PE   +Q  +
Sbjct: 387 LWDAENRLVLCNSHFQRLHQLPDSAVTPGTSYDTVIEVGSMP--EARTRSPECGGAQLGA 444

Query: 455 K--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
           +  E +L + +WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL  S+
Sbjct: 445 RTFEAQLDNGQWLHISERRTKDGGYVAVGTDITRIKDHEHKLIDNDLRLRATVADLKISQ 504

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
             LERQ  +L+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++   +
Sbjct: 505 VKLERQAVQLADLARKYAEEKYRAEDANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGM 564

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
           FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ +D +  D    ++E +R+
Sbjct: 565 FGRLGSEKYQEYCHDILTSGHYLLEVINDILDMSKIEAGRMKLDLEPLDFAGTLSESLRV 624

Query: 633 IGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
           +   A++K +++   I   +   AD+R +K+IL  +LSN++KFT   G++ +R       
Sbjct: 625 VSGRAENKQLELHADIEQGISVIADRRAVKQILVNLLSNAVKFTPEGGQITVRGRARADS 684

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           +++ IADTGIGI   +L K+GQPFE + +Q  +S  G GLGLAI+ +LTNLHGG +++ S
Sbjct: 685 IVLMIADTGIGIAPQSLRKLGQPFEQVESQLTKSYHGSGLGLAIAKSLTNLHGGSMRLRS 744

Query: 753 QEGKGTIVTICMPQ 766
           Q G+GT+V + +P+
Sbjct: 745 QLGQGTVVRLVLPR 758


>gi|49475278|ref|YP_033319.1| two-component sensor histidine kinase [Bartonella henselae str.
           Houston-1]
 gi|49238084|emb|CAF27291.1| Two-component sensor histidine kinase [Bartonella henselae str.
           Houston-1]
          Length = 773

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 242/617 (39%), Positives = 378/617 (61%), Gaps = 6/617 (0%)

Query: 151 IGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRV-PLLR 209
           +GK + + I E    RS  K   + + ++ +    + S +   N    + I+ +   + R
Sbjct: 157 LGKPLQDFISESIALRSLRKHAGIMKVTIGKDAPALASFHQTENGKYGVFISEKTQEIYR 216

Query: 210 LWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLW 269
            WR+  +L +        ++L +L++YY Q  + ++ D+I  +    ++ A+ RGRCGLW
Sbjct: 217 EWRKIFSLNITLLIGTGGVILALLYAYYNQIVRARKTDSISEKIQNRIDMAMMRGRCGLW 276

Query: 270 NFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLD 329
           ++N  + + + SR+MYE++G   ++  LS   I  +I+ ++    ++A+ +     K +D
Sbjct: 277 DWNMASGRVYWSRAMYEMLGYIPQDALLSISQITAIINPNDANFFDLAQELMSGKKKHID 336

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
               MRHA G  +W+++RA++  T    ++++GIA D++E+  L +  A+AD R+  AIE
Sbjct: 337 INVPMRHADGHYVWMRIRAEV--TDEEELHLVGIAFDISEQRQLAEETAQADLRIRDAIE 394

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII-EYRTSDPE 448
             SE+ VLWD   RLVM N+ + +   +P  VL PG  R+ ++ A  RP I EY   D +
Sbjct: 395 NISESFVLWDSEGRLVMSNSKFCEYAAIPKQVLQPGIQRATVE-AMARPAINEYPLKD-D 452

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            + +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L
Sbjct: 453 GTGNLTSIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQEL 512

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             +R   +++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++
Sbjct: 513 KRARGNAQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIM 572

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +  FG LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + ++D++N DL PII+E
Sbjct: 573 LQSTFGPLGSQRYQEYMHDIYNSGNHLLTLINDILDMSKIEAGRFTLDRKNIDLEPIISE 632

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            +R +   AQ KNI +   I  EL    D R +K+I   ++SN++KFT + G + +   K
Sbjct: 633 AVRTLTPQAQEKNISVSTNIAPELHAEVDGRAMKQIFLNLISNAVKFTPSGGSINVCAFK 692

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
               ++  I DTG+GIP+SA++K+GQPFE + NQ  ++  G GLGLAIS +L  LH G+L
Sbjct: 693 KKNNLVCRIKDTGVGIPQSAIKKLGQPFEQVENQLTKTHTGSGLGLAISRSLLELHKGKL 752

Query: 749 KIISQEGKGTIVTICMP 765
           +IIS+E KGT VTI MP
Sbjct: 753 EIISKEMKGTTVTITMP 769


>gi|182678998|ref|YP_001833144.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634881|gb|ACB95655.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 797

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 231/576 (40%), Positives = 356/576 (61%), Gaps = 3/576 (0%)

Query: 194 NSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEA 253
           ++G + +I+    +L  WR       +     S +L+ +  +Y+ QA + KE        
Sbjct: 182 SAGQVALIHPMTEVLSEWRANSWRAGLLLFSTSFVLVALACAYFWQATRAKEAGETCERM 241

Query: 254 NICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI 313
              ++TAL+RGRCGLW+++    +   S+SMYEI+G+    + +SF  I  L+H  +  +
Sbjct: 242 RERIDTALNRGRCGLWDWDLARGRVFWSQSMYEILGMSPSEQFISFGDINALMHPQDGDL 301

Query: 314 CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYH 372
             IA  +       +D  F MR+ +G  +W++ RA+++R  +S   +++GI +D+TE   
Sbjct: 302 AAIAEMLAASKTDAIDHAFRMRNVAGDWVWLRARAELVRDHLSNTPHLVGICVDITEHKV 361

Query: 373 LEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ 432
           L +R A AD RL  AIE  SEA VLWD ++RLVMCN  +Q+ + L + +LVPG     + 
Sbjct: 362 LAERTATADMRLRDAIETVSEAFVLWDADNRLVMCNEKFQRFHNLANDILVPGTPYMQVM 421

Query: 433 DAQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
              T P+I+ + +  ER Q  ++  E +L D RWLQINE  T DGG +SVGTDIT LK +
Sbjct: 422 AKGTPPLIQSQIALGERPQAGARTYEARLGDGRWLQINERRTKDGGYVSVGTDITTLKRH 481

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           + QL ES+RRL ATI DL  SRQ LE Q  +L+    KY  +K  AETAN+ KSEFL  M
Sbjct: 482 EEQLMESERRLMATIADLRKSRQTLELQAQQLADLAEKYLEQKAEAETANRAKSEFLTNM 541

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHELRTPLNAI+GFSE++ +E +G LGS +Y +Y  DI  SGQ+LL +I+++L+MS++E 
Sbjct: 542 SHELRTPLNAIIGFSELMGQEPYGPLGSPRYLDYCNDIRQSGQYLLGVISDVLDMSRLEA 601

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILS 670
            ++ ++K + ++  ++++ I  + ++A+ K I +  +   +   +AD+  I+KIL  +L 
Sbjct: 602 GRVRLEKTDFEIDTVVSKAIAGVKATAEEKEITLLAETTPQTSVHADRGAIEKILLILLR 661

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N+IKFT   G++ +RT  I   + I + DTG+GIP + L ++G+PFE LH      + G 
Sbjct: 662 NAIKFTPAQGRVTVRTRMIQGALNIYVEDTGMGIPPAPLARLGRPFEQLHGSMANGMKGS 721

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           GLGLAI+ +L +LHGG ++I S  G GTIV + +P+
Sbjct: 722 GLGLAIARSLVDLHGGSMRIRSTVGSGTIVLVRIPE 757


>gi|86750547|ref|YP_487043.1| histidine kinase [Rhodopseudomonas palustris HaA2]
 gi|86573575|gb|ABD08132.1| histidine kinase [Rhodopseudomonas palustris HaA2]
          Length = 771

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 251/734 (34%), Positives = 424/734 (57%), Gaps = 24/734 (3%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAI-EIIFQNNNIKFDL 106
             + +P++ + FL+ I   + ++   +  Q+    N+    L + + E +     ++ D 
Sbjct: 38  LRRAVPILIIAFLITICFGAAVQFIDQSRQKRAALNRDLCALADLLAERLEHIGVVRLDR 97

Query: 107 -ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFA------SSTKNSHYIGKKIGEII 159
            AS ++ +++L  L+      +   +++   ++ V A       ++  S ++   I    
Sbjct: 98  PASIERLQNLLPGLIPSWGIAAGRHVIVTSADQRVLARVPGDEGTSAASSFL--DIISAT 155

Query: 160 PELSRSRSRSKTVQM---SEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVT 216
           P L+RS  +    Q+   S AS     + V S  LP   G +++I+       + R +  
Sbjct: 156 PPLTRSAQQGTITQIILPSGASALATLHTVKS--LP---GQVIVIHEDTG--SILRSDAA 208

Query: 217 LEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNK 276
           L++   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++    
Sbjct: 209 LQITLSATTGFVVLILGFAFHWQSTRAQEGDLINDAVRSRIDTALNRGRCGLWDWDLSRG 268

Query: 277 KFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
           +   S+SM+ ++G+   N  L+F  +  L++ D+  +  I   +   +   +D  F MRH
Sbjct: 269 RIFWSQSMFTLLGLESRNDLLTFGEVNALVNSDDIDLFAIGDQLIAGNTDHIDHSFRMRH 328

Query: 337 ASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           A+G  IW+++R ++ + T S   ++IGIA+D+TE+  L +R  EAD RL  AIE   EA 
Sbjct: 329 ANGHWIWLRMRCELSQETQSDNKHLIGIAVDVTEQKSLAERTVEADLRLRDAIETIPEAF 388

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           VLWD ++RLV+CN+++Q+ + LPD  + PG +   + +    P I  R  D         
Sbjct: 389 VLWDADNRLVLCNSHFQRLHKLPDIAVAPGTSYETVIEVGQMPEIRTRLCDNSGGSSPGA 448

Query: 456 ---EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
              E +LAD  WL I+E  T DGG ++VGTDIT +K ++ +L ++  RL+AT+ DL  S+
Sbjct: 449 RTFEAQLADGSWLHISERRTKDGGYVAVGTDITRIKAHEQKLVDNDLRLRATVADLKISQ 508

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
             LERQ  EL+    KY  EK RAE AN+TKS+FLA MSHELRTPLNAI+GFSE++   +
Sbjct: 509 YKLERQAIELADLARKYSEEKTRAEEANQTKSKFLANMSHELRTPLNAIIGFSEIMGSGM 568

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
           FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ +D +  DL   + E +++
Sbjct: 569 FGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLDMEELDLARTLGESLKV 628

Query: 633 IGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
           +   A+ K +++  +I  ++   AD+R +K+IL  +LSN++KFT + G++ +R+  +   
Sbjct: 629 VAGRAEHKQLELLSEIEDDIPIVADRRAVKQILINLLSNAVKFTPDGGRVTVRSRTLPNA 688

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           +++ IAD+GIGI   +L ++GQPFE + +Q  ++  G GLGLAI+ +LT LHGG +++ S
Sbjct: 689 IVLMIADSGIGIAPQSLRRLGQPFEQVESQLSKTYHGSGLGLAIAKSLTTLHGGSMRLRS 748

Query: 753 QEGKGTIVTICMPQ 766
             G GT+V + +P+
Sbjct: 749 TLGAGTVVMVTLPR 762


>gi|319406908|emb|CBI80543.1| two-component sensor histidine kinase [Bartonella sp. 1-1C]
          Length = 769

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 279/777 (35%), Positives = 437/777 (56%), Gaps = 31/777 (3%)

Query: 8   LANYGLYYPGNR----QKITVSSKQ-AFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVF 62
           +A   +Y    R     K +VS+++    R   SI   L        ++IP   ++ L+ 
Sbjct: 1   MAKLDVYNAATRMHSDSKPSVSNRRVGVTRISNSIYQKLLFIEPWLRRSIPFAIIISLIV 60

Query: 63  IATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDL---ASQKKAESMLGQL 119
           +AT   I+  + Y  +  +       L+     I   N I  DL     QKK  S+    
Sbjct: 61  LAT---IRFASFYDWRHTIGKNARSTLSLLSSSII--NKIDHDLLIFTQQKKVASLSHNH 115

Query: 120 LAK--TRFLSES------FILLAQPNELVFASSTKNSHYI-GKKIGEIIPELSRSRSRSK 170
           L    T F   S       I +   N  + ASS  NS  I G+ + + I +   S    K
Sbjct: 116 LQNILTTFHHHSSTNINPMIAILDRNGNMLASS--NSEMISGESLQDFISKNIDSWPLKK 173

Query: 171 TVQMSEASLDQQPYHVLSVNLPHNSG--SILIINSRVPLLRLWREEVTLEVVFFSIISAL 228
              + + ++ Q+P   L+     +SG   + I  ++  + R W+++ +L +  F    ++
Sbjct: 174 NTSIIQITIGQEP--ALASFNQTDSGQYGVFISATKKHIYREWQKKFSLNITLFIGTVSI 231

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM 288
           +L +L++YY Q  + +  D I  +    ++ A+ RGRCGLW++N  + + + SR+MYE++
Sbjct: 232 ILVLLYAYYNQITRARNTDLISEKIQNRIDMAMMRGRCGLWDWNMASGRVYWSRAMYEML 291

Query: 289 GIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRA 348
           G   +N  LS   I  +I   +    E+A+ + G   K +D    MRHA G  +W+++RA
Sbjct: 292 GYEPQNALLSISQITAIIDPKDANFFELAQELMGSEKKHIDINVPMRHAEGHYVWMRIRA 351

Query: 349 QMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCN 408
           ++  T     +++GI+ D++E++   ++ A AD R+  AIE  SE+ VLWD   RLVM N
Sbjct: 352 EV--TDEEEPHLVGISFDISEQHQFAEQTARADLRIRDAIENISESFVLWDSEGRLVMSN 409

Query: 409 ANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQIN 468
           + + +   +P  +L  G  R+ ++ A +RP I       + S +++   + AD  WL+IN
Sbjct: 410 SKFCEYASIPKQMLQSGIERATVE-AMSRPAISEYPLKIDESGNLTSIRQTADGYWLKIN 468

Query: 469 EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
           E  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +R   +++ TE+   N  
Sbjct: 469 ERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARGNAQQRATEVEKLNKS 528

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
            Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFSE++ +  FG LGS +Y EY  DI
Sbjct: 529 LQEEKERAESANKAKSEFLANISHELRTPLNAILGFSEIMLQSTFGPLGSQRYKEYMHDI 588

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
           H SG HLL +IN+IL+MSKIE  + ++D++N +L PII+E IR +   AQ+K I +   I
Sbjct: 589 HNSGTHLLTLINDILDMSKIEAGRFTLDRKNINLEPIISETIRTLTPQAQAKKISLTTNI 648

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
             +L  + D R +K+I   ++SN++KFT + G + IR  +    +I +I DTG+GIP+ A
Sbjct: 649 EQKLHADVDCRAMKQIFLNLISNAVKFTPSGGSIDIRAFQKNNNLIFSIKDTGVGIPQEA 708

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L+I S+E KGTIVTI MP
Sbjct: 709 IKKLGQPFEQVENQFTKTHPGSGLGLAISRSLLELHKGKLEITSKEAKGTIVTIIMP 765


>gi|220925321|ref|YP_002500623.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
 gi|219949928|gb|ACL60320.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
          Length = 782

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 258/745 (34%), Positives = 415/745 (55%), Gaps = 27/745 (3%)

Query: 32  RAYTSIISHLFSFFSSFNQTIPMISMVFLV--FIATSSIIKVTTRYAQQE--KMTNQTSL 87
           RA T     L    S     IP I  +FL+  F  T++ +    R A  E  +  +  + 
Sbjct: 21  RAITPAHQRLARAESWLRFAIPAILGLFLISLFAITATQLLAQRRDAVAEAGRQIDLLAR 80

Query: 88  MLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASST-- 145
           ++  ++      + ++ D A    A             ++   + L  P++ + AS    
Sbjct: 81  LVAASLSSTAPESELRLDGAVPASA------------LVAGRAVYLIGPDDRIAASLPAL 128

Query: 146 -KNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSR 204
               H +   +GE  P L       +   +  A+L   P       LP   G + ++ S 
Sbjct: 129 LPPGHRLADHLGEAQPLLILG----ERAGVMTATLGGAPALATLRALPSGRGRVAVVQSL 184

Query: 205 VPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRG 264
                 WR     E V     + +++ +  +Y  QA + +  D +  +    ++TAL RG
Sbjct: 185 DTATADWRSRARTEAVVIGTATLVIVCVGLAYTLQADRARTVDRVCEQVRQRLDTALCRG 244

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKH 324
           RCGLW+++    + + S SMY+++G   E++ LSF  +  L+H D+  +  +A  +  + 
Sbjct: 245 RCGLWDWDIARGRIYWSDSMYQLLGYVREHEFLSFGDVNALVHPDDTDLYGLASQLAAQD 304

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRT-ISGGMNIIGIAMDLTEKYHLEKRYAEADQR 383
              +D  F +R A+G  IW++ RA+++R    GG +++GI +D++E+  L +  A AD R
Sbjct: 305 AT-VDHEFRIRSAAGEWIWLKARAEIVRDQDDGGRHLVGIIIDISEQRRLAESTATADMR 363

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR 443
           L  A+E  SEA VLWD  +RLV+CN+ +++ + L      PG     I      P +   
Sbjct: 364 LRDAVEAVSEAFVLWDAQNRLVLCNSKFRRLHALTLEEAQPGRRYDAIMGRAAVPAVRRE 423

Query: 444 TSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
             + + ++  ++  E +LAD RWLQI+E  T DGG +SVGTDIT LK +Q +L ES+R+L
Sbjct: 424 IPNTDLAELGARTFEAELADGRWLQISERRTKDGGYVSVGTDITTLKRHQERLVESERQL 483

Query: 502 KATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAI 561
            ATI DL  SR+ LE Q  +L+    +Y  +K +AE+AN++KSEFLA MSHELRTPLNAI
Sbjct: 484 IATIADLKRSRRTLELQTQQLADLAERYLDQKAQAESANRSKSEFLANMSHELRTPLNAI 543

Query: 562 LGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNAD 621
           LGF+EV++ E+FG+LGS KY EY +DI  SG +LL++I++IL+MS+IE  ++++ KQ   
Sbjct: 544 LGFAEVMQDEVFGQLGSEKYREYCRDIRSSGHYLLSVIDDILDMSRIEARRVTLVKQPVP 603

Query: 622 LIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
           +   +   ++LI   A++K + +  ++ ++    AD+R + +IL  +L N++KFT   G+
Sbjct: 604 VAEALERALKLIAEPARAKGLTLSVEMSADAVVLADERALHQILVNLLQNAVKFTPEAGR 663

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +RT +    V I + D+GIGIPK+ L K+G PFE + + + +S  G GLGLAIS +LT
Sbjct: 664 VAVRTRRALDAVHIFVEDSGIGIPKAVLPKLGAPFEQVESNFSRSFKGSGLGLAISRSLT 723

Query: 742 NLHGGRLKIISQEGKGTIVTICMPQ 766
            LHGGRL+I S+ G GTIV + +PQ
Sbjct: 724 ELHGGRLRIRSEVGCGTIVLVRLPQ 748


>gi|307945461|ref|ZP_07660797.1| Non-motile and phage-resistance protein [Roseibium sp. TrichSKD4]
 gi|307771334|gb|EFO30559.1| Non-motile and phage-resistance protein [Roseibium sp. TrichSKD4]
          Length = 790

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 260/739 (35%), Positives = 417/739 (56%), Gaps = 39/739 (5%)

Query: 52  IPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKK 111
           +P++ ++F+  +A+         Y   E M +   +  T   E+      I   LAS +K
Sbjct: 53  VPILCLIFIGTLAS---------YRAAELMNDHQRVDETVRHELELTATIISKHLASAEK 103

Query: 112 AESMLGQLLAKTRFLSESF----------ILLAQPNELVFASSTKNSHYIGKKIGEIIPE 161
                GQ  A  R L+ES           IL+   N  + AS+    +  G+ I +I   
Sbjct: 104 DLPEQGQQSAIQRVLAESLPTGATSDGRVILVTDENARIIASAPLRPNLNGQPISDIFGA 163

Query: 162 LSRSRSRSKTVQMSEASLD-------QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREE 214
                       + E +LD       +  Y  +  +L    G + II     +   WR +
Sbjct: 164 SQPLTVFGARAGIMEVALDIFGNGEMEDTYSTIH-HLDGELGMVAIIQPTNSVYAEWRSD 222

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
           V+  V  F   +++LL +++++Y QA + ++ D I       ++TAL+ GRCGL++++  
Sbjct: 223 VSANVTLFVGTASILLVLIYAFYAQANRAEQADEIYAATRTRIDTALNHGRCGLFDWDLS 282

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
             +   S S+YE++G   ++  LSF  +A L H D+  + E+A  +       +D++F M
Sbjct: 283 RGRIFWSSSLYEMLGHKPKDSLLSFAEVADLTHPDDVDLYELATELLEAGGGIVDKMFRM 342

Query: 335 RHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           RHA+G+ +W++ R ++         ++IGI +D+TE++ LE++   AD RL  AIE  SE
Sbjct: 343 RHANGSWVWLRARGEIQSEPGRSEPHLIGICIDVTEQHRLEEQSRTADLRLRDAIETISE 402

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG----NARSIIQDAQTRP---IIEYRTSD 446
           A VLW+KN+ LV+CN+NYQ+ +GLP H + PG    +  +  ++ Q  P    I  R   
Sbjct: 403 AFVLWNKNNELVICNSNYQELHGLPTHAVTPGTPYKDVMAAAENTQVAPQPVKISQRVDA 462

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
           PE S     E +L D RWLQI+E  T DGG +SVGTDIT LK ++ QL + ++ L AT++
Sbjct: 463 PEGSY----EAQLDDGRWLQISERRTKDGGFVSVGTDITALKRHEEQLIDREKELNATVD 518

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL+ SR+ L+ Q  +L     KY  E+ RAE ANK KSEFLA +SHELRTPLNAI+GFS+
Sbjct: 519 DLTRSRKTLQLQAKQLEELADKYSEERNRAENANKAKSEFLANISHELRTPLNAIIGFSD 578

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++ KE+FG LG+ KY +Y  DIH SG +LLN+IN+IL+MSKIE  ++SI+ ++       
Sbjct: 579 IMNKEMFGPLGTEKYSDYCHDIHNSGTYLLNVINDILDMSKIEAGRMSIETEDLSAKEAA 638

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            +  R++ ++A+ K+I +   +   +   AD+R +K+IL  +L+N++KFT  +G + ++ 
Sbjct: 639 EDAARIMSTAAREKHIDVTCTVEDGIQVRADRRALKQILLNLLANAVKFTPEHGTVSLKA 698

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            +    +   I+DTGIGI    + ++ QPF  + NQ+ ++  G GLGLAI+ +L  +HGG
Sbjct: 699 HQEKNRICFEISDTGIGIADKDIARLAQPFVQVENQFTKTHQGSGLGLAIARSLIEIHGG 758

Query: 747 RLKIISQEGKGTIVTICMP 765
           +L+I S+ G+GT V   +P
Sbjct: 759 KLEISSELGEGTHVRFLLP 777


>gi|49474041|ref|YP_032083.1| two-component sensor histidine kinase [Bartonella quintana str.
           Toulouse]
 gi|49239545|emb|CAF25902.1| Two-component sensor histidine kinase [Bartonella quintana str.
           Toulouse]
          Length = 773

 Score =  449 bits (1154), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 267/729 (36%), Positives = 425/729 (58%), Gaps = 23/729 (3%)

Query: 50  QTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDL--A 107
           + IP I +VFLV +A    + +   Y   +K T  T  +L   I     +N I  DL  A
Sbjct: 51  RAIPFIIVVFLVVLAAIRFVSIHDWYRAIDKNTRSTITLLAAHI-----SNTIDRDLLAA 105

Query: 108 SQK-KAESM----LGQLLAKTR----FLSESFILLAQPNELVFASSTKNSHYIGKKIGEI 158
           +QK KA ++    L  +L   R      + + I +   N  V ASS+ +   +GK + + 
Sbjct: 106 TQKGKAAALSHNHLQNILTNFRNQGLIKTSTVIAIVDQNGNVLASSS-SEIILGKPLQDF 164

Query: 159 IPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP-LLRLWREEVTL 217
             E +  +S S+   + + ++ +    +   +   N    + I+ ++    + WR+   L
Sbjct: 165 TSESTALQSLSQHAGVMQITIKKNDPALALFHQTENGQYGVFISEKIQHTYKEWRKIFLL 224

Query: 218 EVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKK 277
            +  F   + ++L +L++YY Q  + ++ D I  +    ++ A+ RGRCGLW++N  + +
Sbjct: 225 NITLFIGTTGIILSLLYAYYHQIIRARKTDLISEKIQNRIDMAMMRGRCGLWDWNMASGR 284

Query: 278 FHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHA 337
            + SR+MYE++G   ++  LS   I  +I  ++    ++A+ +     K +D    MRHA
Sbjct: 285 VYWSRAMYEMLGYVPQDALLSISQITGIISPNDANFFDLAQELMSGKKKHIDINVPMRHA 344

Query: 338 SGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVL 397
            G  +W+++RA++  T     +++GI+ D++E++   +  A+AD R+  AIE  SE+ VL
Sbjct: 345 DGHYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFAEETAQADLRIRDAIENISESFVL 402

Query: 398 WDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII-EYRTSDPERSQDMSKE 456
           WD   RLVM N+ + +   +P  +L PG  R  ++ A  RP I EY   D + + +++  
Sbjct: 403 WDSEGRLVMSNSKFCEYAAIPKQILQPGIQRETVE-AMARPAINEYPLKD-DGTGNLTSI 460

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
            + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +R   +
Sbjct: 461 RQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARGNAQ 520

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
           ++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++ +  FG L
Sbjct: 521 QRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIMLQSTFGPL 580

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
           GS +Y EY +DI+ SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E +R +   
Sbjct: 581 GSKRYKEYMRDIYNSGSHLLTLINDILDMSKIEAGRFTVDCKNIDLEPIISEALRTLIPQ 640

Query: 637 AQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIIT 696
           AQ KNI +   I ++L    D R IK+I   ++SN++KFT + G + +   K    ++  
Sbjct: 641 AQEKNIFVTTNIATKLHAEVDGRAIKQIFLNLISNAVKFTPSGGNIDVCALKKKNNLVFK 700

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I DTG+GIP+SA++K+GQPFE + NQ  ++  G GLGLAIS +L  LH G+L+IIS+E K
Sbjct: 701 IKDTGVGIPQSAIKKLGQPFEQVENQLTKTYTGSGLGLAISRSLLELHKGKLEIISKEMK 760

Query: 757 GTIVTICMP 765
           GT VTI +P
Sbjct: 761 GTTVTITIP 769


>gi|328544516|ref|YP_004304625.1| Multi-sensor signal transduction histidine kinase [polymorphum
           gilvum SL003B-26A1]
 gi|326414258|gb|ADZ71321.1| Multi-sensor signal transduction histidine kinase [Polymorphum
           gilvum SL003B-26A1]
          Length = 787

 Score =  445 bits (1145), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 252/730 (34%), Positives = 412/730 (56%), Gaps = 18/730 (2%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMT-NQTSLMLTEAIEIIFQNNNIKFDL 106
           F + IP++ +VF+  +A    +++T  +   E+   ++ SL+ +     + Q      +L
Sbjct: 49  FRRLIPILCLVFIASLALYRTLELTFDHQDTERQARDEISLIASVLSARLGQEETALPEL 108

Query: 107 ASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPE---LS 163
             +   + +L   L          ILL  P+ ++ AS+    H  G+ I  ++     L+
Sbjct: 109 GYRSALQRVLADALPAGATSRGRSILLTDPDGMIVASAPLQPHLEGQPITALLGPSQPLT 168

Query: 164 RSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFS 223
              +R+  + + + S  +    V   +L    G + ++     +   WR  V+  V  F 
Sbjct: 169 VFGARAGVMMVDKGSAGEALATVH--HLDGRLGMVAVMQPEKEIFADWRGNVSANVTLFV 226

Query: 224 IISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRS 283
             S +LL ++++++ QA + ++ D I       ++TAL+ GRCGL++++    +   S S
Sbjct: 227 GTSTVLLVLVYAFFSQATRAEQADEIYAATRTRIDTALTHGRCGLFDWDLARGRIFWSAS 286

Query: 284 MYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIW 343
           +Y+++G   ++  L F  IA L H D+  +  +A ++       +D++F MRHA G+ +W
Sbjct: 287 LYDLLGREPKDDILGFAEIADLTHPDDIDLYRLAETLLETGQTTVDRMFRMRHADGSWVW 346

Query: 344 IQVRAQMMRTISGGM--NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKN 401
           ++ R ++ +T  G    ++IGI +D+TE++ L ++   AD RL  AIE  SEA VLW+ +
Sbjct: 347 LRARGEV-QTDPGRAEPHLIGICIDVTEQHELAEQSRTADLRLRDAIETISEAFVLWNAD 405

Query: 402 DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQ------TRPIIEYRTSDPERSQDMSK 455
           + LV+CN+NYQ  + LP+  + PG   + +  A       T P+       P    + S 
Sbjct: 406 NELVICNSNYQSLHNLPEQAVRPGAPYAEVMAAARNSHITTSPL---HGGTPGAGANASY 462

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           E +L D RWLQI+E  T DGG +SVGTDIT LK ++ +L +S+RRL AT++DL  SRQ L
Sbjct: 463 EAQLDDGRWLQISERRTKDGGFVSVGTDITTLKRHEERLLDSERRLMATVSDLRKSRQTL 522

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           E Q  +L     KY  EK  AE AN+ KSEFLA +SHELRTPLNAI+GFS+++ + +FG 
Sbjct: 523 EMQAQQLVELAEKYAQEKTNAENANRAKSEFLANISHELRTPLNAIIGFSDIMDRGMFGP 582

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           +GS +Y EY +DIH SG +LLN+IN+IL+MSKIE  ++ +  +   +  ++ E  R+I +
Sbjct: 583 IGSERYAEYCRDIHESGTYLLNVINDILDMSKIEAGRMEMTVKPLGVEAVVEEAGRIIRA 642

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
            AQ K I++  ++   L   AD+R +K++L  +LSN +KFT   G + +   + G     
Sbjct: 643 PAQEKAIEVTCEVEPGLAVAADRRALKQVLLNLLSNGVKFTPEKGTVRLSVHRAGGLARF 702

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            IADTGIGI K+ ++++ QPF  + NQ+ ++  G GLGLAI+ +L  L GG L I S  G
Sbjct: 703 EIADTGIGIRKADVDRLAQPFVQVENQFTKTHKGSGLGLAIARSLVELQGGTLTIASVPG 762

Query: 756 KGTIVTICMP 765
           +GT V   +P
Sbjct: 763 QGTRVAFTLP 772


>gi|319405334|emb|CBI78952.1| two-component sensor histidine kinase [Bartonella sp. AR 15-3]
          Length = 769

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/555 (41%), Positives = 353/555 (63%), Gaps = 3/555 (0%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           W+++++L +  F    +++L +L++YY Q  + +  D I  +    ++ A+ RGRCGLW+
Sbjct: 214 WQKKLSLNITLFIGTVSIILVLLYAYYNQIIRARNTDLISEKIQNRIDMAMMRGRCGLWD 273

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           +N  + + + SR+MYE++G   +N  LS   I  +I   +    E+A+ +     K +D 
Sbjct: 274 WNMASGRVYWSRAMYEMLGYEPQNALLSISQITAIIDPKDANFFELAQELMDSKKKYIDI 333

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
              MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A+AD R+  AIE 
Sbjct: 334 NVPMRHAKGYYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFVEQTAQADLRIRDAIEN 391

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ ++ A +RP I       + +
Sbjct: 392 ISESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIERATVE-AMSRPAISEYPLKIDET 450

Query: 451 QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
            +++   + AD  WL+INE  T DGG + VGTDI+ LK  Q +  +S+RRL + I +L  
Sbjct: 451 GNLTSIRQTADGYWLKINERRTQDGGLVCVGTDISELKQQQEKFEDSERRLFSFIQELKR 510

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFSE++ +
Sbjct: 511 ARGNAQQRATEVEKLNKSLQEEKERAESANKAKSEFLANISHELRTPLNAILGFSEIMLQ 570

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
             FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D++N +L PII+E I
Sbjct: 571 STFGPLGSQRYKEYVHDIHNSGTHLLTLINDILDMSKIEAGRFTLDRKNINLEPIISETI 630

Query: 631 RLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           R +   AQ+K I +   I  +L  N D R +K+I   ++SN++KFT + G + IR  +  
Sbjct: 631 RTLTPQAQAKKISLTTNIEQKLHANVDCRAMKQIFLNLISNAVKFTPSGGSIDIRAFQKN 690

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             +I +I DTG+GIP+ A++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L+I
Sbjct: 691 NNLIFSIKDTGVGIPQEAIKKLGQPFEQVENQFTKTHPGSGLGLAISRSLLELHKGKLEI 750

Query: 751 ISQEGKGTIVTICMP 765
            S+E KGTIVTI MP
Sbjct: 751 TSKEAKGTIVTIIMP 765


>gi|170738618|ref|YP_001767273.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           sp. 4-46]
 gi|168192892|gb|ACA14839.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           sp. 4-46]
          Length = 764

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 240/643 (37%), Positives = 383/643 (59%), Gaps = 13/643 (2%)

Query: 131 ILLAQPNELVFAS---STKNSHYIGKKIGEIIPEL-SRSRSRSKTVQMSEASLDQQPYHV 186
           I L  P+E++ AS          +G+ +GE  P L    R+   TV +  A     P   
Sbjct: 107 IHLIGPDEVITASLPVPLPPGRSLGEHLGEAQPLLILGERAGLMTVGLRGA-----PALA 161

Query: 187 LSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKEN 246
               LP     + ++ S   +   W+     E +     + +++ I  +Y  QA + +  
Sbjct: 162 TLRALPGGQQRVAVVQSLDTVTAAWQGRARTEAMVIGTATLVIVCIGLAYTLQADRARAV 221

Query: 247 DTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLI 306
           D +  +    ++TAL RGRCGLW+++    + + S SMY+++G   E++ LSF  +  L+
Sbjct: 222 DRVCEQVRQRLDTALCRGRCGLWDWDIARGRIYWSDSMYQLLGYTREHEFLSFGDVNALV 281

Query: 307 HYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTI-SGGMNIIGIAM 365
           H D+  +  +A  +  +    +D  F +R A+G  IW++ RA+++R    GG +++GIA+
Sbjct: 282 HPDDTDLYGLASQLAAQDAT-VDHEFRIRSAAGEWIWLKARAEIVRDQEDGGRHLVGIAI 340

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           D++E+  L +  A AD RL  A+E  SEA VLWD  +RLV+CN+ +++ + L      PG
Sbjct: 341 DISEQRRLAESTATADMRLRDAVEAVSEAFVLWDAQNRLVLCNSKFRRLHALTPEDAQPG 400

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTD 483
                I      P +       E ++  ++  E +LAD RWLQI+E  T DGG +SVGTD
Sbjct: 401 RRYDTIMGRAAVPPVRREIQAGEFAETGARTFEAELADGRWLQISERRTKDGGYVSVGTD 460

Query: 484 ITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           IT LK +Q +L ES+R+L ATI DL  SR+ LE Q  +L+    +Y  +K +AE+AN++K
Sbjct: 461 ITALKRHQERLVESERQLIATIADLKRSRRTLELQTQQLADLAERYLDQKAQAESANRSK 520

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           SEFLA MSHELRTPLNAILGF+EV++ E+FG LG  KY EY +DI  SGQ+LL++I++IL
Sbjct: 521 SEFLANMSHELRTPLNAILGFAEVMQDEVFGHLGCEKYREYCRDIRSSGQYLLSVIDDIL 580

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKK 663
           +MS+IE  ++++ KQ   +  ++   ++++  +A++K + +  ++ ++    AD R + +
Sbjct: 581 DMSRIEARRVTLAKQPLPVAEVLERVLKVVAEAARAKGLTLSVEMNADAVVLADARALHQ 640

Query: 664 ILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQY 723
           IL  +L N++KFT + G++ +RT +    V I + D+GIGIP++ L K+G PFE + +  
Sbjct: 641 ILLNLLQNAVKFTPDAGRVAVRTRRALDAVHIYVEDSGIGIPRTVLPKLGAPFEQVESNL 700

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            +S  G GLGLAI+ +LT LHGGRL+I S+ G GTIV + +PQ
Sbjct: 701 SRSFKGSGLGLAIARSLTELHGGRLRIRSEVGSGTIVLVRLPQ 743


>gi|217976388|ref|YP_002360535.1| multi-sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
 gi|217501764|gb|ACK49173.1| multi-sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
          Length = 795

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 232/584 (39%), Positives = 358/584 (61%), Gaps = 5/584 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V ++N P   G + I+     +L  WR       V     + +L+ +  +Y+ QA + +E
Sbjct: 180 VRTLNQPF--GQLAIVYPMSAVLADWRAASLRTGVLLVATALVLIALALAYFWQASRARE 237

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TALSRGRCGLW+++    + + S SMY+I+G+      LSF  I  L
Sbjct: 238 ADRVCERVRDRIDTALSRGRCGLWDWDLARGRIYWSDSMYQILGLAPVGNFLSFGDINAL 297

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIA 364
           +H  +  +  IA  +T    + +D  F M++  G  +W++ RA+++R  +G   +++GI 
Sbjct: 298 VHPQDGDLAAIAEMLTASKAESVDHAFRMQNVKGEWVWLRARAELVREQAGATPHLVGIC 357

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           +D+TE+  L +R A AD RL  AIE  SEA VLWD +++LVMCN+ +QK + L    ++ 
Sbjct: 358 VDITEQKTLAERTATADMRLRDAIESVSEAFVLWDADNQLVMCNSKFQKFHNLSSEAVIS 417

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGT 482
           G   + + +  T P+I+ +T+  ER Q  ++  E +L D RWLQINE  T DGG +SVGT
Sbjct: 418 GTPYAQVMEKGTPPMIQAQTALGERPQAGARTYEARLGDGRWLQINERRTKDGGYVSVGT 477

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
           DIT LK ++ QL ES+RRL AT+ DL  SRQ LE+Q  +L+    +Y  +K  AETANK 
Sbjct: 478 DITALKRHEEQLMESERRLMATVADLRKSRQTLEQQAQQLADLAERYLEQKAEAETANKA 537

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KSEFLA MSHELRTPLNAI+GFSEV+++E FG LGS KY +Y+ DI  SG++LL +I+++
Sbjct: 538 KSEFLANMSHELRTPLNAIIGFSEVMQQETFGPLGSKKYVDYSNDIKQSGEYLLGVISDV 597

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIK 662
           L+MS++E+ ++ + K   +L   ++  +  +   A+ K I +  +       NAD+   +
Sbjct: 598 LDMSRLESGRVRLQKSEFELDAAVSGALATVEQIAREKEITLVAEAMPGKRANADRAAFE 657

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           KIL  +L N++KFT  +G++ +R   +   + + I DTGIGI  +A  ++G+PFE +   
Sbjct: 658 KILAILLRNAVKFTPKDGRVSVRARFVQGALNVYIEDTGIGIAPAAQARLGRPFEQMGGS 717

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            D  + G GLGLAI+ +L +LHGG ++I S  G GTIV + +PQ
Sbjct: 718 LDNGMKGSGLGLAIARSLVDLHGGSMRIRSTVGSGTIVLVHLPQ 761


>gi|154245571|ref|YP_001416529.1| PAS/PAC sensor signal transduction histidine kinase [Xanthobacter
           autotrophicus Py2]
 gi|154159656|gb|ABS66872.1| PAS/PAC sensor signal transduction histidine kinase [Xanthobacter
           autotrophicus Py2]
          Length = 770

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 259/745 (34%), Positives = 416/745 (55%), Gaps = 57/745 (7%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             + +P + + FLV I   +++++   +A +                 + + NN K DL 
Sbjct: 38  LRRIVPALIVTFLVVIGVGAVVQI---HAHR-----------------VAELNNAKDDL- 76

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNEL-----VFASSTKNSHYIGKKIGEIIPEL 162
                 S+L    A+   L     L   P+ L       A+ +    Y+    G II   
Sbjct: 77  ------SLLALATAEGLTLRAGNSLARVPSALEESLPPRATESGRRAYVTDAQGRIIASA 130

Query: 163 SRSRSRSKTVQMSEASLDQQPYHVLS-----VNLPHNSGSIL--IINSRVPL-------- 207
            RS + +    + + +   QP  + +     + +P  +G+ L  + N   PL        
Sbjct: 131 PRSEAPANLADLIDPA---QPLVIFAERAGVLEVPFGTGTALATVRNLSAPLGQIVFLQP 187

Query: 208 ----LRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSR 263
               L  W +  TL V  F+    +LL + FS++ QA + +E D I       ++TAL+R
Sbjct: 188 TERALASWSDSTTLTVTLFTTTGTVLLILGFSFHWQASRAREADAIYDTVRRRIDTALNR 247

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGK 323
           GRCG+W+++    + + S +M+EI+G+  +++ +SF  IA+L+H D+  + E+A+ +  +
Sbjct: 248 GRCGMWDWDMARGRMYWSDTMFEILGLERKDELVSFGEIAKLVHPDDGDLYELAQELAER 307

Query: 324 HVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQ 382
               +D++F MR A G  +W+++RA++++     G ++IGIAMD+TE   + +R   AD 
Sbjct: 308 PGTPVDRVFRMRTAKGDFVWLRMRAEVVQQQGEDGPHLIGIAMDVTEAQRMAERTVTADM 367

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
           RL  AIE  SEA VLWD  +RLV+CN+ +Q  + LPD  +  G    +I      PI   
Sbjct: 368 RLRDAIESISEAFVLWDSQNRLVLCNSKFQSLHELPDEAIHAGTPFDVIASVGRHPITRT 427

Query: 443 RTSDPERSQDMSK--EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRR 500
                ++ ++ S+  E +L++ RWL+I E  T D G +SVGTDIT +K ++ +L ++++R
Sbjct: 428 PLKPEDKPEEGSRAFEAQLSNGRWLKIAERRTKDNGYVSVGTDITTMKRHEERLMDNEKR 487

Query: 501 LKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNA 560
           L A + DL  S+Q LE Q  +L+    KY  E+ +AE AN+ KSEFLA MSHELRTPLNA
Sbjct: 488 LMALVADLRKSQQTLEHQAQQLAELAEKYSEERNKAEDANRAKSEFLANMSHELRTPLNA 547

Query: 561 ILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA 620
           I+GFSE+++  +FG LGS KY EY  DI  SG +LL++IN+IL+MSKIE  ++ ++ ++ 
Sbjct: 548 IIGFSEIMESGMFGPLGSEKYAEYCTDIKGSGTYLLDVINDILDMSKIEAGRMQLEVEDL 607

Query: 621 DLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG 680
            L  II + +R+   +   KNI +       L    D+R +K+IL  +LSN++KFT   G
Sbjct: 608 ALDDIIADALRVTAVNGDEKNIAMTMAAAPNLAIKGDRRALKQILLNLLSNAVKFTPEGG 667

Query: 681 KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
            + ++    G   +I I DTGIGI K AL +IG+PFE + +Q+ ++  G GLGLAI+ +L
Sbjct: 668 NIAVKARINGAAAVIAIEDTGIGIAKDALARIGRPFEQVESQFTKTHKGSGLGLAIAKSL 727

Query: 741 TNLHGGRLKIISQEGKGTIVTICMP 765
             LHGG ++I S EG+GT V + +P
Sbjct: 728 VELHGGAMRIRSVEGRGTTVIVRLP 752


>gi|319403897|emb|CBI77483.1| two-component sensor histidine kinase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 769

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/555 (41%), Positives = 351/555 (63%), Gaps = 3/555 (0%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           W ++ +L +       +++L +L++YY Q  + +  D I  +    ++ A+ RGRCGLW+
Sbjct: 214 WEKKFSLNITLLIGTVSIILVLLYAYYNQVTRARNTDLISEKIQNRIDIAMMRGRCGLWD 273

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           +N  + + + SR+MYE++G   +N  LS   I  +I   +    E+A+ +     K +D 
Sbjct: 274 WNMASGRVYWSRAMYEMLGYEPQNALLSISQITAIIDPKDANFFELAQELMESKKKHIDI 333

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
              MRHA G  +W+++RA++  T     +++GI+ D++E++   ++ A+AD R+  AIE 
Sbjct: 334 NVPMRHAEGHYVWMRIRAEV--TDEEEPHLVGISFDISEQHQFAEQTAQADLRIRDAIEN 391

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ ++ A +RP I       + S
Sbjct: 392 ISESFVLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIERATVE-AMSRPAISEYPLKIDES 450

Query: 451 QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
            +++   + A+  WL+INE  T DGG + VGTDI+ LK  Q +  +S+RRL + I +L  
Sbjct: 451 GNLTSIRQTANGYWLKINERRTQDGGLVCVGTDISELKQQQEKFEDSERRLFSFIQELKR 510

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R   +++ TE+   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFSE++ +
Sbjct: 511 ARGNAQQRATEVEKLNKSLQEEKERAESANKAKSEFLANISHELRTPLNAILGFSEIMLQ 570

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
             FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D++N +L PII+E I
Sbjct: 571 STFGPLGSQRYKEYMHDIHNSGTHLLTLINDILDMSKIEAGRFTLDRKNINLEPIISETI 630

Query: 631 RLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           R +   AQ+K I +   I  +L  + D R +K+I   ++SN++KFT + G + IR  +  
Sbjct: 631 RTLTPQAQAKKISLTTNIEQKLHADVDCRAMKQIFLNLISNAVKFTPSGGSIDIRAFQKN 690

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             +I +I DTG+GIP+ A++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L+I
Sbjct: 691 NNLIFSIKDTGVGIPQEAIKKLGQPFEQVENQFTKTHPGSGLGLAISRSLLELHKGKLEI 750

Query: 751 ISQEGKGTIVTICMP 765
            S+EGKGTIVTI MP
Sbjct: 751 TSKEGKGTIVTIIMP 765


>gi|163867966|ref|YP_001609170.1| two-component sensor histidine kinase [Bartonella tribocorum CIP
           105476]
 gi|161017617|emb|CAK01175.1| two-component sensor histidine kinase [Bartonella tribocorum CIP
           105476]
          Length = 773

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 262/731 (35%), Positives = 421/731 (57%), Gaps = 23/731 (3%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLA 107
             +++P + + FL+ +A    + +       +K T  T  +L   I      N I  DL 
Sbjct: 49  LRRSLPFVIVAFLIVLAVIRFVSIYDWRNTVDKSTRSTLTLLASHI-----TNTIDRDLL 103

Query: 108 --SQKK-----AESMLGQLLAKTR----FLSESFILLAQPNELVFASSTKNSHYIGKKIG 156
             SQK      + S L  +LA  R        + I +      V ASS+ +   +GK + 
Sbjct: 104 ALSQKGKVSALSHSHLQDILATFRNQDLINPSALIAIVDQKGHVLASSS-SEIVLGKPLQ 162

Query: 157 EIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL-WREEV 215
           + I +    +S  +   + + ++ +    + S +   N    + I+ ++    + WR+  
Sbjct: 163 DFISDSIALQSLGQRAGIMKITIGKDTPALASFHQTENGQYGVFISEKMQDSAMEWRKFF 222

Query: 216 TLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDN 275
           +L +  F   S ++L +L++YY Q  + ++ D +  +    ++ A+ RGRCGLW++N  +
Sbjct: 223 SLNITLFIGTSGIILVLLYAYYNQLLRARKTDLVSEKFQNRIDMAMMRGRCGLWDWNMAS 282

Query: 276 KKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR 335
            + + SR+MYE++G   ++  LS   I+ +I+ ++    ++A+ + G   K +D    MR
Sbjct: 283 GRVYWSRAMYEMLGYVPQDALLSISQISAIINPNDANFFDLAQELMGGKKKHIDINVPMR 342

Query: 336 HASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           HA G  +W+++RA++  T     +++GI+ D++E+  L ++ A+AD R+  AIE  SE+ 
Sbjct: 343 HADGHYVWMRLRAEV--TEEEEPHLVGISFDISEQQQLAEQTAQADLRIRDAIENISESF 400

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII-EYRTSDPERSQDMS 454
           VLWD   RLVM N+ + +   +P  +L  G  R+ ++ A  RP + EY   D + + +++
Sbjct: 401 VLWDAEGRLVMSNSKFCEYAAIPKQILQSGIQRATVE-AMARPALSEYPLKD-DGTGNLT 458

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
              + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +R  
Sbjct: 459 SIRQTADGYWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRTRGS 518

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
            +++ TE+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++ +  FG
Sbjct: 519 AQQRATEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIMLQSTFG 578

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E +R + 
Sbjct: 579 PLGSQRYKEYMHDIYNSGTHLLTLINDILDMSKIEAGRFTLDCKNTDLEPIISEAVRTLT 638

Query: 635 SSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
             AQ KNI +   I  +L    D R +K+I   ++SN++KFT + G + +   K    +I
Sbjct: 639 PQAQEKNIAVTTNITPKLHAEVDGRAMKQIFLNLISNAVKFTPSGGNIDVCAFKKKNNLI 698

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
             I DTG+GIP+SA++K+GQPFE + NQ  +S  G GLGLAIS +L  LH G+L+I S+E
Sbjct: 699 FKITDTGVGIPQSAIKKLGQPFEQVENQLTKSHTGSGLGLAISRSLLELHKGKLEITSKE 758

Query: 755 GKGTIVTICMP 765
            KGT VTI MP
Sbjct: 759 MKGTTVTIIMP 769


>gi|240850171|ref|YP_002971564.1| two-component sensor histidine kinase [Bartonella grahamii as4aup]
 gi|240267294|gb|ACS50882.1| two-component sensor histidine kinase [Bartonella grahamii as4aup]
          Length = 773

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 263/732 (35%), Positives = 425/732 (58%), Gaps = 25/732 (3%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDL- 106
             +++P + + FL+ +A+   I +       +K T  T  +L   I      N I  +L 
Sbjct: 49  LRRSLPFVILAFLIVLASIRFISLYDWRNTIDKNTRSTITLLASHI-----TNTINHNLL 103

Query: 107 -ASQKKAESMLGQLLAK---TRFLSESFI-------LLAQPNELVFASSTKNSHYIGKKI 155
             SQK   S L     +   T F ++  I       ++ Q   ++ +SS++ S  +GK +
Sbjct: 104 AVSQKGKVSALSHSHLQNILTTFRNQDLINPSTLIAIIDQKGNVLASSSSEIS--LGKPL 161

Query: 156 GEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL-WREE 214
            + I +    +S  + V + + ++ +    + S     N    + I+ ++    + WR+ 
Sbjct: 162 QDFISDSIALQSLGQHVGIMKITIGKDAPALASFQQTENGQYGVFISEKMQDSAMEWRKI 221

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
           ++L +  F   S ++L +L++YY Q  + ++ D +  +    ++ A+ RGRCGLW++N  
Sbjct: 222 LSLNITLFIGTSGVILALLYAYYNQIVRARKTDLVSEKIQNRIDMAMMRGRCGLWDWNMA 281

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
           + + + SR+MYE++G   ++  LS   I+ +I+ ++    ++A+ +     K +D    M
Sbjct: 282 SGRVYWSRAMYEMLGYVPQDALLSISQISAIINPNDANFFDLAQELMSGKKKHIDINVPM 341

Query: 335 RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
           RHA G  +W+++RA++  T     +++GI+ D++E+  L ++ A+AD R+  AIE  SE+
Sbjct: 342 RHADGHYVWMRIRAEV--TEEEEPHLVGISFDISEQQQLAEQTAQADLRIRDAIENISES 399

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII-EYRTSDPERSQDM 453
            VLWD   RLVM N+ + +   +P  +L  G  R+ ++ A  RP I EY   D + + ++
Sbjct: 400 FVLWDSEGRLVMSNSKFCEYAAIPKQILQSGIQRATVE-AMARPAISEYPLKD-DGTGNL 457

Query: 454 SKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ 513
           +   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +R 
Sbjct: 458 TSIRQTADGCWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARG 517

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
             +++ +E+   N   + EKERAE+ANK KSEFLA MSHELRTPLNAILGFS+++ +  F
Sbjct: 518 SAQQRASEVEKLNKSLKAEKERAESANKAKSEFLANMSHELRTPLNAILGFSDIMLQSTF 577

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G LGS +Y EY  DI+ SG HLL +IN+IL+MSKIE  + S+D +N DL PII+E +R +
Sbjct: 578 GPLGSQRYKEYMHDIYNSGTHLLTLINDILDMSKIEAGRFSLDCKNTDLEPIISEAVRTL 637

Query: 634 GSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCV 693
              AQ KNI +   I  EL    D R +K+I   ++SN++KFT + G + +   K    +
Sbjct: 638 TPQAQEKNIVVTTNITPELHAEVDGRAMKQIFLNLISNAVKFTPSGGNIDVCAFKKKNNL 697

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
           I  I DTG+GIP+SA++K+GQPFE + NQ  +S  G GLGLAIS +L  LH G+L+I S+
Sbjct: 698 IFKITDTGVGIPQSAIKKLGQPFEQVENQLTKSHTGSGLGLAISRSLLELHKGKLEITSK 757

Query: 754 EGKGTIVTICMP 765
           E KGT VTI MP
Sbjct: 758 EMKGTTVTIIMP 769


>gi|91976495|ref|YP_569154.1| ATP-binding region, ATPase-like [Rhodopseudomonas palustris BisB5]
 gi|91682951|gb|ABE39253.1| ATP-binding region, ATPase-like [Rhodopseudomonas palustris BisB5]
          Length = 771

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 250/738 (33%), Positives = 427/738 (57%), Gaps = 32/738 (4%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQT----SLMLTEAIEIIFQNNNIK 103
             + +P++ + FLV I   + ++V  +  Q+    N+     + +L E +E I     ++
Sbjct: 38  LRRAVPILIIAFLVTICFGAAVQVIDQSRQKRAALNRDLSALADLLAERLEHI---GVVR 94

Query: 104 FD-LASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKN-SHYIGKKIGEII-- 159
            D  AS ++ +S+L  L+      +   +++   ++ V A    +       +  +II  
Sbjct: 95  LDRAASIERLQSLLPGLVPSWGIAAGRHVIVTGADQRVLARVPGDEGASAANRFLDIISA 154

Query: 160 -PELSRSRSRSKTVQMSEASLDQQPYHVLSVN----LPHNSGSILIINSRVPLLRLWREE 214
            P L++S   S+   +SE +L      + +++    LP   G ++II        + R +
Sbjct: 155 TPTLTKS---SQQGVLSEITLPSGASALATLHTIKSLP---GQVIIIQEDTG--SILRSD 206

Query: 215 VTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFD 274
             L++   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++  
Sbjct: 207 AALQITLSATTGFVVLILGFAFHWQSTRAREGDLINDAVRSRIDTALNRGRCGLWDWDLS 266

Query: 275 NKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM 334
             +   S+SM+ ++G+   N  L+F  +  L++ D+  +  I   +       +D  F M
Sbjct: 267 RGRIFWSQSMFTLLGLESRNDLLTFGEVNALVNSDDIDLFTIGDELIAGAADHIDHSFRM 326

Query: 335 RHASGADIWIQVRAQMMR-TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSE 393
           RHA+G  IW+++R ++ + + +   ++IGIA+D+TE+  L +R  EAD RL  AIE   E
Sbjct: 327 RHANGHWIWLRMRCELSQESPTENKHLIGIAVDVTEQKSLAERTVEADLRLRDAIETLPE 386

Query: 394 ALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD-----PE 448
           A VLWD ++RLV+CN+++Q+ + LPD  + PG +   + +    P I  R  D     P 
Sbjct: 387 AFVLWDSDNRLVLCNSHFQRLHKLPDSAIAPGTSYETVIEVGQMPEIRTRQCDVGAGSPP 446

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
            ++    E +L D  WL I+E  T DGG ++VGT+IT +K ++ +L ++  RL+AT+ DL
Sbjct: 447 GARTF--EAQLDDGSWLHISERRTKDGGYVAVGTNITRIKAHEQKLVDNDLRLRATVADL 504

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
             S+  LERQ  EL+    KY  EK RAE AN+ KS+FLA MSHELRTPLNAI+GFSE++
Sbjct: 505 KISQVKLERQAIELADLARKYSEEKNRAEEANQAKSKFLANMSHELRTPLNAIIGFSEIM 564

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
              +FG LGS KY EY  DI  SG +LL +IN+IL+MSKIE  ++ ++ +  DL   + E
Sbjct: 565 GSGMFGTLGSEKYQEYCHDIMTSGHYLLEVINDILDMSKIEAGRMRLEMEELDLARTLGE 624

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            ++++   A +K++++  +I   +   AD+R IK+IL  +LSN++KFT + G++ +R+  
Sbjct: 625 SLKVVAGRADNKHLELRAEIEDGIPIVADRRAIKQILINLLSNAVKFTPDGGRVTVRSRT 684

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
           +   +++ IAD+GIGI   +L ++GQPFE + +Q  ++  G GLGLAI+ +LT LHGG +
Sbjct: 685 LEDSIVMMIADSGIGIAPQSLRRLGQPFEQVESQLTKTYHGSGLGLAIAKSLTRLHGGSM 744

Query: 749 KIISQEGKGTIVTICMPQ 766
           ++ S  G GT+V + +P+
Sbjct: 745 RLRSTLGAGTVVMVTLPR 762


>gi|254502393|ref|ZP_05114544.1| hypothetical protein SADFL11_2432 [Labrenzia alexandrii DFL-11]
 gi|222438464|gb|EEE45143.1| hypothetical protein SADFL11_2432 [Labrenzia alexandrii DFL-11]
          Length = 756

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 258/758 (34%), Positives = 424/758 (55%), Gaps = 43/758 (5%)

Query: 35  TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIE 94
           +S  +HL    S   + IP ++++FLVF+A     ++  ++ +  +   +T+L L  ++ 
Sbjct: 2   SSAHNHLERSDSLMRRLIPALAILFLVFLAMYRTGELVGQH-ESARSDAETTLSLMASV- 59

Query: 95  IIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESF----------ILLAQPNELVFASS 144
                  +   L +  K     G      R L++S            L++  N  + AS+
Sbjct: 60  -------VAAPLNASGKDLPAAGYRTTLKRILADSLPTGATSKGRIFLISDTNGKIAASA 112

Query: 145 TKNSHYIGKKIGEIIPELSR-----SRSRSKTVQMSEASLDQQPYHVLSV--NLPHNSGS 197
                  G+ + +++           R+   ++ ++    D  P  VL+   +L    G 
Sbjct: 113 PLQPSLEGRPLTDLLGPAQPLTVFGERAGVLSIPVNLTGRDG-PEPVLATVRHLDGQLGM 171

Query: 198 ILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICV 257
           I ++     +   WR  ++  V  +  +S +LL I++ ++ QA + ++ D         +
Sbjct: 172 IAVVQPESVVFADWRSALSANVTLYVGVSLVLLAIIYGFFSQASRAEQADENYAATRARI 231

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIA 317
           +TAL+ GRCGL++++    +   S S+YE++G   ++  LSF  ++ L H D+  +  +A
Sbjct: 232 DTALTHGRCGLFDWDLSRGRMFWSSSLYELLGREPKDDILSFSEVSDLTHPDDIDLLGLA 291

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM---NIIGIAMDLTEKYHLE 374
             +       +D+ F MRHA G+ IW++ R ++   +  G    ++IGI +D+TE++ L 
Sbjct: 292 EHLLESGETLVDETFRMRHADGSWIWLRARGEIQ--VDPGRAEPHLIGICLDITEQHLLA 349

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQD 433
           ++   AD RL  AIE  SEA VLW+  + LV+CN+NYQ  + LP   + PG   + ++  
Sbjct: 350 EQSQMADLRLRDAIETISEAFVLWNTRNELVICNSNYQSLHNLPPSAVKPGTPYKDVLAA 409

Query: 434 AQTRPI------IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
           A+  P       +  R   PE S     E +L D RWLQI+E  T DGG +SVGTDIT L
Sbjct: 410 AENGPASPQPVQLSKRQGGPEGSY----EAQLEDGRWLQISERRTKDGGFVSVGTDITAL 465

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           K ++ +L ES++RLKAT+ DL  SR+ILE Q  +LS    KYQ EK RAE AN+ KSEFL
Sbjct: 466 KKHEERLTESEKRLKATVTDLQRSRKILEVQTRQLSEMAEKYQEEKTRAEAANQAKSEFL 525

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A +SHELRTPLNAI+GFS+++ +E+FG LG+ +Y +Y +DI+ SG +LLN+IN+IL+MSK
Sbjct: 526 ANISHELRTPLNAIIGFSDIMTQEMFGPLGTDRYADYCKDIYSSGTYLLNVINDILDMSK 585

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFP 667
           IE  ++SI+ +  +      +  R+I  +A  KNI I   +   L  + DKR +K++L  
Sbjct: 586 IEAGRMSIETEVVNASEAAEDAARIITGAASEKNIVISADVADNLHVDVDKRALKQVLLN 645

Query: 668 ILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI 727
           +L+N++KFT ++G + ++    G  V   + DTGIGI +  +E++ +PF  + NQ+ ++ 
Sbjct: 646 LLANAVKFTPDHGTVTLKARPRGDKVRFEVTDTGIGISERDIERLAKPFVQVENQFTKTH 705

Query: 728 GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            G GLGLAI+ +L  LHGG+L I S+  KGT+V+  +P
Sbjct: 706 QGSGLGLAIARSLVELHGGKLAIESEVKKGTVVSFSLP 743


>gi|319898572|ref|YP_004158665.1| two-component sensor histidine kinase [Bartonella clarridgeiae 73]
 gi|319402536|emb|CBI76079.1| two-component sensor histidine kinase [Bartonella clarridgeiae 73]
          Length = 769

 Score =  439 bits (1129), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 227/555 (40%), Positives = 348/555 (62%), Gaps = 3/555 (0%)

Query: 211 WREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWN 270
           W+++ +L +      ++++L +L++YY Q  + +  D    +     + A+ RGRCGLW+
Sbjct: 214 WQKKFSLNITLLIGTASIILVLLYAYYNQIIRARNTDLTSEKIQNRTDMAMMRGRCGLWD 273

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           +N  N + + SR+MYE++G   +N  LS   I  +I   +    EIA+ +     K +D 
Sbjct: 274 WNMANGRVYWSRAMYEMLGYAPQNALLSISQITAIIDPKDANFFEIAQELMSGAKKHIDI 333

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
              MRHA G  +W+++RA++  T     +++GI+ D++E+    ++ A+AD R+  AIE 
Sbjct: 334 NVPMRHAEGYYVWMRIRAEV--TDEEEPHLVGISFDISEQRQFAEQTAQADLRIRDAIEN 391

Query: 391 TSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERS 450
            SE+ VLWD   RLVM N+ + +   +P  +L  G  R+ ++ A +RP I       + +
Sbjct: 392 ISESFVLWDSAGRLVMSNSKFCEYAAIPKQMLQSGIERATVE-AMSRPAISEYPLKVDEA 450

Query: 451 QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLST 510
            +++   + AD  WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  
Sbjct: 451 GNLTSIRQTADGYWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKR 510

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R   +++ TE+   N   Q EKE+AE+ANK KSEFLA MSHELRTPLNAILGFSE++ +
Sbjct: 511 ARGNAQQRATEVEKLNKSLQEEKEKAESANKAKSEFLANMSHELRTPLNAILGFSEIMLQ 570

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
             FG LGS +Y EY  DIH SG HLL +IN+IL+MSKIE  + ++D +N +L PII+E I
Sbjct: 571 STFGPLGSQRYKEYMHDIHNSGTHLLTLINDILDMSKIEAGRFTLDCKNINLEPIISETI 630

Query: 631 RLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           R +   AQ+K I +   I  +L  + D R +K+I   ++SN++KFT + G + IR  +  
Sbjct: 631 RTLTPQAQAKKISLTTNIEPKLHADVDCRAMKQIFLNLISNAVKFTPSGGSIDIRAFQKN 690

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             +I +I DTG+GIPK A++K+G+PFE + NQ+ ++  G GLGLAIS +L  LH G+L+I
Sbjct: 691 NNLIFSIKDTGVGIPKEAIKKLGKPFEQVENQFTKTHPGSGLGLAISRSLLELHKGKLEI 750

Query: 751 ISQEGKGTIVTICMP 765
            S+E KGTIVTI MP
Sbjct: 751 TSKEAKGTIVTITMP 765


>gi|92117002|ref|YP_576731.1| periplasmic sensor signal transduction histidine kinase
           [Nitrobacter hamburgensis X14]
 gi|91799896|gb|ABE62271.1| periplasmic sensor signal transduction histidine kinase
           [Nitrobacter hamburgensis X14]
          Length = 775

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 251/740 (33%), Positives = 422/740 (57%), Gaps = 36/740 (4%)

Query: 48  FNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLT-------EAIEIIFQNN 100
             + +P + + FL+ I   ++++V  +  Q++ MT    L L        E + +I Q+ 
Sbjct: 38  LRRAVPALIIAFLLTICVGALVQVIDQTRQKQAMTKHDLLALADLLAERLEHVGVIHQDR 97

Query: 101 NIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFAS-STKNSHYIGKKIGEII 159
                 AS ++ +++L  L+      +   +++   ++ V A    + +     +I E+I
Sbjct: 98  P-----ASIERLQNLLPSLIPSWGIAAGRHVIVTGADQRVLARVPIEAAPGESSRILELI 152

Query: 160 PELSRSRSRSKTVQ-MSEAS------LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWR 212
                S ++S  ++ MS AS      LD          +    G + +I  +     +WR
Sbjct: 153 -----STAQSPALRGMSSASVADIILLDGSGALATQRVVRSLLGHVTVIQEKTD--SVWR 205

Query: 213 EEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFN 272
            +  L +   +    ++L + F+++ Q+ + +E D I       ++TAL+RGRCGLW+++
Sbjct: 206 PDTALSITLSATTGFVVLILGFAFHWQSTRAREGDVINDAVRGRIDTALNRGRCGLWDWD 265

Query: 273 FDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIF 332
               +   S+SM+ ++G+   +  L+F  I+ L + D+  +  I   +    +  +DQ F
Sbjct: 266 LSRGRIFWSQSMFTMLGLESRSDLLTFGEISALANPDDIDLFAIGDQLISGKIHHIDQSF 325

Query: 333 HMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
            MRH+ G  IW++VR ++ +    G  ++IGIA+D+TE+  L ++  EAD RL  AIE  
Sbjct: 326 RMRHSGGHWIWLRVRCELSQGAGDGAAHLIGIAVDITEQKSLAEKTVEADLRLRDAIETI 385

Query: 392 SEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQDAQTRPII----EYRTSD 446
            EA VLWD +DRLV+CN+++Q+ + LP+  +  G +  ++I+  +   I     E  T+ 
Sbjct: 386 PEAFVLWDADDRLVLCNSHFQRLHKLPESAVAAGTSYETVIEVGRMHEICARPPETGTTA 445

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
           P      + E +L +  WL I+E  T DGG +SVGTDIT +K ++ +L ++  RL+AT+ 
Sbjct: 446 PGAR---TFEAQLDNGCWLNISERRTKDGGYVSVGTDITRIKEHEQKLVDNDLRLRATVI 502

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DL  ++  LE+Q  EL+    KY  EK+RAE AN+ KS+FLA MSHELRTPLNAI+GFSE
Sbjct: 503 DLKRTQATLEQQAIELADLAQKYAKEKDRAEDANRAKSKFLANMSHELRTPLNAIIGFSE 562

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           ++   +FG LGS KY EY  DI  SGQ+LL +IN++L+MSKIE  ++ +D +  DL   +
Sbjct: 563 IMSNGMFGTLGSEKYSEYCHDILTSGQYLLEVINDVLDMSKIEAGRMKLDMEPLDLSRTL 622

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            E +R++      K +  + +I  ++   AD R +K+I+  +LSN++KFT + G++M R+
Sbjct: 623 AESLRVVTGRTSDKKLTFDVRIDDDIAITADHRAVKQIIVNLLSNAVKFTPDGGRVMARS 682

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V +TIADTGIGI   +L K+G+PFE + +Q  ++  G GLGLAI+ +L NLHGG
Sbjct: 683 QVFANSVALTIADTGIGIAPHSLRKLGKPFEQVESQLTKTYAGSGLGLAIAKSLVNLHGG 742

Query: 747 RLKIISQEGKGTIVTICMPQ 766
            +++ S+ G GT+V + +P+
Sbjct: 743 SMRLRSKPGTGTVVRVTLPR 762


>gi|118587761|ref|ZP_01545171.1| PAS domain protein [Stappia aggregata IAM 12614]
 gi|118439383|gb|EAV46014.1| PAS domain protein [Stappia aggregata IAM 12614]
          Length = 784

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 221/574 (38%), Positives = 354/574 (61%), Gaps = 4/574 (0%)

Query: 196 GSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           G + ++     +   WR++++  V  F   S +LL +++ ++ QA + +  D +      
Sbjct: 204 GMVAVLQPENAIFSQWRDDLSANVTLFVGTSLVLLAVIYGFFSQATRAEAADDMYAATRA 263

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
            ++TAL+ GRCGL++++    +   S S+YE++G   ++  LSF  +A + H D+  +  
Sbjct: 264 RIDTALTHGRCGLFDWDLSRGRMFWSSSLYELLGREPKDDILSFADVADITHPDDIDLLG 323

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLTEKYHLE 374
           +A  +       +D+ F MRHA G+ IW++ R ++         ++IGI +D+TE++ L 
Sbjct: 324 LAEHLLESGETLVDETFRMRHADGSWIWLRARGEIQSEPGRAEPHLIGICIDITEQHELA 383

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQD 433
           ++   AD RL  AIE  SEA VLW+  + LV+CN+NYQ  + LP+ V+ PG   + ++  
Sbjct: 384 EQSRMADLRLRDAIETISEAFVLWNARNELVICNSNYQSLHSLPNSVIKPGTPYKDVMAA 443

Query: 434 AQTRPIIEYRTSDPER--SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
           A    +  +  +  +R  + D S E +L D RWLQI+E  T DGG +SVGTDIT LK ++
Sbjct: 444 ASNAEVAPHPVTLRQRGGAPDGSYEAQLEDGRWLQISERRTKDGGFVSVGTDITALKKHE 503

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
            +L +S++RLKAT+ DL  SRQ LE Q  +L     KYQ EK RAE ANK KSEFLA +S
Sbjct: 504 EKLVDSEKRLKATVTDLQKSRQTLEVQARQLVEMADKYQEEKTRAEAANKAKSEFLANIS 563

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAI+GFS+++ +E+FG +G+ +Y +Y +DI+ SG +LLN+IN+IL+MSKIE  
Sbjct: 564 HELRTPLNAIIGFSDIMTQEMFGPVGTDRYSDYCKDIYSSGTYLLNVINDILDMSKIEAG 623

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           +++I+ +  +      +  R++  +A  KNI +   +   +  +ADKR +K+IL  +L+N
Sbjct: 624 RMTIETETVNASESAEDASRIVTGAATEKNITVTTDVVENVSVHADKRALKQILLNLLAN 683

Query: 672 SIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
           ++KFT +NG + ++    G  +   + DTGIGI +  +E++ QPF  + NQ+ ++  G G
Sbjct: 684 AVKFTPDNGTVTLKARPRGDKLHFEVIDTGIGISERDIERLAQPFVQVENQFTKTHQGSG 743

Query: 732 LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LGLAI+ +L  LHGG L I S+  KGT V+  +P
Sbjct: 744 LGLAIARSLVELHGGALVIKSEVKKGTTVSFTLP 777


>gi|121602141|ref|YP_988756.1| putative non-motile and phage-resistance protein [Bartonella
           bacilliformis KC583]
 gi|120614318|gb|ABM44919.1| putative non-motile and phage-resistance protein [Bartonella
           bacilliformis KC583]
          Length = 773

 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 255/724 (35%), Positives = 421/724 (58%), Gaps = 17/724 (2%)

Query: 52  IPMISMVFLVFIATSSIIKVTTRYAQQEKMT-NQTSLMLTEAIEIIFQNNNIKFDLASQK 110
           IP I + FL+ +A    + +   +   +K T ++ +L+ T  I II  N ++      ++
Sbjct: 53  IPFIIITFLIVLAAIRFVLIYDWHNAIDKDTRSKITLLTTHIINII--NRDLLSATKKER 110

Query: 111 KA-------ESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELS 163
           KA       +++L     +    + + I +   N  V ASS  +   +GK + + IP+ +
Sbjct: 111 KAILSHNHLQNILINFQNEGLTNTNTMITIIDQNRNVLASSNPDI-TLGKPLQDFIPQST 169

Query: 164 RSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRL-WREEVTLEVVFF 222
              +  K     +  + ++P  + S +   N    + I+ +   + + W +  +L ++ F
Sbjct: 170 ALWTLGKYTGAMQIMIGEEPA-LASFHETENGQYGVFISEKTHHIYMEWHKVFSLNLILF 228

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
              ++++L +L++YY Q  + +  D I  +    ++ A+ RGRCGLW++N  + + + SR
Sbjct: 229 IGTASIILALLYAYYTQVTRARNTDLISEKIQNRIDMAMMRGRCGLWDWNMASGRIYWSR 288

Query: 283 SMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADI 342
           +MYE++G   ++  LS   I  +I+  +    ++A+ +     K +D    MRHA G  +
Sbjct: 289 AMYEMLGYVPQDALLSISQITAIINSTDINFFDLAQELMSGEKKHIDINVPMRHADGHHV 348

Query: 343 WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           W+++RA++  T     +++GI+ D++E++   ++ A+AD R+  AIE  SE+ VLWD   
Sbjct: 349 WMRIRAEV--TEEEEPHLVGISFDISEQHQFVEQTAQADLRIRDAIENISESFVLWDSEG 406

Query: 403 RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPII-EYRTSDPERSQDMSKEIKLAD 461
           RLVM N+ + +   +P  +L  G  R+ +  A  RP I EY   + + + +++   + AD
Sbjct: 407 RLVMSNSKFCEYAAIPKQMLQSGIQRATVT-AMARPAISEYFLKEDDGTGNLTSIRQTAD 465

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
             WL+INE  T DGG + +GTDI+ LK  Q +  +S+RRL + I +L  +R   +++ TE
Sbjct: 466 GFWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARGNAQQRATE 525

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
           +   N   Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFS+++ +  FG LGS +Y
Sbjct: 526 VEKLNKSLQAEKERAESANKAKSEFLANISHELRTPLNAILGFSDIMLQSTFGPLGSQRY 585

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
            EY +DIH SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E IR +   AQ K 
Sbjct: 586 EEYMRDIHNSGTHLLTLINDILDMSKIEAGRFTLDCKNVDLEPIISEAIRTLTPQAQEKK 645

Query: 642 IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           I I   I  +L    D R +++I   ++SN++KFT + G + I   +    +I  I DTG
Sbjct: 646 ISITANIAPKLHAELDCRAMRQIFLNLISNAVKFTPSGGSIDICAFQKKNNLIFKIKDTG 705

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           +GIP+SA++K+G+PFE + NQ+ ++  G GLGLAIS +L  LH G+L+I S+E  GT VT
Sbjct: 706 VGIPQSAIKKLGKPFEQVENQFTKTHTGSGLGLAISRSLLELHKGKLEIASEEENGTTVT 765

Query: 762 ICMP 765
           I +P
Sbjct: 766 ITIP 769


>gi|163849986|ref|YP_001638029.1| PAS sensor protein [Methylobacterium extorquens PA1]
 gi|163661591|gb|ABY28958.1| PAS sensor protein [Methylobacterium extorquens PA1]
          Length = 786

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/581 (38%), Positives = 344/581 (59%), Gaps = 2/581 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V +  L H  G + ++    PL   W        V  S I+ +L  +  +Y  Q ++ + 
Sbjct: 168 VAARRLSHGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQA 227

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TAL RGRCGLW+++        S SMY ++G   E   LSF  +  L
Sbjct: 228 ADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNAL 287

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIA 364
           +H ++  +  +AR +   H   +D  F +R ASG  IW++ RA+++   + G  +++GIA
Sbjct: 288 LHAEDGDLYSLARHLAASHAT-VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIA 346

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           MD+TE+  L +  A AD RL  A+E  SEA VLWD ++RLV+CN+ ++  + L     VP
Sbjct: 347 MDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVP 406

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
           G     I      P +       ER    + E++L D RWLQ++E  T DGG +SVGTDI
Sbjct: 407 GRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDI 466

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK +Q QL  S+R L  T+ DL  SR+ LE Q  +L+    ++  +K RAE AN+ KS
Sbjct: 467 TSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKS 526

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPLNAI+GF+E+++ E++G LGS +Y +Y +DI  SG +LL++I++IL 
Sbjct: 527 EFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILH 586

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MS+IE +++ + +++ DL   +   + L+   A SK++ I+ ++   L   AD+R +++I
Sbjct: 587 MSRIEAKRVKLVRRDIDLGTALTSALTLVAKEAASKSVSIDLELAGTLHVLADERALQQI 646

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  I+ N++KFT   G++ +R       V + I DTGIGIPK+A+ K+G+PFE +     
Sbjct: 647 LLNIIQNAVKFTPERGRIALRGRSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLT 706

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +S  G GLGLAI+ +   LHGG L+I S+EG GT+V + +P
Sbjct: 707 RSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLP 747


>gi|254559131|ref|YP_003066226.1| PAS sensor signal transduction histidine kinase [Methylobacterium
           extorquens DM4]
 gi|254266409|emb|CAX22173.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens DM4]
          Length = 786

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 224/581 (38%), Positives = 344/581 (59%), Gaps = 2/581 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V +  L    G + ++    PL   W        V  S I+ +L  +  +Y  Q ++ + 
Sbjct: 168 VAARRLSDGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQA 227

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TAL RGRCGLW+++        S SMY ++G   E   LSF  +  L
Sbjct: 228 ADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNAL 287

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIA 364
           +H ++  +  +AR +   H   +D  F +R ASG  IW++ RA+++   + G  +++GIA
Sbjct: 288 LHAEDGDLYSLARHLAASHAT-VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIA 346

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           MD+TE+  L +  A AD RL  A+E  SEA VLWD ++RLV+CN+ ++  + L     VP
Sbjct: 347 MDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVP 406

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
           G     I      P +       ER    + E++L D RWLQ++E  T DGG +SVGTDI
Sbjct: 407 GRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDI 466

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK +Q QL  S+R L  T+ DL  SR+ LE Q  +L+    ++  +K RAE AN+ KS
Sbjct: 467 TSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKS 526

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPLNAI+GF+E+++ E++G LGS +Y +Y +DI  SG +LL++I++IL 
Sbjct: 527 EFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILH 586

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MS+IE +++ + +++ DL   +N  + L+   A SK++ I+ ++   L   AD+R +++I
Sbjct: 587 MSRIEAKRVKLVRRDIDLGTALNSALTLVSKEAASKSVSIDLELAGTLHVLADERALQQI 646

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  I+ N++KFT   G++ +R       V + I DTGIGIPK+A+ K+G+PFE +     
Sbjct: 647 LLNIIQNAVKFTPEQGRVALRGRSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLT 706

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +S  G GLGLAI+ +   LHGG L+I S+EG GT+V + +P
Sbjct: 707 RSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLP 747


>gi|319408254|emb|CBI81907.1| two-component sensor histidine kinase [Bartonella schoenbuchensis
           R1]
          Length = 772

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 239/658 (36%), Positives = 382/658 (58%), Gaps = 4/658 (0%)

Query: 108 SQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS 167
           S    E +L  L  +    + + I +   NE V ASS+     +GK +   I E +   S
Sbjct: 115 SHSHLEDILVDLRNQNLVNTNTIIAIVDQNENVLASSSSEV-ILGKPLKNFISENAALES 173

Query: 168 RSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISA 227
             +    ++  +  +P   L     ++  S+ +      +   WR+  +L +  F   + 
Sbjct: 174 LKQHTGATQIKIGTEPALALLSQTKNSQYSVFMSEKTHDIYMEWRKIFSLNMTLFIGTTG 233

Query: 228 LLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEI 287
           ++L +L++YY Q  +    D +  +    ++ A+ RGRCGLW++N  + + + SR+MYE+
Sbjct: 234 IILALLYAYYNQVSRAHNMDLVSEKNQNRIDMAMMRGRCGLWDWNMASGRVYWSRAMYEM 293

Query: 288 MGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVR 347
           +G   ++  LS   I  +I+  +    ++A+ +     K +D    MRHA G  IW++ R
Sbjct: 294 LGYVPQDALLSISQITAIINPTDTNFFDLAQELMSGEKKHIDINIPMRHADGHYIWMRFR 353

Query: 348 AQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMC 407
           A++  T     +++GI+ D++E+  L ++ A+AD R+  AIE  SE+ VLWD   RLVM 
Sbjct: 354 AEV--TEGEEPHLVGISFDISEQRQLAEQTAQADLRIRDAIENISESFVLWDSEGRLVMS 411

Query: 408 NANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQI 467
           N+ + +   +P  +L  G  R+ ++ A  RP I       + + +++   + AD  WL+I
Sbjct: 412 NSKFCEYAAIPKQMLQSGIQRATVE-AMARPAISEYLLKEDGTGNLTSIRQTADGCWLKI 470

Query: 468 NEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANA 527
           NE  T DGG +  GTDI+ LK  Q + + S++ L + I +L  +R   +++ TE+   N 
Sbjct: 471 NERRTQDGGLVCTGTDISELKQQQEKFKNSEKSLFSFIQELKRARGNAQQRATEVEKLNK 530

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
             Q EKERAE+ANK KSEFLA +SHELRTPLNAILGFS+++ +  FG LGS +Y EY +D
Sbjct: 531 SLQAEKERAESANKAKSEFLANISHELRTPLNAILGFSDIMLQSTFGPLGSQRYKEYMRD 590

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           IH SG HLL +IN+IL+MSKIE  + ++D +N DL PII+E +R +   AQ K + + + 
Sbjct: 591 IHNSGTHLLTLINDILDMSKIEAGRFTLDCKNIDLGPIISEAVRTLTPQAQEKKVSVTEN 650

Query: 648 IPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
           I  +L    D R I++I   ++SN++KFT + G + +   +    +I  I DTG+GIP++
Sbjct: 651 IAPKLHAEVDCRAIRQIFLNLISNAVKFTPSGGNIDVCAFQKENNLIFKIKDTGVGIPQA 710

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           A++K+GQPFE + NQ+ ++  G GLGLAIS +L  LH G+L+I S+E KGT VTI MP
Sbjct: 711 AIKKLGQPFEQVENQFTKTHTGSGLGLAISRSLVKLHKGKLEITSKEEKGTTVTITMP 768


>gi|240137118|ref|YP_002961587.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens AM1]
 gi|240007084|gb|ACS38310.1| putative PAS sensor signal transduction histidine kinase
           [Methylobacterium extorquens AM1]
          Length = 786

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/581 (38%), Positives = 343/581 (59%), Gaps = 2/581 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V +  L    G + ++    PL   W        V  S I+ +L  +  +Y  Q ++ + 
Sbjct: 168 VAARRLADGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQA 227

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TAL RGRCGLW+++        S SMY ++G   E   LSF  +  L
Sbjct: 228 ADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNAL 287

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIA 364
           +H ++  +  +AR +   H   +D  F +R ASG  IW++ RA+++   + G  +++GIA
Sbjct: 288 LHAEDGDLYSLARHLAASHAT-VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIA 346

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           MD+TE+  L +  A AD RL  A+E  SEA VLWD ++RLV+CN+ ++  + L     VP
Sbjct: 347 MDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVP 406

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
           G     I      P +       ER    + E++L D RWLQ++E  T DGG +SVGTDI
Sbjct: 407 GRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDI 466

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK +Q QL  S+R L  T+ DL  SR+ LE Q  +L+    ++  +K RAE AN+ KS
Sbjct: 467 TSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKS 526

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPLNAI+GF+E+++ E++G LGS +Y +Y +DI  SG +LL++I++IL 
Sbjct: 527 EFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILH 586

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MS+IE +++ + +++ DL   +   + L+   A SK++ I+ ++   L   AD+R +++I
Sbjct: 587 MSRIEAKRVKLVRRDIDLGTALTSALTLVAKEAASKSVSIDLELAGTLHVLADERALQQI 646

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  I+ N++KFT   G++ +R       V + I DTGIGIPK+A+ K+G+PFE +     
Sbjct: 647 LLNIIQNAVKFTPERGRVALRGRSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLT 706

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +S  G GLGLAI+ +   LHGG L+I S+EG GT+V + +P
Sbjct: 707 RSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLP 747


>gi|218528525|ref|YP_002419341.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
 gi|218520828|gb|ACK81413.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
          Length = 786

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/581 (38%), Positives = 343/581 (59%), Gaps = 2/581 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V +  L    G + ++    PL   W        V  S I+ +L  +  +Y  Q ++ + 
Sbjct: 168 VAARRLADGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQTQRAQA 227

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TAL RGRCGLW+++        S SMY ++G   E   LSF  +  L
Sbjct: 228 ADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNAL 287

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIA 364
           +H ++  +  +AR +   H   +D  F +R ASG  IW++ RA+++   + G  +++GIA
Sbjct: 288 LHAEDGDLYSLARHLAASHAT-VDHEFRIRDASGEWIWLRTRAEIVEDAVDGSRHLVGIA 346

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           MD+TE+  L +  A AD RL  A+E  SEA VLWD ++RLV+CN+ ++  + L     VP
Sbjct: 347 MDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHALASEDAVP 406

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
           G     I      P +       ER    + E++L D RWLQ++E  T DGG +SVGTDI
Sbjct: 407 GRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDI 466

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK +Q QL  S+R L  T+ DL  SR+ LE Q  +L+    ++  +K RAE AN+ KS
Sbjct: 467 TSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKS 526

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPLNAI+GF+E+++ E++G LGS +Y +Y +DI  SG +LL++I++IL 
Sbjct: 527 EFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILH 586

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MS+IE +++ + +++ DL   +   + L+   A SK++ I+ ++   L   AD+R +++I
Sbjct: 587 MSRIEAKRVKLVRRDIDLGTALTAALTLVAKEAASKSVSIDLELAGTLHVLADERALQQI 646

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  I+ N++KFT   G++ +R       V + I DTGIGIPK+A+ K+G+PFE +     
Sbjct: 647 LLNIIQNAVKFTPERGRVALRGRSCNGFVHLFIGDTGIGIPKTAISKLGRPFEQVETNLT 706

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +S  G GLGLAI+ +   LHGG L+I S+EG GT+V + +P
Sbjct: 707 RSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLP 747


>gi|323137189|ref|ZP_08072268.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
 gi|322397547|gb|EFY00070.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
          Length = 814

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 232/589 (39%), Positives = 344/589 (58%), Gaps = 3/589 (0%)

Query: 180 DQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQ 239
           D  P       LP   G + +I     +L  WR       + F+  + +LL I++ Y+RQ
Sbjct: 164 DGTPALATVHKLPTPFGQVAMIYPLDNVLGEWRAIAARYALLFAFTTLMLLVIVYGYFRQ 223

Query: 240 AKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSF 299
            ++ +  + +       +ETALSRGRCGLW+++    + + S SMYE++G+P E + LSF
Sbjct: 224 TRRRQAVEHVNALIRKRLETALSRGRCGLWDWDIARGRIYWSDSMYEMLGLPAERRCLSF 283

Query: 300 RAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GM 358
             +  LIH ++  +  IA  V+    K +D  F  +HA G  IW++ RAQ++   +  G 
Sbjct: 284 GELNALIHPEDGDLTVIAEMVSASRTKSVDHEFRAKHADGRWIWVRARAQLVDEANDPGK 343

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
           +++GIA+D++E+  L +  A A+ RL  AI+  SEA VLWD  +RLV CN+ +   +GL 
Sbjct: 344 HLVGIAVDVSEQRALAEHTATANMRLRDAIDAISEAFVLWDAQNRLVTCNSKFLDLHGLS 403

Query: 419 DHVLVPGNARSIIQDAQTRPIIEYRTSDPE-RSQDM-SKEIKLADSRWLQINEWCTHDGG 476
               + G   + I    T P+I+   S  E R+ D  + E +LAD RWLQINE  T DGG
Sbjct: 404 ADAAIAGATYAQIMMRATAPLIQTEISSAEQRAADARTYEARLADGRWLQINERRTKDGG 463

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
            +SVG DIT LK N+ +L ES+RRL A++ DL+ SRQ LE Q  +L+    +Y  +K  A
Sbjct: 464 YVSVGADITALKRNEEKLLESERRLTASVTDLTRSRQTLEMQAQQLATLAEQYHHQKAEA 523

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E A   KSEFLA MSHELRTPLNAI+GFSE+++ E FG LGS KY EY  +I   G +L 
Sbjct: 524 EAAYLAKSEFLANMSHELRTPLNAIIGFSEMMQAEPFGSLGSPKYVEYCNNIRQGGAYLN 583

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA 656
            ++++IL+MS++E   + + ++  ++       I    S A +KNI+I  +    L    
Sbjct: 584 EVLSDILDMSRLEAGLVRLAEREVNVADATRRAIASWRSRADAKNIQIVAEADDRLRCIG 643

Query: 657 DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPF 716
           D+  I K L  +LSNSIKFT+  G + +R  + G  + I + DTG GI   A+ ++G+PF
Sbjct: 644 DESAIVKALGVLLSNSIKFTDAGGFIRLRARRHGAAIAIFVEDTGRGIDPRAISRLGRPF 703

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           E   +  +  + G GLGLAI+ AL +LHGG L+I S+ G GTI  + +P
Sbjct: 704 EQSADLMENGMKGSGLGLAIARALVDLHGGALRIRSRLGLGTIAMMRLP 752


>gi|188579782|ref|YP_001923227.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
 gi|179343280|gb|ACB78692.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
          Length = 786

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 221/581 (38%), Positives = 336/581 (57%), Gaps = 2/581 (0%)

Query: 186 VLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKE 245
           V +  L    G + ++    PL   W        +  S I  +L  +  +Y  Q ++ + 
Sbjct: 168 VATRRLADGLGEVAVLQRFEPLTANWWRMFGHHAISLSAIGLVLAGMATAYILQTQRAQA 227

Query: 246 NDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL 305
            D +       ++TAL RGRCGLW+++        S SMY ++G   E   LSF  +  L
Sbjct: 228 ADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSFGDVNAL 287

Query: 306 IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR-TISGGMNIIGIA 364
           +H ++  +  +AR +   H   +D  F +R ASG  IW++ RA+++   + G  +++GIA
Sbjct: 288 LHSEDGDLYSLARHLAASHAT-VDHEFRIRDASGDWIWLRTRAEIVEDALDGSRHLVGIA 346

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           MD+TE+  L +  A AD RL  A+E  SEA VLWD  +RLV+CN+ ++  + L     VP
Sbjct: 347 MDVTEQRRLAEFTATADMRLRDAVEAISEAFVLWDAGNRLVLCNSKFRDLHALDSEDAVP 406

Query: 425 GNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
           G     I      P +       ER    + E++L D RWLQ++E  T DGG +SVGTDI
Sbjct: 407 GRRYDEIMGRGALPPVRRGIPGAERGTSRTFEVELTDGRWLQVSERRTKDGGYVSVGTDI 466

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
           T LK +Q QL  S+R L  T+ DL  SR+ LE Q  +L+    ++  +K RAE AN+ KS
Sbjct: 467 TSLKRHQEQLVASERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKARAEIANQAKS 526

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPLNAI+GF+E+++ E++G LGS +Y +Y +DI  SG +LL++I++IL 
Sbjct: 527 EFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTYLLSVIDDILH 586

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKI 664
           MS+IE  ++ + ++   L   I   + L+   A SK++ I+ ++   L   AD+R + +I
Sbjct: 587 MSRIEANRVKLVRREIGLDAAIAAAVTLVSKEAASKSVAIDIELAGTLNVLADERALHQI 646

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  I+ N++KFT   G++ +R         + I DTGIGIPK+A+ K+G+PFE +     
Sbjct: 647 LLNIIQNAVKFTPEGGRVALRGRSCNGFAHLFIGDTGIGIPKAAISKLGRPFEQVETNLT 706

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +S  G GLGLAI+ +   LHGG L+I S+EG GT+V + +P
Sbjct: 707 RSYKGSGLGLAIARSTAELHGGSLRIRSEEGVGTLVLVRLP 747


>gi|114705118|ref|ZP_01438026.1| putative sensor histidine kinase transmembrane protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539903|gb|EAU43023.1| putative sensor histidine kinase transmembrane protein [Fulvimarina
           pelagi HTCC2506]
          Length = 774

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 235/646 (36%), Positives = 381/646 (58%), Gaps = 20/646 (3%)

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS-----RSKTVQMSEASLDQQPY 184
           FIL++  + ++ A+S  + + IG    +++ EL+ S +     R +T      +L+++  
Sbjct: 129 FILVSGTDGIITAASPGSEYLIGT---DLVTELALSPTAIQLGRGETT--VPGTLNEEAI 183

Query: 185 HVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNK 244
              S+ L    G   I+    P L  WRE + + V  FS+ S ++L I+ +Y+RQA +  
Sbjct: 184 ETSSMMLADGLGLGTIVQIERPALSAWREALAVNVTLFSLTSFVVLAIVLAYFRQASRAN 243

Query: 245 ENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR 304
           E  T  LE +  V+TALS GR GLW++N    +  LSRS+YE++G   +  ++ F  +  
Sbjct: 244 EAQTAYLETHELVDTALSLGRSGLWDWNVTRGEVQLSRSLYELLGFSPKTASIGFAELEH 303

Query: 305 LIHYDN----KKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
            +H  +     ++C   R V G +V + D+ F +RH  G  +W++  A+  RT SG  ++
Sbjct: 304 RLHPADIGVKHRLC---RVVVG-NVDRFDKTFRLRHRDGHFVWLRAHAEATRTSSGERHL 359

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           +GIAMD++E+    +R  EA  +L  AIE   E  VL D  D +++ N+ Y+  +GL + 
Sbjct: 360 VGIAMDVSEQQAFAERTKEAHHQLHSAIENIPETFVLCDNEDDIILANSRYRTVFGLSEE 419

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK-EIKLADSRWLQINEWCTHDGGTIS 479
              PG   + +     +PI   + S     +D S  EIK+ D RWL ++E  T +G  I+
Sbjct: 420 DTKPGTNLAQVMRKSRKPIESAQVSGSSSKRDDSSSEIKMPDGRWLLLSERRTAEG-FIA 478

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           +G DIT LK +Q +L ES+RRL   I+ LS +R   ER+  +L   N  +++EK +AE A
Sbjct: 479 IGADITQLKMHQTRLHESERRLTDIIHALSETRSDAERKAAQLEELNHSFRIEKNKAEAA 538

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           ++ K+ FLA MSHELRTPLNAILGFS+++++++ G +GS KY  YA DIH SG+ LL +I
Sbjct: 539 SRAKTTFLANMSHELRTPLNAILGFSDIMRQQMLGPIGSEKYTGYAHDIHESGEFLLQLI 598

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR 659
           ++IL+M KIET + ++ ++  DL   + E  R+I +S   + I +  + P +L   AD+R
Sbjct: 599 DDILDMQKIETGRTTMLRRIFDLTEAVAESARMIEASVARRQIDLVVEQPEKLNIYADRR 658

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            + +IL  ++SN++KF++  G++ +   +    V+++I D G GI +  L KIG+PFE  
Sbjct: 659 AVTQILMNLMSNAVKFSDAGGEVRVSVKERSGAVLLSITDRGEGISQCNLAKIGRPFEQT 718

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            +++ ++  G GLGLAI+ +LT LHGGR +I S  G+GTIV I +P
Sbjct: 719 ESEWTRTKKGTGLGLAIARSLTELHGGRFRIASTLGEGTIVAIRLP 764


>gi|304393603|ref|ZP_07375531.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
           R2A130]
 gi|303294610|gb|EFL88982.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
           R2A130]
          Length = 814

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/573 (36%), Positives = 349/573 (60%), Gaps = 2/573 (0%)

Query: 195 SGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEAN 254
           +G + +++    L   WR  V + V  F  I ++LL I+++Y+ Q  + +E +++  E N
Sbjct: 213 AGYVALVHPSASLFESWRTAVKVNVTLFLAIGSVLLIIVYAYFVQGARTRETESLYFETN 272

Query: 255 ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKIC 314
              +TAL+RGRCGLW+++        S SM++++G    ++ + +  +A L+H D++ + 
Sbjct: 273 ARFDTALARGRCGLWDWDLSRGSIVWSPSMHQMLGRAGRSRAMGYGELAELLHPDDRNLL 332

Query: 315 EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLE 374
           +IA     +  +Q+D  F + HASG  + +++RA+++       ++IGIA+D++E+  L+
Sbjct: 333 QIANETFQESSRQIDHRFRILHASGGWVSMRLRAELVHYRGAVPHLIGIAVDVSEQEALK 392

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           ++  +AD RL +AI+  SEA VLWD  +R+V+CN  YQ+ + LP   +  G  +  +   
Sbjct: 393 RQSRDADIRLREAIDNISEAFVLWDAKERMVLCNGKYQQLFNLPSSAIRHGVTKQDVAAI 452

Query: 435 QTRPII--EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
           +  P++  +  T   ++    + E +L D RW QI+E  T DGG +SVGTDIT +K NQ+
Sbjct: 453 RKAPVMRSQVNTDRNQKHHSNTFEAQLDDGRWFQISERPTLDGGAVSVGTDITQIKRNQS 512

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +L +S+R   ATI +L   +Q L     E          ++++A+ ANK+KS+FLA MSH
Sbjct: 513 KLEDSEREHLATIVELRKMQQNLVAFANEADDQRLLADEQRKQADEANKSKSQFLANMSH 572

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI+GFS+++++ +FG LG+ KY EYA DI  SG  LL +IN++L+MSKIE  +
Sbjct: 573 ELRTPLNAIIGFSDIMREGMFGPLGNEKYTEYANDIRSSGGFLLGVINDVLDMSKIEAGR 632

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNS 672
           + I  +   +  ++ E +R+I + A    +++  +I + L   AD+R +K++L  +LSN+
Sbjct: 633 MQIYPEELAVSDLLQETLRIIAAQADDGELQVTTEIETGLDIIADRRAVKQVLINLLSNA 692

Query: 673 IKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           +KFT   G + +   ++   V + I D+GIGI + ALE+IG PFE   ++  +   G GL
Sbjct: 693 VKFTPKGGSIQVSARRLDDNVEMEILDSGIGISQDALERIGLPFEQAASELTRDHVGSGL 752

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLAI+ +L  LHGG + I S EG GT V + +P
Sbjct: 753 GLAIAKSLAELHGGSVDISSIEGIGTTVLVRLP 785


>gi|154251412|ref|YP_001412236.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155362|gb|ABS62579.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 600

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 218/553 (39%), Positives = 333/553 (60%), Gaps = 11/553 (1%)

Query: 219 VVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKF 278
           ++F S++S   L + +   R  +   E +  L+E     + A +  RCG+W+++    + 
Sbjct: 48  LLFSSLLSGGYLALAYMLVRLRESKLEAEAALVENQHRFDMAFAGARCGIWDWDLGENRI 107

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIHYDNK-KICEIARSVTGKHVKQLDQIFHMRHA 337
           + S +M++++G+   +K LS   I  + H D+   I EIA + + +  +  D  F +RHA
Sbjct: 108 YWSSAMFDMVGLKQPSKRLSPNEIKAMAHPDDAGAIDEIANAAS-RPSRSYDTAFRLRHA 166

Query: 338 SGADIWIQVRAQMMRTI-SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
            G+ +W+  + Q+     + G  ++GI +D+T++   E+R  EA++RL  AIE   EA V
Sbjct: 167 DGSWVWMHAKGQVWGGGRAAGERLVGITIDITDQKIAEERVHEANERLRDAIESVGEAFV 226

Query: 397 LWDKNDRLVMCNANYQKAYGLPDHVLVPGNARS-IIQDA---QTRPIIEYRTSDPERSQD 452
           LWD   RL   N+ + +   L +  + PG  R  ++Q A      P+    + D   +  
Sbjct: 227 LWDAEGRLATANSKFGEFLNLGEDYMHPGAPRGEMMQRAGVGDAWPV----SQDGGEAGA 282

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
              EI+L   RWLQI+E  T  GG ++VGTDIT +K  +A L ++K  L+ T+ DL TSR
Sbjct: 283 GVHEIRLPTGRWLQISERRTKSGGHVNVGTDITAIKEQEAALTDNKVALEKTVRDLETSR 342

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
           + L+ Q  +L     KY  EK RAE AN++KSEFLA MSHELRTPLNAI+GFSE+++  +
Sbjct: 343 RKLQEQARQLVDLAEKYASEKTRAEAANRSKSEFLANMSHELRTPLNAIIGFSEIMESGL 402

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
           FGELGS KY EYA DIH SG HLL +IN+IL+MSKIE  +++++ Q  +L  ++ E +RL
Sbjct: 403 FGELGSPKYKEYAGDIHASGTHLLELINDILDMSKIEAGRMTLETQPLELSEVVEESLRL 462

Query: 633 IGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
           +   A+   + I  ++      +ADKR +K++L  +LSN++KFT   G + +R    G+ 
Sbjct: 463 VSGRAEVAKVHIANEMGPLPTVDADKRAVKQVLLNLLSNAVKFTPAGGSIHLRGETSGRF 522

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           V I++ DTGIGIP SAL KIG+PFE + +Q+ +S  G GLGLA+S +L  LHGG L + S
Sbjct: 523 VTISVEDTGIGIPASALPKIGRPFEQVESQHSKSHKGTGLGLALSRSLVELHGGALVLES 582

Query: 753 QEGKGTIVTICMP 765
            EG GT V+  +P
Sbjct: 583 TEGVGTKVSFTLP 595


>gi|170748787|ref|YP_001755047.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655309|gb|ACB24364.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 793

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 214/586 (36%), Positives = 344/586 (58%), Gaps = 16/586 (2%)

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
           +LP  +G + ++    PLLR W      ++V  +  + +++ +  +Y  Q ++    D  
Sbjct: 170 SLPGGAGQVAVLQPVEPLLRGWSARTRDQIVLIAAAAIVIVGVGLAYGLQTRQAARADRA 229

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
             +    +ETAL RG CGLW+++    + + S SMY ++G   +++ LSF  +  L+H D
Sbjct: 230 REQIRGRLETALRRGACGLWDWDIARGRIYWSDSMYTLLGYRRQHEYLSFGDVNGLVHPD 289

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS-GGMNIIGIAMDLT 368
           +  +  +AR +       +D  F MR A GA +W++ RA+++   + GG +++GIA D++
Sbjct: 290 DGDLYSLARGLAANQT-HVDHAFRMRGADGAYVWLRARAEVVADAADGGRHLVGIANDIS 348

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           E+  LE+  A AD RL  A+E  SEA VLWD  +RLV+CN+ ++       H L P +A+
Sbjct: 349 EQRALEETNAAADMRLRDAVEAISEAFVLWDTGNRLVLCNSKFRHL-----HALSPEDAQ 403

Query: 429 S--IIQDAQTRPII-EYRTSDPERSQDMSK------EIKLADSRWLQINEWCTHDGGTIS 479
           +     D   R ++ + R   PE    ++       E +L+D RWLQI+E  T DGG +S
Sbjct: 404 AGRSYTDVMGRGVLPQVRRESPEAGMALTGMAARTFEAELSDGRWLQISERRTKDGGYVS 463

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           VGTDIT LK NQ QL  S+R L  T+ DL  SR+ LE Q  +L+    +Y  +K  AE A
Sbjct: 464 VGTDITSLKRNQEQLLASERELIETVKDLKRSRRTLELQTQQLADLAERYLDQKAAAEAA 523

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N+ K+EFLA MSHELRTPLNAI+GF++V++  + G LG+ +Y EY +DI  SG HLL+MI
Sbjct: 524 NQAKAEFLANMSHELRTPLNAIIGFADVMENAVLGPLGTPRYTEYCRDIRESGSHLLSMI 583

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR 659
           ++IL+M+++E  ++ +  +       ++  +  + ++A+ K I +   +   L   AD +
Sbjct: 584 DDILDMARLEARRVRLSPRAISAETAVSAALAPVEAAAREKAITVSVDVVPGLELLADPQ 643

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            I +IL  ++ N++KFT   G++ +R  + G C  + I D GIGIP++ L ++G+PF  +
Sbjct: 644 AIGQILANLVQNAVKFTPAGGRVAVRGRRAGACTHLYIEDNGIGIPRTDLARLGRPFTQV 703

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             Q  +   G GLGLAI+ ++  LHGG L+I S+E  GTIV + +P
Sbjct: 704 ERQMTRCHKGSGLGLAITRSMVELHGGSLRIRSEETVGTIVLVRLP 749


>gi|296446361|ref|ZP_06888306.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
 gi|296256134|gb|EFH03216.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
          Length = 750

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 217/578 (37%), Positives = 325/578 (56%), Gaps = 3/578 (0%)

Query: 190 NLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTI 249
           NL   SG I +I+    +L  WR       +  +  +A+      +  RQ ++    +  
Sbjct: 163 NLSDGSGQIALIHPHEAVLADWRAATIRCAMVAAGSAAVTAAAGLALRRQTRRAALAERA 222

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
                  V+ AL  GRCGLW+++    + H S SM+E++G+  E + +SF  IA  +H  
Sbjct: 223 HAAMRRRVDAALGSGRCGLWDWDLARGRIHWSDSMFEMLGLDIERRPISFGEIALRLHPQ 282

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLT 368
           +  + E   +V   H    D  F +  A GA +W+++RA+++    G G  ++GIA+D+T
Sbjct: 283 DLDLAEKVEAVAATH-GAFDHQFRIADAVGAWVWLRMRAELIEEEGGAGPRLVGIAVDVT 341

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           E   L +  A AD RL  AIE  SEA VLWD  +RLV+CN+ +   +GL   V  PG + 
Sbjct: 342 EHRALAEGAATADMRLRDAIETISEAFVLWDAQNRLVVCNSKFLGLHGLSADVATPGASY 401

Query: 429 S-IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
           + I+  A      E        + +   E +LAD RWLQI+E  T DGG +SVG DIT L
Sbjct: 402 ARIMASAVALEESEIIGDAAPTANERIYEARLADGRWLQISERRTKDGGYVSVGADITAL 461

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           K NQ +L +S+RRL A++ DL  SRQ LERQ  EL+    +Y ++K  AE AN  KS+FL
Sbjct: 462 KRNQEKLIDSERRLTASVADLIGSRQALERQAQELATLAEQYHLQKGEAEAANLAKSQFL 521

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A MSHELRTPLNAI+GFSE+++ ++FG LGS KY EY   IH  G++LL+++ +IL+MS+
Sbjct: 522 ANMSHELRTPLNAIIGFSEMMQAQVFGALGSPKYVEYCSHIHQGGRYLLDVLTDILDMSR 581

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFP 667
           +E  ++ +++   DL             +A++K I++       L    D   I K +  
Sbjct: 582 LEAGRVRLEESEIDLSGAARATAERSRRAAEAKGIELIVDAREGLRCCGDHDAIVKAIAV 641

Query: 668 ILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI 727
           ++SNS+KFT   G + +R  +  + V+I + DTG GI   A+  +G+PFE      +  +
Sbjct: 642 LVSNSLKFTAAGGCVRLRARRSYRAVLIFVEDTGCGIDARAVAALGRPFEQPATVMENGM 701

Query: 728 GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            G GLGLAI+ +L  LHGG L+I S+ G GTI  + +P
Sbjct: 702 KGSGLGLAIARSLMALHGGSLRIRSRVGVGTIAMLRIP 739


>gi|256159347|ref|ZP_05457133.1| PAS domain-containing protein [Brucella ceti M490/95/1]
          Length = 376

 Score =  360 bits (925), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 249/360 (69%), Gaps = 3/360 (0%)

Query: 408 NANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYR--TSDPERSQDMSKEIKLADSRWL 465
           N+ + +  GLP   L PG  R+ + DA TRP    R   ++  R+   + E +L+D RWL
Sbjct: 1   NSKFSEYAGLPVWTLKPGVPRNEV-DAHTRPFTFERRMANEHNRAGGQTFERQLSDGRWL 59

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           Q+NE  T DGG +S+GTDIT LK +Q +L +S+RRL AT++DLS +R+    +  ELS  
Sbjct: 60  QVNERRTQDGGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIARKGERDRVRELSEL 119

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
             KY +EKERAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+   FG LGS +Y EY 
Sbjct: 120 ARKYSLEKERAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGPLGSDRYEEYI 179

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
            DIH SG  LLN+IN+IL+MSKIE    S+D++  DL P+INE +R+I   A+ KNI +E
Sbjct: 180 NDIHTSGNFLLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVRIISLQAEEKNIAVE 239

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
            +I   +   AD+R IK++L  +LSN++KFT+  G++ +R  K G  + +TI DTG+GIP
Sbjct: 240 TRIEDAMELYADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGAALFMTIQDTGVGIP 299

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           KSAL KIGQPFE + NQ+ ++  G GLGLAIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 300 KSALRKIGQPFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIRSTERVGTVVSVCIP 359


>gi|265997787|ref|ZP_06110344.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M490/95/1]
 gi|262552255|gb|EEZ08245.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M490/95/1]
          Length = 367

 Score =  354 bits (909), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 181/351 (51%), Positives = 244/351 (69%), Gaps = 3/351 (0%)

Query: 417 LPDHVLVPGNARSIIQDAQTRPIIEYR--TSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
           +P   L PG  R+ + DA TRP    R   ++  R+   + E +L+D RWLQ+NE  T D
Sbjct: 1   MPVWTLKPGVPRNEV-DAHTRPFTFERRMANEHNRAGGQTFERQLSDGRWLQVNERRTQD 59

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GG +S+GTDIT LK +Q +L +S+RRL AT++DLS +R+    +  ELS    KY +EKE
Sbjct: 60  GGMVSIGTDITQLKLHQERLVDSERRLMATVHDLSIARKGERDRVRELSELARKYSLEKE 119

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
           RAE AN+ KSEFLA MSHELRTPLNAI+GFSE+I+   FG LGS +Y EY  DIH SG  
Sbjct: 120 RAEAANRAKSEFLANMSHELRTPLNAIIGFSEMIQAGTFGPLGSDRYEEYINDIHTSGNF 179

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
           LLN+IN+IL+MSKIE    S+D++  DL P+INE +R+I   A+ KNI +E +I   +  
Sbjct: 180 LLNVINDILDMSKIEAGHFSLDREEIDLCPLINETVRIISLQAEEKNIAVETRIEDAMEL 239

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R IK++L  +LSN++KFT+  G++ +R  K G  + +TI DTG+GIPKSAL KIGQ
Sbjct: 240 YADRRAIKQVLINLLSNAVKFTSYGGRITVRARKTGAALFMTIQDTGVGIPKSALRKIGQ 299

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           PFE + NQ+ ++  G GLGLAIS +L  LHGG L+I S E  GT+V++C+P
Sbjct: 300 PFEQVENQFTKTHTGSGLGLAISRSLAELHGGWLRIRSTERVGTVVSVCIP 350


>gi|114569501|ref|YP_756181.1| multi-sensor signal transduction histidine kinase [Maricaulis maris
           MCS10]
 gi|114339963|gb|ABI65243.1| multi-sensor signal transduction histidine kinase [Maricaulis maris
           MCS10]
          Length = 911

 Score =  343 bits (881), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 190/550 (34%), Positives = 311/550 (56%), Gaps = 28/550 (5%)

Query: 220 VFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFH 279
           +F ++    L+F+     R  ++  E++       + +E A    RCG+W++N +     
Sbjct: 317 IFVALGLCALVFMQMGRLRSTRQQLEDNEQRF--RVAIEGA----RCGVWDWNPEADTVF 370

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASG 339
           ++ S+  I+G+    +    + +      D +++    R           ++ H   A+ 
Sbjct: 371 VTDSLARILGLDAATECTGQQFLQLFSKPDRERLRAAMRGAPAGA-----EVDHEVLAAR 425

Query: 340 ADIWIQVRAQMMRTISGG----MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           + +W+Q+R    R + GG      IIG+A+D+TE+   + R A A+ RL  A+E  SE+ 
Sbjct: 426 SPVWLQMRG---RILPGGEANHTRIIGVAIDVTERKGAQARVAAAENRLRAALESMSESF 482

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           VLWD   RLV+ N  ++  +   D +L PG +   ++ A  R I   +T         + 
Sbjct: 483 VLWDSRQRLVLWNRKFRDLFDFTDGMLKPGMSYDAVEQAAARAI---KTVHGGSEGKAAY 539

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           EI+L++ RWL  ++  T DGG +SVG DIT LKH++A L E++ +L+ T++D+       
Sbjct: 540 EIELSNGRWLHYSDRPTADGGLVSVGADITDLKHHEAALTENESQLRKTVDDV------- 592

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           +R +  ++    KY+ EK RAE AN++KSEFLA MSHELRTPLNAI GFSE++ +E+FG 
Sbjct: 593 KRSQARIADLAKKYEEEKIRAEEANRSKSEFLANMSHELRTPLNAINGFSEIMMQEMFGP 652

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           LG  +Y  Y +DI  SG+HLL +IN+IL+MSKIE  K+ +  +  D   ++ + IR++  
Sbjct: 653 LGDDRYVGYMKDILSSGRHLLELINDILDMSKIEAGKMQLQPEPTDASELVEQSIRIVRG 712

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
            A+ K +K+   +        D R  K+++  ++SN++KFT   G++ +R    G  V  
Sbjct: 713 RAEEKQLKLRADVSDLPEIEVDPRAFKQVMINLVSNAVKFTPEGGRVTVRGFLSGLGVAF 772

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            ++DTGIGI K  L ++G+PFE + +Q+ +S  G GLGLA+S +L  LHGG L I S  G
Sbjct: 773 QVSDTGIGIAKDDLPRLGRPFEQIESQHSKSFQGSGLGLALSKSLIELHGGTLSIDSVLG 832

Query: 756 KGTIVTICMP 765
           +GT V++ +P
Sbjct: 833 EGTTVSVVLP 842


>gi|315498970|ref|YP_004087774.1| multi-sensor signal transduction histidine kinase [Asticcacaulis
           excentricus CB 48]
 gi|315416982|gb|ADU13623.1| multi-sensor signal transduction histidine kinase [Asticcacaulis
           excentricus CB 48]
          Length = 864

 Score =  330 bits (846), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 205/647 (31%), Positives = 348/647 (53%), Gaps = 35/647 (5%)

Query: 130 FILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPY-HVLS 188
            +L+    +++ AS  + +    +K   + PE  + R  + + ++S+ +L+++ +  + +
Sbjct: 216 IVLINAAGDILSASDERLTGLNIRKALTVTPE--QIRDNANSARISQGTLEEKGFVRIAA 273

Query: 189 VNLPHNSGSILIIN-SRVPLLRLWREEVTLEVVFFSIISALL-LFILFSYYRQAKKNKEN 246
           V    N  + L +  S     R W    TL +    II AL  + ++    R ++  ++ 
Sbjct: 274 VREGENGLTTLYVEPSNAAAARNWLTTATLFIGPL-IIGALFGMLLIVQSRRNSEAARQY 332

Query: 247 DTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLI 306
           +       + VE A    RCG+W ++ ++ +  +S     + G        +   + R+ 
Sbjct: 333 EAKETRYRLAVEAA----RCGIWEWDLESDQVFMSEVTGVMFGWGGSGVATTNEVLLRIA 388

Query: 307 HYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM--RTISGGMNIIGIA 364
               + + +   +  G     LD  F +   +G  IWI  R Q    R  +G   + G+A
Sbjct: 389 PEHRETVRKALLNARGHGA--LDVSFRVPGDNGRAIWIDARGQATGPRGPAGFTRLSGVA 446

Query: 365 MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVP 424
           +D++E+   + R   A+ RL+ AI   S+A VLWD+  RLVM NA + + + +    L  
Sbjct: 447 LDVSEERAAQSRAQRAEARLTGAINSVSDAFVLWDRRGRLVMWNAVFGRTFSIDPRFLKA 506

Query: 425 GNARSIIQDA------QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTI 478
           G +R +I+        +  P+I+ R        +   E +L D RW+QI+E  T +GGT+
Sbjct: 507 GTSRELIEKVMAIAIRRQEPVIDGR--------EGVVEAELNDGRWIQISESRTLEGGTV 558

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
             G DIT +K  +   R ++ +L+A ++ L  SR+I    +T+L+    KY++ K RAE 
Sbjct: 559 VTGADITAIKVQEEMSRRNEEQLQAMVDKLEQSRRI----QTDLA---KKYEMAKIRAEQ 611

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           AN  KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  +Y EYA DI  SGQHLL +
Sbjct: 612 ANHAKSEFLANMSHELRTPLNAINGFSEIMAGEMFGPLGHARYKEYAGDILSSGQHLLAL 671

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADK 658
           IN+IL+MSKIE  K+++  +   +  ++++ +RL+   A+   +K+   +P      AD 
Sbjct: 672 INDILDMSKIEAGKMTLRFEPVSVEEVVDDTLRLVRQRAEKAGLKMRVHLPQLPDIQADY 731

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R +K+IL  IL+N+IKFT + G + +        + + +ADTGIGI    +E++ +PFE 
Sbjct: 732 RALKQILLNILTNAIKFTPSGGTITVSAVPTDSFMHLYVADTGIGIAPKDMERLARPFEQ 791

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + NQ+ ++  G GLGLA++ +L  +H GRL++ S  G+GT V++ +P
Sbjct: 792 IENQFSRTKEGTGLGLALTKSLIEMHSGRLEVDSTVGQGTTVSVILP 838


>gi|329849802|ref|ZP_08264648.1| non-motile and phage-resistance protein [Asticcacaulis biprosthecum
           C19]
 gi|328841713|gb|EGF91283.1| non-motile and phage-resistance protein [Asticcacaulis biprosthecum
           C19]
          Length = 836

 Score =  326 bits (835), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 206/614 (33%), Positives = 326/614 (53%), Gaps = 38/614 (6%)

Query: 166 RSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSII 225
           R+R+ +  + + + D   +  L+ + P   G I +    VP  + +            + 
Sbjct: 230 RARADSRDLIQGARDGDGFVKLA-SAPQGDGRIAVAG--VPTQQFYSSSAAWIKGLIFVG 286

Query: 226 SALLLFILFSYYR--QAKKNKENDTILLEAN-----ICVETALSRGRCGLWNFNFDNKKF 278
             LL+  LF      QA+K    D +  +AN     + VE A    RCG+W+++ +    
Sbjct: 287 GPLLIGALFGVLLVFQARKT-HTDNLQFQANEQRYRLAVEAA----RCGIWDWDLEQDLI 341

Query: 279 HLSRSMYEIMGIPYENKTLSFRAIARLIH-YDNKKICEIARSVTGKHVK-QLDQIFHMRH 336
           ++S    ++ G+               ++    +   ++ +++    +K   D  F + +
Sbjct: 342 YMS----DVTGVMLGWGGGGVATTGEFVNRVAPEHRADVMKALDSARLKGAFDVSFRVPN 397

Query: 337 ASGADIWIQVRAQMM--RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEA 394
           A G  IW+ VR Q +  R   G + + G+A+D++++   + R   A+ RL  AI   S+A
Sbjct: 398 AEGKSIWVDVRGQSVGARNQLGFLRLNGVALDVSDERMAQSRAQRAEARLLDAINSVSDA 457

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
            VLWD+  RL+M N  + + +G+ +  L  G  R +I   Q   I   R      ++D  
Sbjct: 458 FVLWDRRHRLLMWNKTFGETFGIDERFLRVGTPRELID--QVMQIAIRRHQPAPDARDGV 515

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQ- 513
            E +L + RW+QI E  T +GG +  GTDIT +K  +   R ++  L+A +  L  +RQ 
Sbjct: 516 YEAELNNGRWIQIAESRTLEGGRVLTGTDITAVKIQEEFRRRNEEELQALVQKLEQARQQ 575

Query: 514 --ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
             IL R          KY++ K RAE AN  KSEFLA MSHELRTPLNAI GFSE++  E
Sbjct: 576 QMILAR----------KYEMAKIRAEAANHAKSEFLANMSHELRTPLNAINGFSEIMATE 625

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
           +FG LG  +Y EYA DI  SGQHLL++IN+IL+MSKIE  K+++  +   L  +I + +R
Sbjct: 626 MFGPLGHARYKEYAGDILGSGQHLLSLINDILDMSKIEAGKMTLRIEPVSLDEVIEDTLR 685

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           L+   A+   +KI   +P      AD R +K+IL  +L+N+IKFT  +G + I  +    
Sbjct: 686 LVRQRAEKAGLKIRVHMPQLPEIEADFRALKQILLNLLTNAIKFTPQHGTVTISAAMTDN 745

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            V I +ADTGIGI    +E++ +PFE + NQ+ ++  G GLGLA++ +L  +H GRL+I 
Sbjct: 746 NVHIAVADTGIGIAAKDMERLARPFEQIENQFSKTKEGTGLGLALTKSLIEMHSGRLEID 805

Query: 752 SQEGKGTIVTICMP 765
           S EG+GT V + +P
Sbjct: 806 STEGQGTTVNVILP 819


>gi|83945614|ref|ZP_00957960.1| non-motile and phage-resistance protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83850980|gb|EAP88839.1| non-motile and phage-resistance protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 849

 Score =  323 bits (827), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 187/508 (36%), Positives = 300/508 (59%), Gaps = 22/508 (4%)

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
           A+   RCG+W+++ D  +  L+ S  +++G            +  L   D  K+    R 
Sbjct: 333 AIEGARCGVWDWDLDTDEVVLTDSFAQLIGRARGESLSGPELLLLLGKEDRPKVRAALRG 392

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAE 379
                    D    +R A+G  +W+Q+R +++        IIG+A+D+TE+   + R A 
Sbjct: 393 AANAQ----DVDLEVR-AAGLPVWLQLRGRLLPHTR---RIIGVAIDITERKGAQARVAA 444

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           A+ RL  A+E  SE+ VLWD   RLV+ N  ++  +G  +  L  G++   ++ A  R I
Sbjct: 445 AESRLRAALESMSESFVLWDARGRLVLWNRKFRDFFGFNEPDLRIGSSYEQVEAAAARAI 504

Query: 440 IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKR 499
                S  E  QD   +++L D RW+   E  T DGG +SVG DIT LK  Q  L+++ R
Sbjct: 505 KAAHAS--EDGQD-DYDLELNDGRWIHYAERRTADGGLVSVGADITALKDQQRALKDNDR 561

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
            ++ T+ +L  S++ ++    EL+   A Y+ EK RAE AN++KSEFLA MSHELRTPLN
Sbjct: 562 EMRRTVENLRRSQERVQ----ELA---ANYEQEKIRAEEANRSKSEFLANMSHELRTPLN 614

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AI GFSE++  E+FG LG  +Y +Y +DI  SGQHLL++IN+IL+MSKIE  K+ +  Q 
Sbjct: 615 AINGFSEIMAGEMFGPLGHERYQDYVRDILSSGQHLLSLINDILDMSKIEAGKMQL--QP 672

Query: 620 ADLIP--IINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTN 677
             L+P  +I + +R++ + A+ K+I++  +        AD R +K+++  ++SN++KFT 
Sbjct: 673 EPLMPAEVIEQCVRIMRARAEEKSIELTVEGSELPEITADPRALKQVILNLMSNAVKFTP 732

Query: 678 NNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
             GK+ +R  +    V++ ++DTGIGI +  L+++G+PFE + +Q+ +   G GLGLA+S
Sbjct: 733 EGGKVKLRGFQAADGVVLQVSDTGIGISEDDLQRVGRPFEQIESQHSKKHQGSGLGLALS 792

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMP 765
            +L  +HGG L+I S+ G+GT V+  +P
Sbjct: 793 KSLIEMHGGALRIDSRLGEGTTVSFTLP 820



 Score = 37.7 bits (86), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 3/159 (1%)

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
           + R  +++ RL  AIE     +  WD +   V+   ++ +  G      + G    ++  
Sbjct: 320 QARLHDSEGRLHLAIEGARCGVWDWDLDTDEVVLTDSFAQLIGRARGESLSGPELLLLLG 379

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLAD-SRWLQI-NEWCTHDGGTISVGTDITLLKHNQ 491
            + RP +         +QD+  E++ A    WLQ+      H    I V  DIT  K  Q
Sbjct: 380 KEDRPKVRAALRGAANAQDVDLEVRAAGLPVWLQLRGRLLPHTRRIIGVAIDITERKGAQ 439

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
           A++  ++ RL+A +  +S S  +L   +  L + N K++
Sbjct: 440 ARVAAAESRLRAALESMSESF-VLWDARGRLVLWNRKFR 477


>gi|197106142|ref|YP_002131519.1| sensor histidine kinase (non-motile and phage-resistance protein )
           [Phenylobacterium zucineum HLK1]
 gi|196479562|gb|ACG79090.1| sensor histidine kinase (non-motile and phage-resistance protein )
           [Phenylobacterium zucineum HLK1]
          Length = 621

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 193/517 (37%), Positives = 286/517 (55%), Gaps = 27/517 (5%)

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLI---HYDNKKICEI 316
           A+   RCG+W ++    K  +S     + G  +    +  + +   +   H D  +    
Sbjct: 102 AVEAARCGIWEWDLAADKIFMSEVTAALFG--WRGGVVDGQQVLDRVSPGHRDGLREALA 159

Query: 317 ARSVTGKHVKQLDQIFHMRH-ASGADIWIQVRAQ-MMRTISGG-MNIIGIAMDLTEKYHL 373
             ++ G      D  F +   A G  IWI  R +       GG   IIG+A+D+TE+   
Sbjct: 160 NAAIYG----DFDVSFRVPSLAGGRPIWIDARGRGFGEAPEGGYARIIGVALDVTEERLA 215

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
           + R  +A+ RL  AIE  SEA VLWD++ RL+MCN NY+  + L   +L+ G  R  ++ 
Sbjct: 216 QARAQQAESRLRDAIESVSEAFVLWDRHGRLLMCNRNYRDYFKLESGLLLAGVGREQVER 275

Query: 434 AQTRPII-EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
           A    +  EY      R     +E +LAD RW+QI+E  T +GG +    DIT+LK    
Sbjct: 276 AARMAVRQEYPAPGDRRG---VREAELADGRWVQISERPTAEGGLVVTAADITVLKAQ-- 330

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
              E  RRLK    +L  +   LER + +LS    KY+ EK RAE A++ KSEFLA MSH
Sbjct: 331 ---EEARRLKE--EELRRAVFNLERSQEQLSELARKYEAEKIRAEGASQAKSEFLANMSH 385

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI GFSE++  E++G LG  +Y +YA+DI  SGQHLL +IN+IL+MSKIE  K
Sbjct: 386 ELRTPLNAINGFSEIMVAEMYGPLGDARYRDYARDILNSGQHLLALINDILDMSKIEAGK 445

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNS 672
           +S+      L  I  + +RL+ + A+S  + +           AD R +K++L  +LSN+
Sbjct: 446 MSLRFDPCSLEEIAEDALRLVRNRAESAGLTLVLDFVELPEVEADYRAVKQVLLNLLSNA 505

Query: 673 IKFTNNNGKMMIRTSK----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           IKFT   G++ +R  +    +GQ V +++ DTGIGI    LE++ +PFE + +Q+ ++  
Sbjct: 506 IKFTPRGGRITLRAERRDDPLGQRVRVSVQDTGIGIAPEDLERLARPFEQVESQHAKTQQ 565

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLA++ A   LHGG L + S  G+GT  +  +P
Sbjct: 566 GTGLGLALTKAFVELHGGLLDLKSAPGQGTTASFSLP 602


>gi|16126721|ref|NP_421285.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
 gi|221235503|ref|YP_002517940.1| sensory transduction histidine kinase pleC [Caulobacter crescentus
           NA1000]
 gi|13638405|sp|P37894|PLEC_CAUCR RecName: Full=Non-motile and phage-resistance protein
 gi|13424035|gb|AAK24453.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
 gi|220964676|gb|ACL96032.1| sensory transduction histidine kinase pleC [Caulobacter crescentus
           NA1000]
          Length = 842

 Score =  318 bits (816), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 192/554 (34%), Positives = 307/554 (55%), Gaps = 31/554 (5%)

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
            I  ALLL I      Q++K +      +++      A+   RCG+W ++ +  + +LS 
Sbjct: 294 GIALALLLMI------QSRKAEVAHREFIDSERRFRLAVEAARCGIWEWDLNGDQVYLS- 346

Query: 283 SMYEIMGIPYENKTLSFRAIARL---IHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS- 338
              ++ G  +        +   L   I  D+++    A +    +    D  F +  +  
Sbjct: 347 ---DVTGAMFGWGGGGVVSGQDLLERISIDHRERVRQALANAAMY-GAFDVSFRVPASEQ 402

Query: 339 GA-DIWIQVRAQMMRTIS--GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           GA  +WI  R Q        G   IIG+A+D+TE+   + R   A+ RL  AIE  SEA 
Sbjct: 403 GARSLWIDARGQGFGKPGSEGHARIIGVALDVTEERIAQARAQAAENRLRDAIESVSEAF 462

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           VLWD+  RL+MCN NY+  + L   +L PG AR+ +       I +   + P+ ++ + +
Sbjct: 463 VLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEVNRFAALAIKQDHPA-PDGAKGV-R 520

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           E ++ D RW+QI+E  T +GG +    DIT +K  +   R ++ +L+  +  L       
Sbjct: 521 EAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQEEARRRNEEQLQNAVAGL------- 573

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           ER + +L+    KY+ EK +AE+ANK KSEFLA MSHELRTPLNAI GFSE++  E+FG 
Sbjct: 574 ERSQEQLAELARKYETEKVKAESANKAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGP 633

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           LG  +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  K+++  ++  L  +  + +RL+ +
Sbjct: 634 LGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFESMHLEDVAEDAVRLVRN 693

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT----SKIGQ 691
            A++  +K++   P      AD R +K++L  +LSN+IKFT   G + +R        G 
Sbjct: 694 RAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSNAIKFTPRAGSVTVRAEVRRDPFGD 753

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +++ DTGIGI K  L ++ +PFE + +Q+ ++  G GLGLA++ +L  +H G L++ 
Sbjct: 754 LIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTTQGTGLGLALTKSLITMHDGVLEMH 813

Query: 752 SQEGKGTIVTICMP 765
           S  G+GT V+  +P
Sbjct: 814 STPGEGTTVSFTLP 827


>gi|144273|gb|AAA23052.1| non-motile and phage-resistance protein [Caulobacter crescentus
           CB15]
          Length = 842

 Score =  318 bits (815), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 192/554 (34%), Positives = 308/554 (55%), Gaps = 31/554 (5%)

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSR 282
            I  ALLL I      Q++K +      +++      A+   RCG+W ++ +  + +LS 
Sbjct: 294 GIALALLLMI------QSRKAEVAHREFIDSERRFRLAVEAARCGIWEWDLNGDQVYLS- 346

Query: 283 SMYEIMGIPYENKTLSFRAIARL---IHYDNKKICEIARSVTGKHVKQLDQIFHMRHAS- 338
              ++ G  +        +   L   I  D+++    A +    +    D  F +  +  
Sbjct: 347 ---DVTGAMFGWGGGGVVSGQDLLERISIDHRERVRQALANAAMY-GAFDVSFRVPASEQ 402

Query: 339 GA-DIWIQVRAQMMRTIS--GGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEAL 395
           GA  +WI  R Q        G   IIG+A+D+TE+   + R   A+ RL  AIE  SEA 
Sbjct: 403 GARSLWIDARGQGFGKPGSEGHARIIGVALDVTEERIAQARAQAAENRLRDAIESVSEAF 462

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           VLWD+  RL+MCN NY+  + L   +L PG AR+ +       I +   + P+ ++ + +
Sbjct: 463 VLWDRQGRLLMCNRNYRSVFSLEPKILKPGAARAEVNRFAALAIKQDHPA-PDGAKGV-R 520

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           E ++ D RW+QI+E  T +GG +    DIT +K  +   R ++ +L+  +  L       
Sbjct: 521 EAEMMDGRWIQISERRTAEGGLVMTAADITAIKTQEEARRRNEEQLQNAVAGL------- 573

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           ER + +L+    KY+ EK +AE+ANK KSEFLA MSHELRTPLNAI GFSE++  E+FG 
Sbjct: 574 ERSQEQLAELARKYETEKVKAESANKAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGP 633

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           LG  +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  K+++  ++  L  +  + +RL+ +
Sbjct: 634 LGDQRYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFESMHLEDVAEDAVRLVRN 693

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG----KMMIRTSKIGQ 691
            A++  +K++   P      AD R +K++L  +LSN+IKFT   G    ++ +R    G 
Sbjct: 694 RAEAAGLKLDIDFPQLPEIEADYRAVKQVLLNLLSNAIKFTPRAGSVTVRVEVRRDPFGD 753

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            + +++ DTGIGI K  L ++ +PFE + +Q+ ++  G GLGLA++ +L  +H G L++ 
Sbjct: 754 LIKVSVTDTGIGIAKEDLARLAKPFEQVESQFSKTTQGTGLGLALTKSLITMHDGVLEMH 813

Query: 752 SQEGKGTIVTICMP 765
           S  G+GT V+  +P
Sbjct: 814 STPGEGTTVSFTLP 827


>gi|295688681|ref|YP_003592374.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           segnis ATCC 21756]
 gi|295430584|gb|ADG09756.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           segnis ATCC 21756]
          Length = 843

 Score =  316 bits (810), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 193/550 (35%), Positives = 307/550 (55%), Gaps = 31/550 (5%)

Query: 227 ALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYE 286
           ALLL +      Q++K++      +++      A+   RCG+W ++ +  +  LS    +
Sbjct: 299 ALLLVV------QSRKSEAAQREFIDSEQRFRLAVEAARCGIWEWDLNADEVFLS----D 348

Query: 287 IMGIPYENKTLSFRAIARL---IHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGA--D 341
           + G  +        +   L   I  D+++    A +    +    D  F +         
Sbjct: 349 VTGAMFGWGGGGVVSGQDLLDRIAPDHRERLRKALANAALY-GAFDVSFRVPAVGQGQRS 407

Query: 342 IWIQVRAQMM-RTISGGMN-IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWD 399
           +WI  R Q   R  + G + IIG+A+D+TE+   + R   A+ RL  AIE  SEA VLWD
Sbjct: 408 LWIDARGQGFGRADADGYSRIIGVALDVTEERVAQARAQAAENRLRDAIESVSEAFVLWD 467

Query: 400 KNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKL 459
           ++ RL+MCN NY+  + L   +L PG AR+ I + +    I+   S P+ ++ + +E +L
Sbjct: 468 RHGRLLMCNRNYRNVFSLDPKLLKPGAARAEI-NRRAALAIKQDHSAPDAAKGV-REAEL 525

Query: 460 ADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
            D RW+QI+E  T +GG +    DIT +K+     R ++ +L+  +  L       ER +
Sbjct: 526 MDGRWIQISERRTAEGGLVMTAADITAIKNQDEARRLNQEQLQNAVAGL-------ERSQ 578

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            +L+    KY+ EK RAE AN+ KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  
Sbjct: 579 EQLAELARKYETEKVRAEGANRAKSEFLANMSHELRTPLNAINGFSEIMMNEMFGPLGDE 638

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
           +Y  Y+QDIH SGQHLL +IN+IL+MSKIE  K+++  +   +  +  + +RL+ + A++
Sbjct: 639 RYKGYSQDIHSSGQHLLALINDILDMSKIEAGKMNLKFEPMHVEDVAEDAVRLVRNRAEA 698

Query: 640 KNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM----IRTSKIGQCVII 695
             + +    P      AD R IK++L  +LSN+IKFT   G +     +R    G  V +
Sbjct: 699 AGLNLRIDFPPLPEIEADYRAIKQVLLNLLSNAIKFTPRAGSVTLTAEVRRDAFGDMVRV 758

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           ++ADTGIGI K  L ++ +PFE + +Q+ ++  G GLGLA++ +L ++H G L++ S  G
Sbjct: 759 SVADTGIGIAKEDLARLARPFEQVESQFSKTTQGTGLGLALTKSLISMHDGALEMTSTPG 818

Query: 756 KGTIVTICMP 765
           +GT V+  +P
Sbjct: 819 EGTTVSFALP 828


>gi|302382006|ref|YP_003817829.1| PAS/PAC sensor signal transduction histidine kinase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302192634|gb|ADL00206.1| PAS/PAC sensor signal transduction histidine kinase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 792

 Score =  314 bits (805), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 179/532 (33%), Positives = 289/532 (54%), Gaps = 18/532 (3%)

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
           +RQ++ ++    +  E+      A+   RCG+W ++ D +   +S  M  ++G+P     
Sbjct: 261 WRQSRASR----VWAESEHRFRVAVEAARCGVWEWDLDRETVDVSDYMAALLGLPTGGSV 316

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMM--RTI 354
            S   I R IH   + + E A           +  F +    G   WI  R Q    R  
Sbjct: 317 TSAAVIER-IHPRYRDLVEHALR-QAATFGAFEVTFAVPLEGGGARWIDARGQARGRRGD 374

Query: 355 SGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKA 414
            G   I+G+AMD+TE      +   A+ RL   IE  S+A VL+DK+ RL++ N  ++ A
Sbjct: 375 DGYGMILGVAMDITEARRARAQLQAAEGRLRDGIESVSDAFVLFDKHGRLILWNQAFKDA 434

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHD 474
           +G  D  +  G  +  +       I   R S   R+   ++E++L D R LQ+ E  T D
Sbjct: 435 FGFADEAVRKGAQKDELNRIAALAIKADRPSPEGRAG--AREVELYDGRVLQLAERFTGD 492

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GGT+    D+T ++  + + + S   L+ T+++L  S++       +LS+   KY++   
Sbjct: 493 GGTVITAADVTAIRRQEVERQRSADSLRKTVDELEASQE-------KLSLLARKYEIAMT 545

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
           RAE AN+ KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  KY  YA DI  SGQH
Sbjct: 546 RAEAANQAKSEFLANMSHELRTPLNAINGFSEIMAGEMFGPLGHEKYKGYAHDILKSGQH 605

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
           LL++IN+IL+M+KIE  K+++  +   L  +  + IRL+   AQ   + +  +       
Sbjct: 606 LLSLINDILDMAKIEAGKMTLHYEAVSLTELCEDAIRLMRGKAQDCGLTLSLEAGDVPEI 665

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIG 713
            AD R +K+++  ++SN++KFT   G++ +  ++     + I + DTGIGI  + L ++ 
Sbjct: 666 EADYRGLKQVMLNLISNAVKFTPEGGEITVSVTRQNAVTMRIAVTDTGIGIAAADLARLA 725

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           QPFE +  Q+ ++  G GLGLA++ +L  LHGG + ++S+ G+GT V+  +P
Sbjct: 726 QPFEQVEGQHSKTTQGTGLGLALTKSLIELHGGEMTMVSEPGEGTTVSFDIP 777


>gi|167647393|ref|YP_001685056.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           sp. K31]
 gi|167349823|gb|ABZ72558.1| PAS/PAC sensor signal transduction histidine kinase [Caulobacter
           sp. K31]
          Length = 844

 Score =  313 bits (801), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 186/523 (35%), Positives = 291/523 (55%), Gaps = 32/523 (6%)

Query: 255 ICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARL-----IHYD 309
           + VE A    RCG+W +     +  +S    ++ G  +        A   L     + + 
Sbjct: 327 LAVEAA----RCGIWEWELGADQVFMS----DVTGAMFGWGGGGVVAGQELLDRVSVDHR 378

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGA-DIWIQVRAQMMRTIS--GGMNIIGIAMD 366
           +K    +A + T       D  F +    G   IWI  R Q        G   IIG+A+D
Sbjct: 379 DKVRQALANAAT---YGAFDVSFRVPSRDGGRAIWIDARGQGFGKPGEDGYSRIIGVALD 435

Query: 367 LTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN 426
           +TE+   + R   A+ RL  AIE  SEA VLWD+  RL+MCN NY+  + L   +L PG 
Sbjct: 436 VTEERLAQARAQAAENRLRDAIESVSEAFVLWDRQGRLLMCNRNYRNVFNLEPKLLKPGA 495

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITL 486
            R+ +        I++    P+ ++ + +E +L D RW+QI+E  T +GG +    DIT 
Sbjct: 496 PRNEVNRFAAL-AIKHDQPAPDGAKGV-REAELNDGRWIQISERRTAEGGLVMTAADITA 553

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           +K+ +   R ++ +L+  +  L       ER + +L+    KY++EK +AE ANK KSEF
Sbjct: 554 IKNQEEARRLNEEQLQHAVAGL-------ERSQEQLAELARKYEMEKVKAEGANKAKSEF 606

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLNAI GFSE++  E+FG LG  +Y  Y+ DIH SGQHLL +IN+IL+MS
Sbjct: 607 LANMSHELRTPLNAINGFSEIMMNEMFGPLGDQRYKGYSLDIHNSGQHLLALINDILDMS 666

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILF 666
           KIE  K+++  +   L  +  + +RL+ + A++  +K+E   P      AD R +K++L 
Sbjct: 667 KIEAGKMNLKFEPLSLEDVTEDAVRLVRNRAEAAGLKLEIDFPPLPEVEADYRAVKQVLL 726

Query: 667 PILSNSIKFTNNNGKMMIRT----SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
            +LSN+IKFT   G++++R       +G+ V +++ DTGIGI    L ++ +PFE + +Q
Sbjct: 727 NLLSNAIKFTPRAGRIVVRAEVRRDPLGERVRVSVTDTGIGIAAEDLARLARPFEQVESQ 786

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + ++  G GLGLA++ +L  +H G L++ S  G+GT V+  +P
Sbjct: 787 HAKTTQGTGLGLALTKSLVEMHDGALEMTSTPGEGTTVSFILP 829


>gi|13476392|ref|NP_107962.1| two-component, sensor histidine kinase [Mesorhizobium loti
           MAFF303099]
 gi|14027153|dbj|BAB54107.1| two-component, sensor histidine kinase [Mesorhizobium loti
           MAFF303099]
          Length = 356

 Score =  313 bits (801), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 231/341 (67%), Gaps = 1/341 (0%)

Query: 423 VPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK-EIKLADSRWLQINEWCTHDGGTISVG 481
           +PG  R+ ++        E R ++    Q  +  E +L+D RWLQ+NE  T DGG +SVG
Sbjct: 1   MPGVTRASLEGRMLAFASERRLANTNGPQGGATFERQLSDGRWLQVNELKTRDGGIVSVG 60

Query: 482 TDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANK 541
           +DIT +K +Q +L +S+RRL ATI+DLS +R+  E +  EL   N KY  E ERAE AN+
Sbjct: 61  SDITQIKLHQEKLVDSERRLMATIHDLSLARRAEEERSRELVDLNRKYMKETERAEAANR 120

Query: 542 TKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN 601
            KSEFLA MSHELRTPLNAI+GFSE++++ +FG LGS +Y EYA DI+ SG++LL +IN+
Sbjct: 121 AKSEFLANMSHELRTPLNAIIGFSELMEQGLFGPLGSARYEEYATDINSSGKYLLGVIND 180

Query: 602 ILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           IL+MSKIE  + S+D++  DL P+I+E +R++   A  K I +E +I   L   AD+R I
Sbjct: 181 ILDMSKIEAGQFSLDQEQIDLGPLISETVRVVSLQAAQKAITVETRIADALSLFADRRAI 240

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           K+I+  +LSN++KFT   G + +R       +++TI D G GIPK AL K+G+PFE + N
Sbjct: 241 KQIVINLLSNAVKFTGQGGHISVRARNTSGALVLTIEDNGCGIPKEALGKLGRPFEQVQN 300

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           Q+ ++  G GLGLAIS +L  L GG LKI S EG GTIV++
Sbjct: 301 QFSKNHAGSGLGLAISRSLAELQGGALKIRSTEGVGTIVSV 341


>gi|329888197|ref|ZP_08266795.1| non-motile and phage-resistance protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328846753|gb|EGF96315.1| non-motile and phage-resistance protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 420

 Score =  300 bits (769), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 159/406 (39%), Positives = 244/406 (60%), Gaps = 10/406 (2%)

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           +G+A+D+TE    + +   A+ RL  AIE  S+A VL+D+  RL++ N  +Q A+  P  
Sbjct: 1   MGVALDVTEARRTKAQAQAAESRLRDAIESVSDAFVLFDRRGRLILWNQGFQDAFAFPKG 60

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV 480
           V+ PG  +  +       I     S   R+    +E++L D RWLQ+ E  T DGGT+ +
Sbjct: 61  VVRPGAQKDELNRIAAEAIKAEHPSAGGRAG--VREVELKDGRWLQMAERFTGDGGTVVI 118

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
             DIT+++  +A+ R +   L+A + +L  S       +  L++   KY+V   RAE AN
Sbjct: 119 CADITVIRRQEAERRRAADELRAMVAELEAS-------QANLALLARKYEVAMTRAEAAN 171

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + KSEFLA MSHELRTPLNAI GFSE++  E+FG LG  +Y  YA DIH SGQHLL++IN
Sbjct: 172 QAKSEFLANMSHELRTPLNAINGFSEIMAAEMFGPLGDRRYKGYAADIHGSGQHLLSLIN 231

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +IL+M+KIE  K+++  +   L  +  E +RL+   AQ   + +    P +L   AD+R 
Sbjct: 232 DILDMAKIEAGKLTLHYEPMALDVLCAEAVRLMRGKAQEAQLALTLDCPEDLHIEADQRG 291

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           +K++L  ++SN++KFT   G + ++ + +    V +++ DTGIGI    LE++ QPFE +
Sbjct: 292 LKQVLLNLISNAVKFTPEGGAVSVKVAPRDAATVRVSVVDTGIGIAAKDLERLAQPFEQV 351

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             Q+ +S  G GLGLA++ +L  LHGG + I S+ G+GT V   +P
Sbjct: 352 EGQHSKSTQGTGLGLALTKSLIELHGGAMTIESEPGRGTTVWFDLP 397


>gi|312113732|ref|YP_004011328.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218861|gb|ADP70229.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
          Length = 630

 Score =  297 bits (760), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 274/477 (57%), Gaps = 10/477 (2%)

Query: 293 ENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMR 352
           E++  SFR +   +H D+     I++++     K+++    ++ A       Q+R ++  
Sbjct: 147 ESRPASFRDLRHWLHPDDFLYASISQALKSGQ-KRVNWPVRIKDAEKGWRTFQLRGEISS 205

Query: 353 TISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
           T  G     G+ + +      +    E    L + +E    ++ +WD+ +RLV+CN  ++
Sbjct: 206 TPQGAPAFEGLLVPIDPSQSPQG--LEGFPSLPEIVESLPISIAIWDRENRLVLCNRKFR 263

Query: 413 KAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK----EIKLADSRWLQIN 468
           + Y +     +PG +   IQ AQT+  I  R   PE    + +    E +L D  WLQI 
Sbjct: 264 QLYRVSAAAALPGTSYEAIQ-AQTQEAIAQRP--PEGRGVVGRFQLQERQLGDGTWLQIG 320

Query: 469 EWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
           E+ T +G  +S GTDIT+ K  Q ++ E +++++A ++    SR+ LE Q  +L      
Sbjct: 321 EYWTGEGTLVSFGTDITMQKQTQHRVLEREQQMRARVDGFEQSRRQLEIQARQLRELAES 380

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
           Y  EK RAE AN+ KSEFLA +SHELRTPLNAI+GFSE+++  + G +G+ KY  Y +DI
Sbjct: 381 YNEEKIRAEAANQAKSEFLANVSHELRTPLNAIIGFSEMMRDGVLGPIGNPKYESYVKDI 440

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
           H SG++LL MIN+IL+MSKIE  + ++  +   +  +  E + ++   A   N+++ +  
Sbjct: 441 HNSGRYLLEMINDILDMSKIEAGRWTLSPEWFTMSDVFQECLSVVSPVAMEGNVELSQSG 500

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
            + +    D+R +K++L  +LSN++KFT  +GK+ +R  +    + I IADTG+GIPK  
Sbjct: 501 NTSISLYGDRRALKQVLINLLSNAVKFTPQDGKVSLRAYRYRGSIRIAIADTGVGIPKHD 560

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           L ++G+PFE + NQ  +   G GLGLAIS +L  +HGG+L I S+ G+GT VT  +P
Sbjct: 561 LGRLGRPFEQVSNQLTKGHKGTGLGLAISRSLVEMHGGKLDIKSRVGEGTTVTCILP 617


>gi|114797754|ref|YP_761588.1| non-motile and phage-resistance protein [Hyphomonas neptunium ATCC
           15444]
 gi|114737928|gb|ABI76053.1| non-motile and phage-resistance protein [Hyphomonas neptunium ATCC
           15444]
          Length = 821

 Score =  293 bits (751), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 212/660 (32%), Positives = 327/660 (49%), Gaps = 57/660 (8%)

Query: 126 LSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYH 185
           L+++  ++ +P      S     H IG     + P  S +  +   V  S          
Sbjct: 183 LTQASTIIPEPGSGAHISVQAEGHVIGFGDPALQPAASAADLQRPQVTSSGG------VR 236

Query: 186 VLSVNLPHNSGSILI-INSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYR------ 238
             S   P   GS+ + +    PL    R ++ L +  F+++ A   F LF   R      
Sbjct: 237 AASACAPVGEGSVCVCVTVDQPLFT--RADL-LSLAIFALLVAAPTFTLFGLSRRLSLRQ 293

Query: 239 -----QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
                Q  +N+E+D IL    + +  A    R G W +  D     LS    +++G+   
Sbjct: 294 REIAIQETRNEESDRIL---GLVMRGA----RAGYWEWYQDASALFLSDGAADLVGLGEG 346

Query: 294 NKTLSFRAIARLIHYDNKKICE---IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQM 350
            +      +AR+       + E    ARS+   H+  + Q   +R       WI++R  +
Sbjct: 347 GRAPLEELLARVPVESRGYVKEGFSKARSIGWVHLTFIAQTSPLR-------WIEMRGSI 399

Query: 351 -MRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNA 409
               ++G     GI MD TE+   E R   A++RL  AIE  +    LWD   RL+  N 
Sbjct: 400 STDPVTGTTVFGGIMMDATERKQAEDRVKTAERRLRNAIEGFNGPFALWDTRKRLLYWNR 459

Query: 410 NYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINE 469
            +   +GL D  L PG +   +  A+   +   R S+ +     +  I L   RWL++ E
Sbjct: 460 AFALDFGLQD-TLRPGMSHDTVVIARAGAVSMERQSEEDAR---TTTIALRTGRWLKMVE 515

Query: 470 WCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKY 529
             T DGG I+VG ++T    N+ +L++ K +L+    DL  S    E   +ELS    KY
Sbjct: 516 RATPDGGLITVGIEVTENVRNEEELKKQKEKLRRAALDLERS----EGHASELS---RKY 568

Query: 530 QVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIH 589
             EKE+AE A   KS FLA MSHELRTPLNA++GFSE++  E+ G LG   Y EYA+DI 
Sbjct: 569 SEEKEKAERAALAKSAFLANMSHELRTPLNAVIGFSEIMTNELAGPLGDPSYKEYAKDIL 628

Query: 590 YSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI----E 645
            SGQHLL+MIN+IL+M+KIE  K++I  Q  D I  ++  +R+I   A+ K I +    E
Sbjct: 629 MSGQHLLDMINDILDMAKIEAGKMTISPQPIDPIDPVDAAMRMIRRKAEEKAIDLVLEAE 688

Query: 646 KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
             +P     +AD R I++++  +LSN+IKFT+ +G + +R  + G  +   + DTGIGIP
Sbjct: 689 DNLPD---IDADHRAIRQMMLNLLSNAIKFTDRSGTITVRVEQRGTDIYFGVTDTGIGIP 745

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              L ++ QPFE +    D++  G GLGL+++ +   +HGGR+ + S  G+GT V   +P
Sbjct: 746 AEDLPRLAQPFEQVAKTKDRNHEGTGLGLSLTKSFAEMHGGRMLLSSIYGEGTTVAFVLP 805


>gi|254420304|ref|ZP_05034028.1| PAS fold family [Brevundimonas sp. BAL3]
 gi|196186481|gb|EDX81457.1| PAS fold family [Brevundimonas sp. BAL3]
          Length = 759

 Score =  290 bits (742), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 175/540 (32%), Positives = 282/540 (52%), Gaps = 25/540 (4%)

Query: 234 FSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYE 293
           F   R+A+ ++E  +      I VE A    RCG+W ++ D  +  LS  M  ++G    
Sbjct: 220 FQGLRRARASREWASSEKRFRIAVEAA----RCGVWEWDLDGAEVTLSDYMATLLGFETG 275

Query: 294 NKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQM--M 351
               +   +AR+      ++    R  T     ++   F +    G   WI  R Q    
Sbjct: 276 GVVPAEAVMARIHPRYRDEVQHALRQATAYGAFEV--TFPVPGDGGRTRWIDARGQARGA 333

Query: 352 RTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY 411
           R  +G   I+G+A+D+TE    +     A+ RL   +E  S+A VL+D+  RL++ N  +
Sbjct: 334 RGEAGFSAILGVALDITEARRAKAAAQSAESRLRDGVESISDAFVLFDRQGRLILWNQAF 393

Query: 412 QKAYGLPDHVLVPGNARSIIQDAQTRPI-IEYRTSDPERSQDMSKEIKLADSRWLQINEW 470
           + A+     V+  G A+  +       I  E+  +D    +   +E++L D RWLQ++E 
Sbjct: 394 EDAFDFQSGVVRRGAAKEELNRIAALAIKAEHAPTD---GRAGLREVELHDGRWLQLSER 450

Query: 471 CTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQ 530
            T +GG++    DIT +K  + + R +   L  T+  L  S+Q+L +          KY+
Sbjct: 451 FTSEGGSVVTAADITAIKREETERRRAVEDLSRTVAQLEASQQMLSQLAR-------KYE 503

Query: 531 VEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHY 590
           +   RAE AN+ KSEFLA MSHELRTPLNAI GFSE++  E+FG +G  KY  YA DI  
Sbjct: 504 IAMTRAEAANQAKSEFLANMSHELRTPLNAINGFSEIMAAELFGPIGE-KYKGYAGDILK 562

Query: 591 SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPS 650
           SGQHLL++IN+IL+M+KIE  K+++  +   L  +  +  RL+        + +E +   
Sbjct: 563 SGQHLLSLINDILDMAKIEAGKMTLHYEPVSLRDVCEDAARLMRGKVLESGLTLEIEAGD 622

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIP 705
                AD R +K+++  ++SN++KFT   G + +  +          V +  ADTGIGI 
Sbjct: 623 LPDIEADHRGVKQVMLNLISNAVKFTPEGGTVTLSLTPFKGAAGEDRVRVACADTGIGIA 682

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              + ++ +PFE +  Q+ ++  G GLGLA++ +L  +HGGRL I S+ G GT+V+  +P
Sbjct: 683 PEHMVRLARPFEQVEGQHSKTTQGTGLGLALTKSLIEMHGGRLNIESEPGVGTVVSFDLP 742


>gi|218670425|ref|ZP_03520096.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli GR56]
          Length = 228

 Score =  278 bits (712), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 126/217 (58%), Positives = 167/217 (76%), Gaps = 1/217 (0%)

Query: 268 LWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQ 327
           LW+F+F+N++F  SRSMY+++G+P  +KT+ F   ARL+H D+  + EIAR++   H  Q
Sbjct: 12  LWDFDFENREFFWSRSMYDMLGLPGSDKTMGFGEAARLMHPDDGGLYEIARAIAKGHSGQ 71

Query: 328 LDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           +DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE++ L +RYAEADQRL+ A
Sbjct: 72  VDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQHRLAQRYAEADQRLADA 131

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP 447
           IECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI+  A  RP+IE R +D 
Sbjct: 132 IECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSIVNAAAARPVIERRIADA 191

Query: 448 ERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTD 483
           + S    + E++LAD RWLQINE  T DGG +SVGTD
Sbjct: 192 DGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTD 228


>gi|254293651|ref|YP_003059674.1| histidine kinase [Hirschia baltica ATCC 49814]
 gi|254042182|gb|ACT58977.1| histidine kinase [Hirschia baltica ATCC 49814]
          Length = 752

 Score =  275 bits (702), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 169/508 (33%), Positives = 274/508 (53%), Gaps = 29/508 (5%)

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKK--ICEIARSVT 321
           G+ G W +N +   F L     E++G+  +N  LS +    LIH  N+K  + E+ ++  
Sbjct: 255 GQNGYWTWNRETGLFSLRTKTAEMLGL-IDNSDLSLQQFQELIHPGNQKNVLYELEKA-- 311

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEAD 381
            KH K   Q+    + S +  + +++    +       + GI  D TE+   E R   ++
Sbjct: 312 -KHNKSF-QVSFKGNGSFSSRYFEMQGGPFQD-----GLSGIMTDTTERVRAEARSRMSE 364

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE 441
                  +        WD+  RL++ N ++ + + LP++VL  G +  ++     + I  
Sbjct: 365 HLARSVADAYPGPFASWDQRHRLLLWNRHFARLFNLPENVLKAGTSYDVVMAEAAKQI-- 422

Query: 442 YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRL 501
            R   P    D  +EI L    WL   +  T  GG ++VG DI+ +K++Q  L   +++L
Sbjct: 423 -RIERPVPGSDNGREILLLSDIWLNFYDRPTAGGGLVTVGLDISSIKNHQESLLGKEKKL 481

Query: 502 KATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAI 561
           +  + +L       +R + +      KY  EK +AE A++ KS FLA MSHELRTPLNAI
Sbjct: 482 RRLVLEL-------DRMQGQSEEHARKYAEEKTKAEKASQAKSVFLANMSHELRTPLNAI 534

Query: 562 LGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNAD 621
            GFSE++ KEI+G LG  +Y  YA+DI  SGQHLL+MIN+IL+M+KIE  K+SI  +  D
Sbjct: 535 NGFSEMLIKEIYGPLGDERYIGYAEDILSSGQHLLDMINDILDMAKIEAGKMSISTREID 594

Query: 622 LIPIINEGIRLIGSSAQSK----NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTN 677
            +  ++  +R+I   A  K    N+ ++  IP       D R IK+++  ++SN+IKFT+
Sbjct: 595 PVEAVDSAVRMIRRRAADKDIDLNLTVKDDIPD---IEGDHRAIKQMVLNLVSNAIKFTD 651

Query: 678 NNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
             G + I   K    V +++AD GIGIPK  + ++ QPFE      +++  G GLGL+++
Sbjct: 652 PGGYINISVVKENAFVRVSVADNGIGIPKQDIPRLAQPFEQSSADENRNSKGSGLGLSLT 711

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMP 765
            +   +HGGRL+I S+ G+GT V+  +P
Sbjct: 712 KSFAEMHGGRLEIESEFGEGTTVSFLLP 739


>gi|218513200|ref|ZP_03510040.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli 8C-3]
          Length = 207

 Score =  265 bits (677), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 127/202 (62%), Positives = 158/202 (78%), Gaps = 1/202 (0%)

Query: 315 EIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLE 374
           EIAR++   H  Q+DQIF MRHA G  +W++ RAQ++R+ SG M++IGIAMD+TE++ L 
Sbjct: 6   EIARAIAKGHSGQVDQIFRMRHAGGHYVWMRARAQVIRSNSGRMHLIGIAMDVTEQHRLA 65

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA 434
           +RYAEADQRL+ AIECTSEA VLWDKNDRLVMCN ++Q+AYGLPD VLVPG  RSI+  A
Sbjct: 66  QRYAEADQRLADAIECTSEAFVLWDKNDRLVMCNTHFQQAYGLPDSVLVPGTERSIVNAA 125

Query: 435 QTRPIIEYRTSDPERS-QDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
             RP+IE R +D + S    + E++LAD RWLQINE  T DGG +SVGTDITL+K +Q +
Sbjct: 126 AARPVIERRIADADGSGYSRTTEVQLADERWLQINERRTRDGGRVSVGTDITLMKRHQER 185

Query: 494 LRESKRRLKATINDLSTSRQIL 515
           LRES+RRL ATI DLS SRQ L
Sbjct: 186 LRESERRLMATIGDLSASRQTL 207


>gi|304321187|ref|YP_003854830.1| non-motile and phage-resistance protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300089|gb|ADM09688.1| non-motile and phage-resistance protein [Parvularcula bermudensis
           HTCC2503]
          Length = 754

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 177/577 (30%), Positives = 294/577 (50%), Gaps = 35/577 (6%)

Query: 198 ILIINSRVPLL--RLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANI 255
           +L+    VPL+   LW   +++ V    +  AL+   + + + +A    E   +L     
Sbjct: 166 VLVAAQPVPLIPFALWAPYLSVGVGIAGLCWALMAMAIRTRHTEAISEGERRHLL----- 220

Query: 256 CVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICE 315
                L   R G+  +  +N    L  +    +G   +N T+    +   IH  +  +  
Sbjct: 221 --SRILGPERAGIGIWRRENTGVVLPAATRAALGFTRQNVTMPTDDLEGFIHQADTPVAH 278

Query: 316 IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEK 375
             R      +   D +   R   G   + +V   + RT S    + GIA+ L +    + 
Sbjct: 279 --RFFFADDIGGGDLVLRCRTVEG--TYARV---LFRTTSDAEGM-GIAVPLGDSGLADP 330

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG---NARSIIQ 432
           + ++   RL + +E   +A +LWD+N+RL+  NA +   +G+    +  G    A   + 
Sbjct: 331 QASQEVDRLRETVEALPQAFLLWDQNERLLAWNAPFLSLFGIDRGAVAEGIDAGALMALA 390

Query: 433 DAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
            A   P++ + T  P    D + E    + +++++    T  GG + V  D++  K    
Sbjct: 391 SADLCPLLAHFT--PPTDDDQAVEAVFPNEQFVRVVRTKTVGGGWVCVAHDVSDAKIEAE 448

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           Q   ++R L+ T+       ++L+R + +L  A  +Y+ EK  A+ AN+ KSEFLA MSH
Sbjct: 449 QRARNERELQHTV-------EVLKRNREDLREAVRRYETEKLNAQEANRAKSEFLANMSH 501

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI GFSE++K+E+FG LG  KY EY +DIH SG HLLN+I++IL++SK+E  K
Sbjct: 502 ELRTPLNAINGFSELMKEELFGPLGHKKYVEYIKDIHASGSHLLNLIDDILDLSKLEAGK 561

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIK---IEKKIPSELFFNADKRIIKKILFPIL 669
           + +D    DL  ++ E +RL+    +  +++   +   IPS     AD R +K+++  +L
Sbjct: 562 LDLDLCQVDLDRLLKESLRLVEMQMREASLEFRSLTDHIPS---VWADPRAVKQVILNVL 618

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SN+ KFT   G + + T      V I IADTGIG+    LEK+GQPFE   + + ++  G
Sbjct: 619 SNAQKFTPQGGAVTVTTLVDLTTVTILIADTGIGMTPEQLEKLGQPFELADDHFSRASRG 678

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            GLGLA+S +L     G L + S+  +GT+  IC+P+
Sbjct: 679 TGLGLALSKSLMEAQNGLLAVTSEPRRGTVAAICLPR 715


>gi|218678760|ref|ZP_03526657.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 894]
          Length = 231

 Score =  262 bits (670), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 115/194 (59%), Positives = 156/194 (80%)

Query: 225 ISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSM 284
           IS++LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+FDN++F  SRSM
Sbjct: 1   ISSILLVILYAYYTQVKRARDADDIFLESNLRVETALSRGRCGLWDFDFDNREFFWSRSM 60

Query: 285 YEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWI 344
           Y+++G+P  +K + F   ARL+H D+  + EIAR++   H  Q+DQIF MRHA G  +W+
Sbjct: 61  YDMLGLPGSDKAMGFGEAARLMHPDDGGLYEIARAIAKGHSGQVDQIFRMRHAGGHYVWM 120

Query: 345 QVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRL 404
           + RAQ++R+ SG M++IGIAMD+TE++ L +RYAEADQRL+ AIECTSEA VLWDKNDRL
Sbjct: 121 RARAQVIRSNSGRMHLIGIAMDVTEQHRLAQRYAEADQRLADAIECTSEAFVLWDKNDRL 180

Query: 405 VMCNANYQKAYGLP 418
           VMCN ++Q+AYGLP
Sbjct: 181 VMCNTHFQQAYGLP 194


>gi|163795303|ref|ZP_02189270.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
 gi|159179289|gb|EDP63820.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
          Length = 664

 Score =  243 bits (619), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 146/392 (37%), Positives = 212/392 (54%), Gaps = 17/392 (4%)

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQ---------KAYGLPDHVLVPGNARSIIQDA 434
           L   ++ T +A+ L+D+ +RLV+ N +++             L + VL      +     
Sbjct: 279 LRDTVDATEQAVALFDREERLVIWNQSFELFSPAVTFRVGMTLEETVLTVTKTSASTMHI 338

Query: 435 QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
             RP+         R      E + AD R   I E  T DGG +   TD T LK  +   
Sbjct: 339 DGRPVTAAERLALPRGSFTELERRSADGRIFLIRERLTADGGVVITATDATDLKVKE--- 395

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
               + L+A +  L  +R   E+    L+        EKERAE A++TKS+FLA MSHEL
Sbjct: 396 ----QTLEAQVQALHAARADAEQHAEHLARMTDMLTREKERAEAASRTKSQFLANMSHEL 451

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNA+LGFSE++K E FG LG+ +Y EYA DIH SG HLL++IN+IL+MSKIE  K  
Sbjct: 452 RTPLNAVLGFSEILKTEAFGPLGAKRYKEYADDIHASGHHLLSLINDILDMSKIEAGKYR 511

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSI 673
           + K+   L  II    R++   A   ++ ++ ++P   L  N D R IK++L  +L+N+I
Sbjct: 512 LHKEKEALASIIGAVGRMMRGRAAEADLVLQVELPDPALVVNVDVRAIKQVLINLLANAI 571

Query: 674 KFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
            FT   G++ +        V + +AD GIGIP+  L ++ +PFE +     +   G GLG
Sbjct: 572 TFTPAGGRVRLGVRVHDDGVAMYVADNGIGIPEEELPRLLRPFEQIDGADRRGREGTGLG 631

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LA+S+AL  LH G L + SQ G GT VT+ +P
Sbjct: 632 LALSNALVELHSGTLTLESQIGIGTTVTVRLP 663



 Score = 50.8 bits (120), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 93/203 (45%), Gaps = 42/203 (20%)

Query: 355 SGGMNIIGIAMDLTEKYHLEKRYAE-------ADQRLSKAIECTSEALVLWDKNDRLVMC 407
           +GG+ I   A D+T++   E R  E       A++RL  A++ + +   ++D + RLV+C
Sbjct: 122 AGGLAIY--ARDVTDRRADEIRMRELEQRARRAERRLIDALDASPDPFAVFDSSSRLVLC 179

Query: 408 NANYQKAYGLPDHVLVPG-------NARSIIQDA------------QTRPIIEYRTSDPE 448
           N  +    GL D  L+PG          SI  D             Q R ++ +R +D E
Sbjct: 180 NQTWASMSGLGDARLLPGRRFEDLLRQVSIGADPANVGFDTIEAFIQWR-LVRHRNADGE 238

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
             Q     I   D R   I E    DGG+++V T+IT       +L  S+R L+ T++  
Sbjct: 239 PIQ-----ITQKDGRVFLIRERRMDDGGSVNVATEIT-------ELERSRRLLRDTVDAT 286

Query: 509 STSRQILERQKTELSIANAKYQV 531
             +  + +R++  L I N  +++
Sbjct: 287 EQAVALFDREE-RLVIWNQSFEL 308


>gi|83591406|ref|YP_425158.1| PAS/PAC sensor Signal transduction histidine kinase [Rhodospirillum
           rubrum ATCC 11170]
 gi|83574320|gb|ABC20871.1| PAS/PAC sensor signal transduction histidine kinase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 773

 Score =  209 bits (533), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 233/432 (53%), Gaps = 63/432 (14%)

Query: 354 ISGGMNIIGIAM---DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
           + G    +G+ +   D+T +   E R   A++ L +A E  S A++L+D    LV+ N+ 
Sbjct: 377 VDGDGKAMGVTLFTRDITSRREAEDRARAAERHLLEATELMSAAMLLFDPQGILVLINSA 436

Query: 411 YQKAYGLPD--HVLVPG----------NARSIIQDA--QTRPIIEYRTSDPERSQDMSKE 456
            + A  LPD   +L PG           AR +   A  +++  I+  T  P        E
Sbjct: 437 CRAA--LPDLEDILHPGLSFIELRAAIVARRLFVQAITESQGGIKGGTPGP-----APIE 489

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
           ++  D RWL I +  T  G T+ +GTDIT          E KRR                
Sbjct: 490 VRGKDGRWLLIRQSATSSGYTLILGTDIT----------ELKRR---------------- 523

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
               E ++A+AK     E AE AN+ KSEFLA MSHELRTPLNAI+GFS++ + ++FG L
Sbjct: 524 ----ERALADAK-----EVAEYANRAKSEFLANMSHELRTPLNAIIGFSDITRHQMFGRL 574

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
            +  Y +YA++I+ SG HLL +I++IL+++KIE  ++ +D++  D   +++  I+++   
Sbjct: 575 DNPVYVDYARNIYDSGTHLLEIISDILDLAKIEAGELGLDEEEVDAARLVDSAIQMVTPR 634

Query: 637 AQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI--GQCV 693
           A SK I +   +  +L     D   +K++L  +LSN++K+T  +G + + T+++  G  +
Sbjct: 635 ATSKRIALTNLLTGDLPRLWCDPLRLKQVLINLLSNAVKYTQEDGAVAV-TARLAGGDGL 693

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            I++ DTGIG+ ++ ++     F  + + Y +  GG GLGL ++  LT  H G L I S+
Sbjct: 694 AISVIDTGIGMDEAGIQVAMTAFGQVESPYSRRQGGTGLGLPLTRKLTEAHQGCLTIASR 753

Query: 754 EGKGTIVTICMP 765
            G+GT VTI +P
Sbjct: 754 PGEGTTVTILLP 765


>gi|163795280|ref|ZP_02189247.1| Sensor protein gacS [alpha proteobacterium BAL199]
 gi|159179266|gb|EDP63797.1| Sensor protein gacS [alpha proteobacterium BAL199]
          Length = 727

 Score =  207 bits (528), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 141/421 (33%), Positives = 217/421 (51%), Gaps = 60/421 (14%)

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV 421
           G+  DLT+    E+R    + +L++A++  SE L  WD++DRLVMCN  Y+   G     
Sbjct: 331 GVGKDLTDLITAEQRVRATNTQLAQALDARSEGLAFWDRDDRLVMCNQAYRDQSGKSGST 390

Query: 422 LVPGNA-----RSIIQ-----------DAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL 465
           LVPG +     R+ I+           DA  +  +E R + P      + EI   D RWL
Sbjct: 391 LVPGISYEDYIRAGIEAGEVPAAVGREDAWLQERLEVRRNLP-----YTVEIFRGD-RWL 444

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
            I E  T DGGT+   TDI+          E KRR  A +  +                 
Sbjct: 445 LIREQRTPDGGTLLTATDIS----------ELKRREDALVKAV----------------- 477

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
                   E+A+ AN+ K  FLA MSHELRTPLNAI+GF+E+IK         V+  EYA
Sbjct: 478 --------EQAQLANRAKMAFLATMSHELRTPLNAIIGFAEIIKSGQIASNSDVQ-GEYA 528

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
             IH SG HLL +IN++L++S+IE  ++ +D++   L  +I+E  R+I   A++  +++ 
Sbjct: 529 GYIHESGAHLLAVINDLLDVSRIEAGRLVLDEKPFGLASLIDECDRMIRQKAEADGLRLA 588

Query: 646 -KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK-IGQCVIITIADTGIG 703
              +   L  + D+R  K+IL  +LSN++KFT + G + +   +  G  + + + DTGIG
Sbjct: 589 MATVDPGLGIHGDRRAFKQILINLLSNAVKFTESGGAVTLTAERDAGGRLRMVVRDTGIG 648

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           +  + + ++ +PF  L N + +   G GLGL I+  L   HGG +   S   +G+ VTI 
Sbjct: 649 VEANRVVELFEPFRQLENVHARRHHGTGLGLYITKNLVEAHGGSIVFESTVHEGSTVTIT 708

Query: 764 M 764
           +
Sbjct: 709 L 709


>gi|218670543|ref|ZP_03520214.1| multi-sensor signal transduction histidine kinase [Rhizobium etli
           GR56]
          Length = 186

 Score =  201 bits (512), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 97/183 (53%), Positives = 137/183 (74%)

Query: 583 EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
           EYA+DIH SG+HLLN+IN+IL+MSKIE   + +  +  DL+P+I E +R     A  KNI
Sbjct: 1   EYARDIHDSGKHLLNVINDILDMSKIEAGHLRLHCERIDLVPLIEESLRFTAIPAAEKNI 60

Query: 643 KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGI 702
            I+++I S L   AD+R +K++L  +LSN++KFT+N G++ +RT ++   V +TIADTGI
Sbjct: 61  VIDQRISSGLTLTADRRAMKQVLLNLLSNAVKFTDNGGRIAVRTRRVDGAVTVTIADTGI 120

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           GIP+SAL KIGQPFE + +QY +S GG GLGLAIS +LT LHGGR+KI S+E  GT++++
Sbjct: 121 GIPRSALSKIGQPFEQVQSQYAKSKGGSGLGLAISRSLTALHGGRMKIRSREAVGTVISL 180

Query: 763 CMP 765
            +P
Sbjct: 181 RIP 183


>gi|144901258|emb|CAM78122.1| sensory transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 975

 Score =  200 bits (509), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 210/423 (49%), Gaps = 60/423 (14%)

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD-- 419
           G A D+T     E+  A         I+   + +V++D ++RLV  N++ ++   LP+  
Sbjct: 572 GTAADITPLKRHEQELATQSAMRQTIIDNMGQGVVVFDGDERLVALNSHARQLLDLPETE 631

Query: 420 -------------HVLVPG---NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR 463
                        ++ V G   ++ +I+   Q R  +     DP R  + ++     +  
Sbjct: 632 IETGTSNLEALLLYLAVQGEFGHSGAIMVKVQRR--LARLRRDPRRVFEHARP----NGS 685

Query: 464 WLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELS 523
            L+I       GG I   TDIT                              +R+K E++
Sbjct: 686 VLEIRSTAMPGGGLILTFTDIT------------------------------DRKKVEVT 715

Query: 524 IANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYE 583
           +  A+     + AE  N+ K+ FLA +SHELRTPLNAI+GFSE++K EIFG L    Y  
Sbjct: 716 LREAR-----DAAERGNRAKATFLANISHELRTPLNAIIGFSELMKHEIFGPLQPPAYRS 770

Query: 584 YAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK 643
           Y  D+H SG HLL +IN+IL+MSK E     + +   D+  ++   +R++   A +  I 
Sbjct: 771 YVDDVHESGMHLLELINDILDMSKAEAGMTDLVESPVDVAAVVRASLRMMDKRASANGIS 830

Query: 644 IEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGI 702
           +E  +P  L F  AD+R I++IL  +LSN++KFT++ G + +     G+ ++I + DTGI
Sbjct: 831 LEADLPDGLAFLRADERRIRQILLNLLSNAVKFTDDGGMVRVTAQVDGRGMVIEVIDTGI 890

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           G+    ++K+ +PF     +  +   G GLGL ++ AL N HGG +++ S    GT VT+
Sbjct: 891 GMTPEDMDKVMEPFVQADTRLSRKYEGTGLGLPLTKALVNAHGGTMELHSIPDHGTTVTV 950

Query: 763 CMP 765
             P
Sbjct: 951 TFP 953



 Score = 50.8 bits (120), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 9/133 (6%)

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
           RL  A+    + + L+D  +RLV  N  Y++       ++ PG     I DA+    +  
Sbjct: 212 RLVDALSSVQDGVALFDPRERLVTANDLYRQFMAPVAEIIKPGRLFQDIVDAEFEMGVVR 271

Query: 443 RTSDPERSQDMSK---------EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
           +  +  RS  ++          E +L D RW+ IN + T DGG + +  D+T  +   A 
Sbjct: 272 QECEVVRSGKLADHAVPAVQGCEAELFDGRWVSINVYPTADGGYLRILRDVTARRQVTAS 331

Query: 494 LRESKRRLKATIN 506
           L +S   L+  +N
Sbjct: 332 LHDSVTWLRGIMN 344


>gi|197106173|ref|YP_002131550.1| sensor histidine kinase DivJ [Phenylobacterium zucineum HLK1]
 gi|196479593|gb|ACG79121.1| sensor histidine kinase DivJ [Phenylobacterium zucineum HLK1]
          Length = 553

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 154/241 (63%), Gaps = 5/241 (2%)

Query: 528 KYQVEKER--AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           ++++EK R  AE  N  KS FLA MSHELRTPLNAI+GFS+++++ +FG +G  +Y EYA
Sbjct: 297 EHELEKARISAEQQNAGKSRFLANMSHELRTPLNAIMGFSDIMRQRLFGPMGD-RYGEYA 355

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           + IH SG HLL +IN++L+MSKIE E+  + +++ D    +   +RL+   A+   + + 
Sbjct: 356 ELIHESGSHLLELINDVLDMSKIEAERFELAREDFDARDAVGAVLRLMRGQAERAGVTLR 415

Query: 646 KKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
             +P E L   AD+R +K+I   ++SN++KFT   G + +     G+ + + +AD+G+GI
Sbjct: 416 AVMPPEPLEAEADRRAVKQITLNLISNALKFTPRGGTVTVTAQGAGETLELIVADSGVGI 475

Query: 705 PKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
             + LE++G+PFE   +   Q   G GLGL++  A   LHGG + I S  G+GT VT+ M
Sbjct: 476 APADLERLGRPFEQAGDA-QQRAAGSGLGLSLVRAFAALHGGEMAIESGVGEGTTVTVRM 534

Query: 765 P 765
           P
Sbjct: 535 P 535


>gi|288962795|ref|YP_003453089.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288915061|dbj|BAI76545.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 448

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 179/308 (58%), Gaps = 12/308 (3%)

Query: 464 WLQINEWCTHDG---GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS--RQILERQ 518
           W  +N     DG   G + VG DIT  K  +  LR+++  L+  + D + +  ++I ER+
Sbjct: 140 W-NLNRLPESDGAPAGILCVGQDITRRKRAEMALRQARDELEMRVADRTRALMQEIQERR 198

Query: 519 KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
           + E ++  AK     E+AE AN+ KSEFLA MSHELRTPLNAI+GFS +++ EI G LG 
Sbjct: 199 RAEQALIQAK-----EQAELANRAKSEFLANMSHELRTPLNAIIGFSSMMESEIVGPLGH 253

Query: 579 VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
            KY +YA+ I  SGQHLL +I++IL+++KIE  K+ +  Q  D+   +   + LI   A+
Sbjct: 254 PKYLDYAKVIGKSGQHLLAVISDILDVAKIEAGKLEMHPQPMDVRDAVESSLLLIAERAK 313

Query: 639 SKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITI 697
              + + + I P       D   +K+IL  +L+N++KFT   G + +R    G  ++I +
Sbjct: 314 EGGLTLVQDIAPDTPRLLGDPVRVKQILLNLLANAVKFTPAGGSVTLRVRPEGGRILIEV 373

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
           AD+GIG+    +    QPF  + +Q  +  GG GLGL +  +   L  G L I S+EG+G
Sbjct: 374 ADSGIGMSAEGIAIALQPFGQVDSQLSRRSGGTGLGLPLVRSFVELLNGTLDIRSREGEG 433

Query: 758 TIVTICMP 765
           T +++ +P
Sbjct: 434 TTISVRLP 441


>gi|163792358|ref|ZP_02186335.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
 gi|159182063|gb|EDP66572.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
          Length = 528

 Score =  199 bits (506), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 165/283 (58%), Gaps = 9/283 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L H Q  +RE    L+ T + L+    +L RQ T L  A+ +    ++ A TA+++KS F
Sbjct: 211 LDHLQTAVRERDSALQETSDALA----LLARQNTRLKAASEELSRTRDAALTADRSKSMF 266

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLNAI+GFSE++ ++++G +G  KY +YA DI  SG HLL +I+++L++S
Sbjct: 267 LAAMSHELRTPLNAIIGFSEIMARQLYGPIGHAKYRDYANDIRSSGDHLLALIDDVLDLS 326

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE---KKIPSELFFNADKRIIKK 663
           ++E  K+ + ++  D++  I    RL+   A    I +       PS      D+   ++
Sbjct: 327 RVEAGKLVLRREPLDVVEQIESCCRLVQGRATDSGIDLRFAPAANPSATILG-DRVRFRQ 385

Query: 664 ILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           IL  +L+N++KFT+  G + +         V+I +ADTGIG+    LE++ +PFE     
Sbjct: 386 ILLNVLTNAVKFTDAGGSVQVDIGDDTAGTVVIRVADTGIGMSDDDLERVFRPFEQAGVS 445

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             +++ G GLGLA+S AL   H G L I S  G+GT VT+  P
Sbjct: 446 GARAVEGVGLGLALSRALVREHDGTLNIASAPGRGTTVTLSFP 488


>gi|288962975|ref|YP_003453269.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
 gi|288915241|dbj|BAI76725.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
          Length = 1310

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 148/524 (28%), Positives = 244/524 (46%), Gaps = 43/524 (8%)

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL--SFRAIARLIHYDNK-KICEIARSVT 321
           R G+W++N +      S +  E +G  Y +  L  S    A LI  +++    E  R+  
Sbjct: 350 RDGIWDWNLETGGIWFSPTWKEQLG--YRDDELENSLEMWAGLIFEEDRFTALETVRAYN 407

Query: 322 GKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEA 380
              +   + +   RH  G  ++I  RA  +R  +G +  ++G   D+T +   E+    A
Sbjct: 408 AGLIPNFEAVQRFRHKRGHTVYILSRAIHIRDAAGRVVRMVGAHTDITREKLTEEELRLA 467

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQDAQTRPI 439
            Q L  AIE   E L  +D +DRL++CN  Y++A+ L   +  PG     I++ A     
Sbjct: 468 KQTLDDAIEAVPEGLAYFDADDRLILCNERYREAHPLTAPLFTPGRPFEEILRAAVANGE 527

Query: 440 IEYRTSDPE------------RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
                  P             R+     E +L D RW+ + E  T  G  +   TDIT  
Sbjct: 528 FAGNPDGPSDEAWIQAELAQHRNPGAPFERELPDGRWIVVAENRTSSGSLVCTRTDITER 587

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           K  +A+L+     + A    L  +R+              +    + RAE A + KSEFL
Sbjct: 588 KRFEAELQRQAADMCALAEGLDAARE--------------EADALRARAEAATQAKSEFL 633

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A MSHE+RTP+N I+G +E++      E    +  ++AQ I  S   LL +IN+IL++SK
Sbjct: 634 AAMSHEIRTPMNGIMGMTELLFDTPLTE----EQRQFAQAIRSSSNALLTIINDILDISK 689

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI--PSELFFNADKRIIKKIL 665
           +E  +++I+    D   ++   + L+   A  K I+I   I  P       D   I++IL
Sbjct: 690 LEAGRVTIETLPFDPADLVEGVVELLTPRAHEKGIEIGFYIDPPLRRTLLGDPTRIRQIL 749

Query: 666 FPILSNSIKFTNNNG---KMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIGQPFEPLHN 721
             ++ N++KFT+      ++  R +     V+ +T+ DTGIGIP  A+  +   F+ +  
Sbjct: 750 VNLVGNAVKFTDQGSVAVELEAREATDAHLVLRMTVTDTGIGIPAEAMPTLFNKFQQVDG 809

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +  GG GLGLAI   L+ L GG + + S+ G G+   + +P
Sbjct: 810 SITRKFGGTGLGLAICRQLSELMGGSIAVESRLGSGSRFLVDLP 853


>gi|154252383|ref|YP_001413207.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154156333|gb|ABS63550.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 523

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/271 (38%), Positives = 171/271 (63%), Gaps = 16/271 (5%)

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           RL+A + +L  +R+ LE+   EL +A        + A +A++ KS+FLA MSHELRTPLN
Sbjct: 248 RLRAHVLELDETRKQLEKTSAELLVA-------LQSASSADQAKSQFLATMSHELRTPLN 300

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AILGFSE++  E FG L + +Y +Y QDI  SG+HLL++IN++L+ ++++  ++ + +++
Sbjct: 301 AILGFSEIMAAETFGPLNNARYSDYVQDIFKSGKHLLSLINDVLDFTRVDAGELHLHEED 360

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNN 678
            DL   + + IR+I + A+++NI ++ +I ++L    AD R I+++L  +LSN++KFT +
Sbjct: 361 IDLEEAVTDTIRMISAQAKAQNIALDYEIAADLPHLIADHRRIRQVLLNLLSNAVKFTPD 420

Query: 679 NGKMMIRTSKIGQCVIITIADTGIGIPKS----ALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            G++ I        +++ + DTGIGI       ALE+ GQ    L  +Y+    G GLGL
Sbjct: 421 GGEVHIGALVADGAMLLRVTDTGIGIAAENIPLALERFGQIDSDLSRKYE----GTGLGL 476

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            ++  L   HGG L I S+ G+GT VT+  P
Sbjct: 477 PLAKCLMEHHGGCLDIASELGRGTTVTVTFP 507


>gi|154251104|ref|YP_001411928.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155054|gb|ABS62271.1| PAS/PAC sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 661

 Score =  198 bits (503), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 114/268 (42%), Positives = 170/268 (63%), Gaps = 8/268 (2%)

Query: 502 KATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAI 561
           + T   +  +R I ER++ E+ + +A+     ERAETA++TKS FLA MSHELRTPLNAI
Sbjct: 375 RQTAEVIGITRDISERKRHEMELLDAR-----ERAETASRTKSRFLANMSHELRTPLNAI 429

Query: 562 LGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNAD 621
           +GFSE+++ ++FG LG  +Y EYAQ I+ SG  LL++I++IL+MSKIE  K  +  +  D
Sbjct: 430 IGFSEILRMQMFGALGHPRYTEYAQLINESGALLLDLISDILDMSKIEAGKYELHPETVD 489

Query: 622 LIPIINEGIRLIGSSAQSKNIKIEKKIP-SEL--FFNADKRIIKKILFPILSNSIKFTNN 678
              +I   +RL+   A+   I + KKI  +EL     AD+R +K+I+  +LSNS KFT  
Sbjct: 490 AAALIESCVRLVRGRAEENGIHLVKKIQCAELGGTLVADERALKQIMLNLLSNSAKFTPA 549

Query: 679 NGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
            G++ +  ++  + +   +ADTG GIP   + ++GQPFE +      S  G GLGLA+  
Sbjct: 550 GGRISVALTETEETICFAVADTGRGIPADQIARLGQPFEQIATDAALSKEGTGLGLALVR 609

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           +L  LHGG + I S+ G GT VT+ +P+
Sbjct: 610 SLAELHGGSMAIDSELGVGTTVTVTLPK 637


>gi|144899922|emb|CAM76786.1| Signal transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 830

 Score =  197 bits (502), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 157/234 (67%), Gaps = 1/234 (0%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           KE+AE A+++KSEFLA +SHELRTPLNAI+GFSEV+   +FG LG+ +Y EYA DI  SG
Sbjct: 582 KEQAELASRSKSEFLATISHELRTPLNAIIGFSEVMAGSMFGPLGNSRYQEYAGDIVQSG 641

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
           +HLL +IN+IL++SKIE  ++S+D    D+ P+I+  +RL+ + A++ ++++  ++  +L
Sbjct: 642 RHLLAVINDILDVSKIEAGQMSLDFGPVDIPPVIDSAVRLVETRARANSLRLRSEVDKDL 701

Query: 653 -FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEK 711
              + D+R   +IL  +LSN+IKFT   G++ I  S+    + + + DTGIG+ +S ++ 
Sbjct: 702 PIIDGDRRRCLQILVNLLSNAIKFTPEGGQVTIGASRENDGIRLKVQDTGIGMSESEIQV 761

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             +PF  +     +   G GLGL ++ ++  LHGG L + S++G+GT V   +P
Sbjct: 762 ALEPFRQVDGSLSRQYEGTGLGLPLAKSMVELHGGSLVVNSRKGEGTEVAFWLP 815


>gi|302382311|ref|YP_003818134.1| integral membrane sensor signal transduction histidine kinase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302192939|gb|ADL00511.1| integral membrane sensor signal transduction histidine kinase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 580

 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 148/227 (65%), Gaps = 3/227 (1%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA MSHELRTPLNA+LGFS+V+++ +FG L S KY EYA +IH +G HLL++I
Sbjct: 326 NAGKTRFLANMSHELRTPLNAVLGFSDVMRQRLFGPL-SPKYAEYADNIHEAGSHLLDLI 384

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFNADK 658
            ++L++SKIE E+  + ++  D   +++  + L+  +A    + +   +P + L   AD+
Sbjct: 385 GDVLDVSKIEAERYELSREPFDAREVVSAAVALVRGTATDGGVTLASLLPDDPLAVEADR 444

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R +K+I   +LSN+IKFT + G + +    IG  + + +ADTG+GI    L+++G+PFE 
Sbjct: 445 RALKQITLNLLSNAIKFTPSGGSVTLTLETIGPYLEMVVADTGVGIAARDLKRLGRPFE- 503

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              + DQ   G GLGL++  AL  LHGGR+ I S  G+GT VT+ +P
Sbjct: 504 QAGEADQRAKGTGLGLSLVRALAELHGGRMSIESTLGEGTAVTVRLP 550


>gi|46202135|ref|ZP_00053708.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 663

 Score =  196 bits (497), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 130/431 (30%), Positives = 207/431 (48%), Gaps = 62/431 (14%)

Query: 358 MNIIGIAMDLTEKYHLEK-------RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
           +  IG+  D++E+   EK       R +    RL   I+   + + ++  +D L+  N +
Sbjct: 258 LTFIGVIRDISERKRSEKALRDSTTRLSHQANRLQAIIDNMPQGVAVFASDDALIALNES 317

Query: 411 YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDP-----ERSQDMSKEIK------- 458
             +  GLP   + PG     I  +    ++    + P     + + D+S+ I+       
Sbjct: 318 AIRMLGLPKAEITPGT----IDISLFMALLAANDTPPGHHSAQLTADLSESIRERPEMVF 373

Query: 459 ---LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
                    +++       GG I   TDIT  KH +  LRE+K                 
Sbjct: 374 EHFTPSGLIMEVRSSSMPGGGLILSFTDITDRKHIEQTLREAK----------------- 416

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
                             + AE  N+TK+ FLA +SHELRTPLNAI+GFSE++K EIFG 
Sbjct: 417 ------------------DEAERGNRTKNTFLANISHELRTPLNAIIGFSEMMKHEIFGP 458

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           L    Y  Y  DIH SG HLL +IN+IL+MSK E     + +    +  +I   IRL+  
Sbjct: 459 LEPASYRAYVDDIHESGMHLLELINDILDMSKAEAGMTDLMETAVHVPDLIRAAIRLLNR 518

Query: 636 SAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
            A++  I + + +P  L    AD+R +++I+  + SN++KFT++ G + I         +
Sbjct: 519 RAENAAISLTEDLPPNLPTLLADERRLRQIILNLGSNAVKFTDDGGAVTIGAKVTEAGFV 578

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           I +ADTGIG+    ++++ +PF     +  +   G GLGL ++ AL   HGG L + SQ 
Sbjct: 579 IRVADTGIGMTPEDVQRVMEPFVQADTRLSRKYEGSGLGLPLAKALVIAHGGTLNLDSQP 638

Query: 755 GKGTIVTICMP 765
           G+GT+VT+  P
Sbjct: 639 GRGTVVTVTFP 649



 Score = 41.2 bits (95), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 68/154 (44%), Gaps = 12/154 (7%)

Query: 379 EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRP 438
           +A ++L +A+  + + + L+D  +RL+ CN  Y +        + PG AR   +D     
Sbjct: 28  DAQRQLLEALGNSRDGVALYDSANRLITCNDRYLQMLSPIKDSIRPG-AR--FEDLMAEL 84

Query: 439 IIEYRTSDPERSQDMSK---------EIKLADSRWLQINEWCTHDGGTISVGTDITLLKH 489
               +  D   ++ +S          + K  D +W+ +N + T DGG + +  DIT  K 
Sbjct: 85  AEAEKMEDGWLARKLSGGGLTDATAGDDKFRDGQWITVNAYATSDGGQLRILRDITQRKQ 144

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELS 523
            +  L ++   L+  ++ +      ++   T LS
Sbjct: 145 AEIALEDTVSWLRGVMDTVVDGIVTIDETGTVLS 178


>gi|144899595|emb|CAM76459.1| sensory transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 565

 Score =  195 bits (495), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 142/516 (27%), Positives = 246/516 (47%), Gaps = 50/516 (9%)

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVK 326
           GLW++N   K+ +LS  +  I+G   E    +     +++H D++   +   S   +H+K
Sbjct: 71  GLWDWNPITKELYLSARLLAILGFSGETVRTTSHDWLKMVHPDDRVPYQ---STLVQHLK 127

Query: 327 -QLDQI---FHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEAD 381
            Q D     + +R  +G   WI  R   +R  +G    ++G   D+T++   E     ++
Sbjct: 128 GQTDHFECEYRVRGRNGEYRWILSRGLAVRDENGVATRMVGSIGDVTDRKRREAVLRASE 187

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE 441
            R    +E  +  +V+   + R+   N   ++ +GL     + G A S I D+       
Sbjct: 188 ARFRSLVEAAASIIVVVGADGRVREFNREAERMFGLSAAAAI-GRAWSTILDSNRV---- 242

Query: 442 YRTSDPERSQDMSKEIKLADSRWL----------QINEW----CTHDGGTISVGTDITLL 487
               D +R      E++     W            I  W     + D G + VG DIT  
Sbjct: 243 --GQDGDRFDQWLDEVRKG---WQVRDRETVLGQHIISWNLAPLSDDDGIVIVGQDITQR 297

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           +  +  LR++   L+  +   +   +   RQ                 AE AN+ KSEFL
Sbjct: 298 RRAETALRQANDLLEYRVAARTAEAEAACRQ-----------------AEEANRGKSEFL 340

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A MSHELRTPLNAI+GFS+ ++  + G + +  Y EY Q I  SG HLL++IN++L++SK
Sbjct: 341 ANMSHELRTPLNAIIGFSDAMRLGVMGPVENPLYAEYVQAIWESGTHLLSIINDVLDLSK 400

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN-ADKRIIKKILF 666
           +E     +  +   L P+  + IRL+   A    +++  ++  +      D   +K++LF
Sbjct: 401 VEAGHFDLAPERLPLTPLAEQVIRLMAEKAMRHRLELRLQVDGDPGHALVDPLRLKQVLF 460

Query: 667 PILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            +L+N++KFT   G +++   +      I +AD+GIG+    ++++ +PF  + +   + 
Sbjct: 461 NLLANAVKFTPAGGHVILSLGRDDGGSWIKVADSGIGMRPEDIDRVLEPFVQIDSHLSRR 520

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
             G GLGL ++     LHGG L + SQ G+GT+VTI
Sbjct: 521 NMGTGLGLPLAKRFIELHGGTLALASQPGQGTVVTI 556


>gi|294495114|ref|YP_003541607.1| PAS/PAC sensor signal transduction histidine kinase
            [Methanohalophilus mahii DSM 5219]
 gi|292666113|gb|ADE35962.1| PAS/PAC sensor signal transduction histidine kinase
            [Methanohalophilus mahii DSM 5219]
          Length = 1034

 Score =  195 bits (495), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 132/414 (31%), Positives = 219/414 (52%), Gaps = 43/414 (10%)

Query: 360  IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
            I+G + D+T +   E    ++ Q+    +E  +E +   D+N  +     N +   G   
Sbjct: 650  IVGSSQDITGRIKAENELRQSKQKYQSLVENLNEIVYTLDQNATVTYVTPNIENISGYKP 709

Query: 420  HVLVPGNARSIIQDAQTRPIIE-YRT-----SDPERSQDMSKEIKLADSRWLQIN-EWCT 472
              ++  N    +     R  +E +R       +P   + ++K     D+ W++ N +   
Sbjct: 710  EEVIGKNFVEFVHPDDIRGRMEQFRKVLSGIDEPSEYRFLTKS---GDTVWVRTNAKPII 766

Query: 473  HDGGTISVG---TDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKY 529
             D   + +     DIT +K  + QL ++  R                    E++I     
Sbjct: 767  KDDKIVGIQGLLMDITDVKKAEKQLEDAVLR------------------ANEMAI----- 803

Query: 530  QVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIH 589
                 +AE ANKTKS+FLA MSHELRTPLN+++GFS+++ KEI GEL   +  +Y  +I 
Sbjct: 804  -----QAEYANKTKSQFLANMSHELRTPLNSVIGFSDILLKEIKGELNDSQK-KYISNIS 857

Query: 590  YSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP 649
              G+HLL++IN+IL++SKIE  K+ +  ++ +L  + +E   +I   AQ K+I +E   P
Sbjct: 858  NGGRHLLDLINDILDLSKIEAGKMELACEDLNLDSVFSEIESVISPQAQKKSIDLEISKP 917

Query: 650  SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIGIPKSA 708
            +++  NADK  IK+I+F +LSN+IKFT+ NGK+ +   ++ +  V IT+ DTGIGIP+  
Sbjct: 918  ADIEINADKSKIKQIIFNLLSNAIKFTDENGKVSMSAGEVDRDQVEITVKDTGIGIPEDK 977

Query: 709  LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
            L+KI  PF    +   +  GG GLGL +      +HGG + + S+ GKG++ T+
Sbjct: 978  LDKIFDPFMQADSSTSRKYGGTGLGLPLVKEYVEMHGGEILVESEVGKGSVFTL 1031


>gi|163793573|ref|ZP_02187548.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159181375|gb|EDP65890.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 950

 Score =  194 bits (494), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 145/457 (31%), Positives = 221/457 (48%), Gaps = 63/457 (13%)

Query: 330 QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
           QI       G+ + + +   +  T + G+  + +  D++ +   E    +A +RL  A+E
Sbjct: 528 QIIAAATDQGSGVQVPIELTVAETAASGLTFVIVLRDISARIGAEAAARQAVERLRDAVE 587

Query: 390 CTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD-------AQTRPIIEY 442
             ++   L+  + RLV+CNA +    G       PG    +I +       A    +   
Sbjct: 588 RITDGFALFGPDRRLVICNARFVDMLGEAGSTARPGGRYDVIMECYAETSRAPVSAVGRG 647

Query: 443 RTSDPERSQDMSKEIKLA-----DSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRES 497
           R    ER+  +++  + A     D RW +I+E  T +GG + V TDIT LKH        
Sbjct: 648 RDWVAERTAALAETSEPAVRECLDGRWFRIDERPTAEGGLVCVYTDITELKHR------- 700

Query: 498 KRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
                                  E+ I  A        AE+A+  KSEFLA MSHELRTP
Sbjct: 701 -----------------------EMEITQAMIS-----AESASSAKSEFLANMSHELRTP 732

Query: 558 LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
           LNA++GF++++K+E+FG LG   Y EY +DI  SG  LL+MI  IL+ S+ E    S   
Sbjct: 733 LNAVIGFADLMKQELFGPLGHDHYREYVEDIIGSGSKLLSMIEVILDFSRSEQVGQSDSD 792

Query: 618 QNADLIPIINEGIRLIGSSAQSKNIKI----EKKIPSELFFNADKRIIKKILFPILSNSI 673
               L  ++   +R +   A  KNI +    ++ +P     N D  I+ +IL  +LSN+I
Sbjct: 793 ARCALNDVVGAVVRDLSPIALQKNIDVSVDRDETLPP---LNVDGAILYQILQNLLSNAI 849

Query: 674 KFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPF----EPLHNQYDQSIG 728
           KF+N    + +RT +       +++ D G+GIP   ++K+ QPF     PL   +D    
Sbjct: 850 KFSNPGAPIGLRTFRAADGSAGMSVTDHGVGIPDELIDKVTQPFWQRQGPLVRDHD---- 905

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G GLGLAI  + T+  GG LK  SQ G+GT VTI +P
Sbjct: 906 GVGLGLAIVKSHTDALGGELKFDSQVGRGTTVTILLP 942


>gi|239787541|emb|CAX84010.1| Sensor protein [uncultured bacterium]
          Length = 834

 Score =  193 bits (491), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 152/517 (29%), Positives = 258/517 (49%), Gaps = 59/517 (11%)

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIH-------YDNKKICEIA 317
           R  LWN N+ +    L R++ ++ G+P+E+   +F A             +  K++ +  
Sbjct: 355 RVILWNANYLDFYPEL-RTVLDV-GVPFEDLVRAFAATGAPADAATDPEAWIRKRLIQHR 412

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRY 377
            +    HV++L          G   W+ V     RT  GG  I+ +  D+TE+   EK  
Sbjct: 413 LADGNPHVQRL----------GDGRWLLVSEN--RTSEGG--IVSVRTDITERMQAEKAL 458

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ--DAQ 435
             +++R   A+E     +  W+     +      +   G  D   VP    + ++   A+
Sbjct: 459 RRSEERYELAVEAGKVGVWDWNIKTGEMYIAPKLKAMLGYED-TEVPNRFEAWMELVHAE 517

Query: 436 TRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
            RP ++  T+     +    E+     R+ ++++    +G +        + +  Q +  
Sbjct: 518 DRPHVKAATAAHLEGRTERHEV-----RYRRVHK----NGSSYWFKASGVVQRDTQGR-- 566

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
               R+  T  D      I++   TE ++  AK     + AE AN+ K+EFLA MSHELR
Sbjct: 567 --PERMAGTDAD------IIDHVLTEAALRAAK-----DNAEVANRAKTEFLANMSHELR 613

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TPLN+I+GFS+++  + FG +G  +Y EYA+DI+ +G HLL++IN+IL++S+IE E +S+
Sbjct: 614 TPLNSIIGFSDILVNQSFGPMGVPEYVEYARDINSAGSHLLSLINDILDVSRIEVEALSL 673

Query: 616 DKQNADLIPIINEGIRLIGSSAQSKNIKI----EKKIPSELFFNADKRIIKKILFPILSN 671
           ++Q  D   + N   RL+   A+   + +     K+ P+ L+  AD+R +K++L  +L+N
Sbjct: 674 NEQRIDAAHMANSCQRLVLDRAKRAKLNLVLDMPKQFPAALY--ADERRVKQVLLNLLAN 731

Query: 672 SIKFTNNNGKMMIRT--SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SIKFT   G + ++    + G+ V   +ADTGIGI    +E     F  + + + +   G
Sbjct: 732 SIKFTEPGGTVTLKGMLDEEGRFV-FAVADTGIGIAPEDIEAAMSTFGQVDSSFTRRYEG 790

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            GLGL +S  L  LHGG L + SQ G GT VTI  P+
Sbjct: 791 AGLGLPLSKKLVELHGGGLSLESQPGVGTTVTIRFPK 827



 Score = 71.2 bits (173), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 89/194 (45%), Gaps = 20/194 (10%)

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLT-----EKYHLEKR--YAEADQR 383
           FH R   G+  W+      +R   G + + + I  D++     E+   E R   A A +R
Sbjct: 276 FHNRRKDGSLYWVSASISPVRNAEGAITHFLAIEDDISGQKRSEELLREARDWAAGAQER 335

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQDAQTRPIIEY 442
           L+ AIE  SEA +L D +DR+++ NANY   Y     VL  G     +++          
Sbjct: 336 LTDAIESISEAFILCDADDRVILWNANYLDFYPELRTVLDVGVPFEDLVRAFAATGAPAD 395

Query: 443 RTSDPE----------RSQDMSKEI-KLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ 491
             +DPE          R  D +  + +L D RWL ++E  T +GG +SV TDIT     +
Sbjct: 396 AATDPEAWIRKRLIQHRLADGNPHVQRLGDGRWLLVSENRTSEGGIVSVRTDITERMQAE 455

Query: 492 AQLRESKRRLKATI 505
             LR S+ R +  +
Sbjct: 456 KALRRSEERYELAV 469


>gi|154252152|ref|YP_001412976.1| multi-sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154156102|gb|ABS63319.1| multi-sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 798

 Score =  192 bits (488), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 164/256 (64%), Gaps = 13/256 (5%)

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           +ER++ E  +  A      E AE AN+ K++FLA MSHELRTPLNAI+GFSE++ +E+FG
Sbjct: 535 IERRRAEEGLRQAT-----ETAEMANRAKTKFLANMSHELRTPLNAIIGFSEIMSQEMFG 589

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            LGS +Y EY  DIH SG+HLLN+I++IL++SKIE  +  +++   D+  ++   + ++ 
Sbjct: 590 PLGSDRYREYTNDIHGSGRHLLNVIDDILDISKIEAGRYVLEEDEIDMAHVLKWSVEMMR 649

Query: 635 SSA----QSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK-I 689
           +      Q+ N+ + + IP+     AD+R +++I+  +LSN+ KFT   G++ +  S+  
Sbjct: 650 ARTLEKRQNVNLHLPEAIPN---VRADQRAMRQIMLNLLSNASKFTPAEGRIDLNVSRND 706

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              +++++AD+GIGIP++ L+++ +PF  + +   +  GG GLGL I+ +L  +HGG   
Sbjct: 707 AGDLMVSVADSGIGIPRNKLDEVLEPFGQVDDTSARQHGGTGLGLPITKSLIEMHGGSFT 766

Query: 750 IISQEGKGTIVTICMP 765
           + S  G GT  T+  P
Sbjct: 767 LESTLGAGTTATMIFP 782


>gi|163792987|ref|ZP_02186963.1| sensor/response regulator hybrid [alpha proteobacterium BAL199]
 gi|159181633|gb|EDP66145.1| sensor/response regulator hybrid [alpha proteobacterium BAL199]
          Length = 528

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 174/296 (58%), Gaps = 15/296 (5%)

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN-------AKYQVE 532
           +G  IT   H   Q+    R L      L    ++++ + T+L  AN       A  Q  
Sbjct: 216 LGDLITGFNHMLEQIETQHRELMVYREQL---ERLVDDRTTQLQDANVRLHQTVADLQES 272

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K   E+AN+ KSEFLA MSHELRTPLNAI+GFS+++  ++FG+LG  +Y +YA+DIHYS 
Sbjct: 273 KSELESANRFKSEFLANMSHELRTPLNAIIGFSDIMVNQLFGKLGDARYEDYAKDIHYSA 332

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK---IP 649
            HL+ +I +IL+ ++IE  K+ + +    +  ++ + +R+I  S  ++ IK+E++   +P
Sbjct: 333 NHLIEIIGDILDTTRIEFGKLELQEATVSVDGLLEDALRIISPSIHAQRIKLEQQALPLP 392

Query: 650 SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSAL 709
                  D   +++IL  +LSN++KFT+  G + I   KI   + ITI DTGIGI ++ L
Sbjct: 393 GPK-LRCDPIRVRQILINLLSNAVKFTDPGGAISIGV-KIRDGIEITITDTGIGIDEADL 450

Query: 710 EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           E++  PF  + + + +   G GLGL++S  L   H G+L + S+ G+GT VTI  P
Sbjct: 451 ERVVTPFAQVEHAFARKYQGTGLGLSLSKTLMECHQGKLTLSSRLGEGTAVTIYFP 506


>gi|300023375|ref|YP_003755986.1| integral membrane sensor signal transduction histidine kinase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525196|gb|ADJ23665.1| integral membrane sensor signal transduction histidine kinase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 553

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 153/251 (60%), Gaps = 6/251 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +EL  A+A     + RAE ANK KS FLA MSHELRTPLNAI+GFSEV++KEI G +GS 
Sbjct: 256 SELEEASAISDEARRRAEAANKAKSRFLATMSHELRTPLNAIMGFSEVMEKEILGPIGSD 315

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA +I+ SG HLL +IN IL++S+IE  +  + ++   L  I  +  RLI   A +
Sbjct: 316 TYREYAHNIYESGNHLLCIINEILDLSRIEAGRYDLHEETVRLTDIAEDCRRLIKIKADA 375

Query: 640 KNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI---RTSKIGQCVII 695
           K + I E   P      AD R +++I   +LSN++KFT   G+++I    TS  GQ   +
Sbjct: 376 KTLHIVEDFAPDLPHVWADPRAMRQICLNLLSNALKFTPRGGRIVITVGHTSDGGQ--FV 433

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           TI+DTG GIPK  + ++ Q F      +  + GG GLGL I   L +LHGG   + S+  
Sbjct: 434 TISDTGPGIPKDEIPRVLQAFGQGSLAHQTAEGGTGLGLPIVQNLISLHGGTFDLQSELR 493

Query: 756 KGTIVTICMPQ 766
           KGT VT+ +P+
Sbjct: 494 KGTEVTVTLPR 504


>gi|83309766|ref|YP_420030.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82944607|dbj|BAE49471.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 586

 Score =  192 bits (487), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 164/276 (59%), Gaps = 10/276 (3%)

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKER--------AETANKTKSEFLAKMS 551
           R+  +I D+ T R   +R   E +    +  VE+ R        AE AN+ KSEFLA MS
Sbjct: 311 RMVGSIGDV-TERHAYQRALQEANEQLEQRVVERTRELDLARCQAEEANRCKSEFLANMS 369

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAI+GFS+V++  +FG +G+ +Y EY   I  SG HLL +IN+IL+++K+E  
Sbjct: 370 HELRTPLNAIIGFSDVMRSGVFGPVGNARYGEYIGWIWDSGHHLLRIINDILDLAKVEVG 429

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILS 670
           +  + +++  ++P++   IRL+   A    + +  K  P       D   +K++L  +LS
Sbjct: 430 RFDLSRESTPVLPLLESAIRLVSERATRAEVNVGCKAEPGLGDAMLDPLRMKQVLLNLLS 489

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT   G + +     G  +++ +ADTGIG+ + +LEK  QPF  + +   +   G 
Sbjct: 490 NAVKFTPAGGSVSLEARHEGTDLVLIVADTGIGMDEESLEKALQPFVQVESSLSRRYAGT 549

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           GLGL ++ + + LHGG L ++S+ G+GT VT+ +P+
Sbjct: 550 GLGLPLAKSFSELHGGSLDLVSRPGEGTTVTVRIPR 585


>gi|115523225|ref|YP_780136.1| multi-sensor hybrid histidine kinase [Rhodopseudomonas palustris
           BisA53]
 gi|115517172|gb|ABJ05156.1| multi-sensor hybrid histidine kinase [Rhodopseudomonas palustris
           BisA53]
          Length = 1039

 Score =  191 bits (485), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 164/590 (27%), Positives = 278/590 (47%), Gaps = 61/590 (10%)

Query: 207 LLRLWREEVTLEVVFFSIISAL--LLFILFSYYRQAKKNKENDTILLEANICVETALSR- 263
           +L  WR + T+E   F  + A+  +L +L    RQ  K + +  +L   N     A SR 
Sbjct: 297 VLASWRGDATIEA--FGALGAVAGVLLLLSVLTRQIGKGRRSALLLARQN--ARFARSRQ 352

Query: 264 --------GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI-- 313
                   G+ G W  N        S  ++EI G+      +S      LIH ++ ++  
Sbjct: 353 MLLDAQRIGKLGHWMTNAAGDSAVWSPQLFEIAGL-APRPGVSLDQFLALIHPEDLQVFL 411

Query: 314 --CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG-MNIIGIAMDLTEK 370
              E++RS   K + +L  +       GA  WI++ A   R  +G  + + GI  D+TE+
Sbjct: 412 HELELSRSGDTKLIHELRWV----RPDGAIRWIRMEADRRRDANGDPVGVFGIVQDITER 467

Query: 371 YHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARS 429
              E     +   L  AIE  S+  VL+DK+DR V+ N+++++ +      + PG     
Sbjct: 468 KRAEAAAEASRHLLVDAIESMSQGFVLYDKHDRFVLANSHFKEMFPELADRMKPGMRYED 527

Query: 430 IIQDAQTRPIIEY------------RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
           ++       +++             RT+   R+ +   E +  + RW+++ +  T DGG 
Sbjct: 528 VLCAVHQSDLVDAPKAGASFDEWLARTTAWHRAANRPIERRYDNGRWIRLVDHRTSDGGI 587

Query: 478 ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
             + TDIT  K  +A L +        + DL  +R  LE QK EL   +A  ++ KE AE
Sbjct: 588 AGLRTDITDFKTIEAALEQK-------VADLELARNNLESQKQELVAKSADLELAKETAE 640

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            A++ KS+FLA MSHE+RTP++ ++G  +++++       + +   YA+    S   LL 
Sbjct: 641 AASRAKSDFLAIMSHEIRTPMSGMVGMIDLLRETPL----TAEQKGYAEIAKESVNSLLG 696

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFN 655
           + N+IL+ SK+E  ++  +  + D+   I   I L+ + AQ+K + I   +   L  +  
Sbjct: 697 VTNDILDFSKLEAGELKAEAIDFDIEHTIGGAISLMKAKAQAKQLDIRTVLTPGLPKWLV 756

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-------KIGQCVIITIADTGIGIPKSA 708
            D   I++IL  +++N+IKFT   G + ++ S       KI   + I I DTGIGIP   
Sbjct: 757 GDPSRIRQILLNLINNAIKFT-EQGAISVKASYHSLDDDKIE--LRIEIVDTGIGIPMEV 813

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
            +++  PF        +  GG GLGLAI   L  + GG + + S    G+
Sbjct: 814 QQRLFNPFVQADTSISRKYGGTGLGLAICKQLALMMGGEIGVRSGPEPGS 863


>gi|206889876|ref|YP_002248033.1| two component system histidine kinase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741814|gb|ACI20871.1| two component system histidine kinase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 618

 Score =  191 bits (485), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 117/294 (39%), Positives = 169/294 (57%), Gaps = 14/294 (4%)

Query: 474 DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEK 533
           D GT  + T I  ++     L ES  RLK     L    Q ++ +  EL IA       K
Sbjct: 330 DIGT-PIDTRIIEMESLNDALIESANRLKELYQSL---EQKVKERTAELEIA-------K 378

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
             AE AN+ KSEFLA MSHELRTPLN+I+GF+EV++ ++FG L   K  EY +DIH S +
Sbjct: 379 IHAEAANRAKSEFLANMSHELRTPLNSIIGFTEVLQDQLFGTLNE-KQLEYLKDIHDSAK 437

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-- 651
           HLLN+IN+IL++SKIE  K  ++     +  ++N  + +    A    IK++ +I  E  
Sbjct: 438 HLLNLINDILDLSKIEEGKTELELSEFRVSDVVNVSLIMFKEKASKHGIKLDAEISKEAD 497

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEK 711
           +   AD+R IK++LF ++SN++KFT + G + I   +    + I + DTGIGI K   +K
Sbjct: 498 ITVTADERKIKQVLFNLVSNAVKFTPDGGSVKITAERKEDMIEIVVEDTGIGIKKEDRDK 557

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + QPF  L   Y +   G GLGLA+S +L  LHGG++   S+ GKG+      P
Sbjct: 558 LFQPFSQLETTYTKKYQGTGLGLALSKSLVELHGGKIWCESEYGKGSRFGFSFP 611


>gi|83311645|ref|YP_421909.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82946486|dbj|BAE51350.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 847

 Score =  191 bits (485), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 173/299 (57%), Gaps = 17/299 (5%)

Query: 476 GTISV-GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ---KTELS---IANAK 528
           G ++V G+DIT         R +  RL   +N+ S  R++ +R    K E++    A  +
Sbjct: 543 GVVNVYGSDITG--------RIAAERLLHMVNE-SLERRVHQRTEALKAEIAEHIRAERE 593

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
               KE+A+ AN+ K+EFLA +SHELRTPLNA++GFSEV+  E+FG LGS +Y  Y  DI
Sbjct: 594 LVAAKEQADLANRAKTEFLANVSHELRTPLNAVIGFSEVMAAEMFGPLGSARYVGYVNDI 653

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
             SG+HLL +IN+IL+++KIE  ++  D +      ++   IR++ S A +  + +   I
Sbjct: 654 LASGRHLLAVINDILDIAKIEAGQMEFDMELVQPAEVVAAAIRIVESRADAGGLVLGSHI 713

Query: 649 PSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
             ++    AD+R + +IL  +LSNS+KFT   G + +    +G  V  T++DTGIG+   
Sbjct: 714 AEDVPALKADRRRLLQILVNLLSNSVKFTPEGGSVEVTVEVLGDMVGFTVSDTGIGMSDD 773

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            +     PF  +     +   G GLGL +  A   LHGG L I+S++G+GT VT+ +PQ
Sbjct: 774 EVVVAMLPFRQVDGSLSRRYDGTGLGLPLVRAFVELHGGHLDIVSRKGEGTQVTVRLPQ 832


>gi|114569450|ref|YP_756130.1| periplasmic sensor signal transduction histidine kinase [Maricaulis
           maris MCS10]
 gi|114339912|gb|ABI65192.1| periplasmic sensor signal transduction histidine kinase [Maricaulis
           maris MCS10]
          Length = 562

 Score =  191 bits (484), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 151/235 (64%), Gaps = 2/235 (0%)

Query: 532 EKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYS 591
           ++E AE   + KS+FLA +SHELRTPLNAI+GFS+V+K  +FG L   +Y EYA  IH S
Sbjct: 290 DREAAEEDARAKSQFLASVSHELRTPLNAIIGFSDVMKARLFGPL-PARYAEYADLIHES 348

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE-KKIPS 650
           GQHL+ +I ++L+MSKIE ++  + ++  D+  ++N   +++   A+   I ++ K+   
Sbjct: 349 GQHLMELIGDVLDMSKIEADRYELVRETFDIGEVVNLSAKMMRLQAEEAGINLKIKRHDG 408

Query: 651 ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
            L  + D++ +++IL  +LSN++KFT   G +++     G  +++ + D+G+GI      
Sbjct: 409 PLLVDGDRKALRQILLNLLSNAVKFTPKGGAIVVMARASGGQLVMAVGDSGVGIDPEETA 468

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++GQP++   N  D    G GLGL++  AL+ LHGG + I S++G+GT VTI +P
Sbjct: 469 RLGQPYQQAANARDIEKRGTGLGLSLVRALSELHGGSMNIASRKGEGTTVTISLP 523


>gi|154251392|ref|YP_001412216.1| multi-sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
 gi|154155342|gb|ABS62559.1| multi-sensor signal transduction histidine kinase [Parvibaculum
           lavamentivorans DS-1]
          Length = 617

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 149/234 (63%), Gaps = 1/234 (0%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           +++A  A+++KSEFLA MSHELRTPLNAI+GFSE +++E+FG +G+ +Y EYA+DIH SG
Sbjct: 369 RDQATAASRSKSEFLANMSHELRTPLNAIIGFSEALERELFGPVGNPRYREYAEDIHDSG 428

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SE 651
            HLL++IN+IL++SKIE     + +   DL  I+    R++   AQ  NI IE ++P   
Sbjct: 429 VHLLSLINDILDLSKIEAGHFKLHEDETDLDHIVAAATRIVRHRAQQANIAIECRLPQPP 488

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEK 711
           L    D+R +K++L  ++SN++KF+ +   +++  +   Q + I++AD G+GI    + +
Sbjct: 489 LAVLVDERALKQVLINLVSNAVKFSPDGSLILVEANVTTQGLRISVADKGVGIAPEDIPR 548

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              PF  L     ++  G GLGL ++  LT LH G+L I S    GT V + +P
Sbjct: 549 ALTPFTQLDGSLSRAHEGTGLGLPLAKHLTELHDGKLFIESAVDVGTTVYVDLP 602


>gi|110633906|ref|YP_674114.1| periplasmic sensor signal transduction histidine kinase
           [Mesorhizobium sp. BNC1]
 gi|110284890|gb|ABG62949.1| periplasmic sensor signal transduction histidine kinase
           [Chelativorans sp. BNC1]
          Length = 505

 Score =  189 bits (479), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 156/251 (62%), Gaps = 6/251 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL  A A     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+ KE+ G + +V
Sbjct: 237 AELETAKAVSDEARHRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMAKEVLGPVQNV 296

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA+D+H SGQHLL +IN IL++S+IE  +  ++++   L  I++E  R++    ++
Sbjct: 297 TYREYAKDVHQSGQHLLELINEILDLSRIEAGRYQLNEEPLALADIVHECCRMMDLKLKA 356

Query: 640 KNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           K+IK+ ++  PS L   AD+R +++I   +LSN++KFT + G++ +R   TS  GQ   I
Sbjct: 357 KDIKLVQQFEPSLLNLMADERAVRQISLNLLSNAVKFTPSGGEIRVRVGWTSGGGQ--YI 414

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D G GI +  +  +   F         +  G GLGL I   LT+LHGG L++ S+  
Sbjct: 415 SICDNGPGISEEEMPLVLSAFGQGSVAIKSAEQGTGLGLPIVQGLTHLHGGLLRLKSKLR 474

Query: 756 KGTIVTICMPQ 766
           +GT+ T+  P+
Sbjct: 475 EGTVATVIFPR 485


>gi|325292298|ref|YP_004278162.1| two component sensor sensor histidine kinase [Agrobacterium sp.
           H13-3]
 gi|325060151|gb|ADY63842.1| two component sensor sensor histidine kinase [Agrobacterium sp.
           H13-3]
          Length = 514

 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 165/284 (58%), Gaps = 3/284 (1%)

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILER--QKTELSIANAKYQVEKERAETANKT 542
           T  K  QAQ   ++  + A  N     R+++ +    TE+ +       +   AE+AN  
Sbjct: 183 TGAKSRQAQFIHARMEMTAIRNAAGRLRRVVAQLSDVTEMELLRRDVARKAAEAESANDA 242

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA +SHELRTPLNA+LGFS+++  E FG L + +  EY   I  SG HLL+++N +
Sbjct: 243 KSRFLAAVSHELRTPLNAVLGFSDILAGEYFGRLENDRQREYVGLIRQSGAHLLSVVNTM 302

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRII 661
           L+MSK+E  +  +  ++  +   I+    ++G  A+ K + +  +I   +   +AD+R I
Sbjct: 303 LDMSKLEAGRYELMMESFPIGETISSCEAMLGLQAKEKGLTLTSRIQRGIGEISADQRAI 362

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           +++L  +  N+IKFT+  G + I  ++ G+ + +T++DTGIGI    +E +GQPF  + N
Sbjct: 363 RQVLINLAGNAIKFTDAGGVVSIDAAREGRMLKLTVSDTGIGIASDKIELLGQPFMQVQN 422

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +Y +   G GLGL++   L  LHGG   I SQ G GT+VTI +P
Sbjct: 423 EYTRRYEGTGLGLSLVKGLVALHGGTFAITSQPGAGTVVTIMLP 466


>gi|218459504|ref|ZP_03499595.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli Kim 5]
          Length = 266

 Score =  188 bits (477), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 154/265 (58%), Gaps = 2/265 (0%)

Query: 50  QTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQ 109
           + IP + + FL  +A S    + + Y++ E      + +       +F +    FD    
Sbjct: 3   RAIPALIIAFLTVVAASHFFGMMSEYSRLEASARHATALSAATASAVFADTADIFDSGDI 62

Query: 110 KKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRS 169
            +A++ L + L + R  + +F+LL Q +  VFA++T    ++G  +G+  PE+S  R   
Sbjct: 63  AQAQARLSRYLPQDRLDNGAFVLLVQASGKVFAATTAGLSHVGSNVGDFFPEVSAIRRFG 122

Query: 170 KTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVP-LLRLWREEVTLEVVFFSIISAL 228
               + E ++   P H   + L  N+G  ++  + +  + RLWREE+ L V  F+ IS++
Sbjct: 123 DRAGVIETTIGGVP-HYAEITLMGNAGGFVVAATSLEEVGRLWREELALNVTLFAGISSI 181

Query: 229 LLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIM 288
           LL IL++YY Q K+ ++ D I LE+N+ VETALSRGRCGLW+F+F+N++F  SRSMY+++
Sbjct: 182 LLVILYAYYTQVKRARDADDIFLESNLRVETALSRGRCGLWDFDFENREFFWSRSMYDML 241

Query: 289 GIPYENKTLSFRAIARLIHYDNKKI 313
           G+P  +KT+ F   ARL+H D+  +
Sbjct: 242 GLPGSDKTMGFGEAARLMHPDDGGL 266


>gi|46201797|ref|ZP_00208250.1| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 641

 Score =  186 bits (471), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/232 (41%), Positives = 146/232 (62%), Gaps = 3/232 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           A+ AN+TK++FLA MSHELRTPLNAILGFSE+I +E+FG +G  +Y  Y QDI+ +GQHL
Sbjct: 405 AQAANRTKTDFLAAMSHELRTPLNAILGFSEIISREMFGPVGE-RYRTYGQDINAAGQHL 463

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FF 654
           L MIN+IL++S+IE    ++  +  D   +    +RL+GS A++ N+ + + +P  L   
Sbjct: 464 LAMINDILDISRIEIGAFTLCIEPVDPHELAYSCLRLVGSRAEAGNVDLSEDMPESLPHL 523

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRT-SKIGQCVIITIADTGIGIPKSALEKIG 713
             D R  K+IL  +L N++KFT   GK+ +R  ++    +   + DTGIG+ ++ +    
Sbjct: 524 MIDSRRTKQILINLLGNAVKFTPPGGKVTLRGETRDSGGIAFHVIDTGIGMSEADMAVAL 583

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            PF  +    D+   G GLGL ++ +L  LHGG L+I S  GKGT V++  P
Sbjct: 584 SPFGQVDTGLDRRFEGAGLGLPLAKSLAELHGGSLEITSIPGKGTTVSVYFP 635


>gi|46202456|ref|ZP_00053185.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
            magnetotacticum MS-1]
          Length = 1136

 Score =  186 bits (471), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 177/317 (55%), Gaps = 26/317 (8%)

Query: 455  KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
            +EI  A+ R  ++  +   D    + G  +T +  ++  LR +++ L+A+I+ L +++  
Sbjct: 828  EEIIDAEGRIYRMGIFPYRDLREQTAGAILTFI--DETDLRNTQKDLEASIDSLRSTQGE 885

Query: 515  LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
            L+  K                AE+AN+ KSEFLA MSHELRTPLNA+LGF++++  E++G
Sbjct: 886  LKEAKN--------------IAESANRAKSEFLANMSHELRTPLNAVLGFAQIMADEMWG 931

Query: 575  ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
             LG+ +Y EY   I  SGQHLL +I  +L+MS IE  + ++ + N ++  +I   +RL+ 
Sbjct: 932  SLGNDRYKEYIGIIVNSGQHLLALIGQVLDMSVIEAGRTTLRESNVNISDVIVTSMRLLS 991

Query: 635  SSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCV 693
            S A++  I +   +P +L     D   I++IL  +L N++KFT   G + +  S     V
Sbjct: 992  SQAENSEINLTASVPDDLPHMRGDLTAIQRILLNLLGNALKFTPAGGAVTLTASHDQSGV 1051

Query: 694  IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI-----GGFGLGLAISDALTNLHGGRL 748
             I + DTGIGI    L+++  PFE    Q  Q I      G GLGL I+ +L  LHGG L
Sbjct: 1052 TICVRDTGIGISAHDLDRVLMPFE----QGGQRILRKEREGVGLGLPITKSLMELHGGTL 1107

Query: 749  KIISQEGKGTIVTICMP 765
             I S+EGKGT   +  P
Sbjct: 1108 SIDSKEGKGTTACVHFP 1124


>gi|322421480|ref|YP_004200703.1| multi-sensor signal transduction histidine kinase [Geobacter sp.
           M18]
 gi|320127867|gb|ADW15427.1| multi-sensor signal transduction histidine kinase [Geobacter sp.
           M18]
          Length = 580

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 208/404 (51%), Gaps = 35/404 (8%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND-RLVMCNANYQKAYGL-PDHVLV 423
           ++ E+   E+   E++QR     E  S+ L+     D +  MCN    +  G   D +L 
Sbjct: 205 EINERRQAEECLKESEQRFRTIFESNSDGLIAIRIEDHKFYMCNRAICRMLGYREDELLR 264

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTD 483
              A    +D   R I  +        +++  EI +A+   +Q       DG       +
Sbjct: 265 LSIADIHPEDKLPRAIRLF-------ERELQGEISVAEELPVQ-----RKDGSVFYADVN 312

Query: 484 ITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           I+ +      +   K  L     D++  R++ E +   L+            AE A +TK
Sbjct: 313 ISPI------ILYGKPHLIGAFRDVTERRKLRESEIARLA------------AEEACRTK 354

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S+FLA MSHELRTPLN+++GFSEV++ E++G +   K  EY  +IH SG+HLL++IN+IL
Sbjct: 355 SDFLANMSHELRTPLNSVIGFSEVLQDELYGPMNE-KQREYVNNIHISGRHLLSLINDIL 413

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRII 661
           ++SK+E+ K+ ++     L  ++ + + +    A    + I  +   E   N  AD+R +
Sbjct: 414 DLSKVESGKMELELSAFSLRDMLGDSLAMFKEKALRSAVGIHLEFDPEADANIMADQRKL 473

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           K+I+F +LSN+IKFT   G + +   ++   V I +ADTGIGI    + K+ +PF  L +
Sbjct: 474 KQIMFNLLSNAIKFTPAGGTLQVSARRMPDFVEIAVADTGIGIKAQDIPKLFKPFTQLGS 533

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGLA+S  L  LHGGR+++ S+ G G+  +  +P
Sbjct: 534 VYTKGFEGTGLGLALSKRLVELHGGRIRVKSKFGTGSRFSFTIP 577


>gi|83594543|ref|YP_428295.1| PAS/PAC sensor Signal transduction histidine kinase [Rhodospirillum
           rubrum ATCC 11170]
 gi|83577457|gb|ABC24008.1| PAS/PAC sensor signal transduction histidine kinase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 778

 Score =  185 bits (470), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 208/423 (49%), Gaps = 58/423 (13%)

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL---- 417
           G+  D++ +   +++  E ++R + AI  T EA+V WD +   +  +       GL    
Sbjct: 389 GLVRDISARKEADRQLRENEERYALAIAGTHEAIVDWDIDSDTITYSDRITAIVGLDPKD 448

Query: 418 ------------PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWL 465
                       PDH           +D  TR     R      S   S + +LA  R  
Sbjct: 449 LDRSASWIALIHPDHR----------KDYLTRMDALLRGE----SSFFSCDFRLA-GRAG 493

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
               W  H           T L+    Q+     RL   + D++ SR+  +R +      
Sbjct: 494 AEERWLRHRA---------TALRRPDGQIY----RLSGAVGDITDSRRGEDRLREA---- 536

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
                  KE AE AN+ KSEFL  MSHELRTPLNAI+GFSEV+  E+FG LG+ +Y +YA
Sbjct: 537 -------KEAAEFANRAKSEFLTNMSHELRTPLNAIIGFSEVLHSEMFGPLGATQYLDYA 589

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
             I  SG+HLL++IN+IL++S+IE  + ++  +  D   I+    RL+   A++  ++++
Sbjct: 590 ASIRDSGRHLLDVINDILDVSRIEAGRATLFPEPLDFAEIVASVHRLVNQRAEAAGVRLK 649

Query: 646 KKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI--RTSKIGQCVIITIADTGI 702
             + P+      + R +K++L  +L N+IKFT   G++ +  R  +    ++I ++D+GI
Sbjct: 650 ITLDPALPPLLGEARRLKQVLINLLGNAIKFTPAGGEIALSARGDEDKGQMVIEVSDSGI 709

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           G+    +    +PF  +  Q  +   G GLGL +S A   LHGG L++ S  G GT +T+
Sbjct: 710 GMAPEDIPLALEPFRQIDGQLARRYEGTGLGLPLSKAFVELHGGTLRVDSTPGAGTRITV 769

Query: 763 CMP 765
            +P
Sbjct: 770 RLP 772



 Score = 39.7 bits (91), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 28/150 (18%)

Query: 375 KRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANY------------QKAYG-----L 417
           +R  EA+ RL +A+E   +   L D +D +V+ NA                 YG      
Sbjct: 147 RRIREAESRLERALESIDQGFYLCDASDTVVLRNAKLAHLLPGLPPLEPGTTYGAMMAAA 206

Query: 418 PDHVLVPGNARSIIQDAQTR--PIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDG 475
            D+  +P   R      +TR   +   R   P  + D          RW++++E  T +G
Sbjct: 207 CDNGAIPAATRH-----RTRWLSLCMARHHLPRGAWDFEN----GRGRWVRVSESLTPEG 257

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATI 505
           G + + TDIT  +    Q+R+ ++RL   +
Sbjct: 258 GRVGLLTDITETRKASEQVRQREQRLDGIM 287


>gi|254420242|ref|ZP_05033966.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Brevundimonas sp. BAL3]
 gi|196186419|gb|EDX81395.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Brevundimonas sp. BAL3]
          Length = 549

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 153/246 (62%), Gaps = 8/246 (3%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL + +A+ + E   A++A KT+  FLA MSHELRTPLNA++GF++++++ +FG L   +
Sbjct: 290 ELGLESARAEAE---AQSAGKTR--FLANMSHELRTPLNAVIGFADIMRQRLFGPLPD-R 343

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  YA  IH +G HLL++IN++L++SKIE E+  +  ++ D    ++  + L+   A  K
Sbjct: 344 YAGYADSIHQAGGHLLDLINDVLDLSKIEAERYELALESLDARDPVSAAVALVRVQADDK 403

Query: 641 NIKIEKKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIAD 699
            + +   +PS  L   AD R +K++   +LSN++KFT   G + +    +G  + + ++D
Sbjct: 404 GVDLAPVLPSIPLTVQADARALKQMALNLLSNAVKFTPTGGSVTLTLDGVGPYLELVVSD 463

Query: 700 TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
           TG+GI    L ++G+PFE      DQ   G GLGL++  +LT LHGGR+ I S  G+GT 
Sbjct: 464 TGVGIAPEDLRRVGRPFE-QAGGADQKAQGTGLGLSLVRSLTELHGGRMSIDSTLGEGTA 522

Query: 760 VTICMP 765
           V + +P
Sbjct: 523 VMVRLP 528


>gi|114707276|ref|ZP_01440173.1| probable two-component sensor histidine kinase protein [Fulvimarina
           pelagi HTCC2506]
 gi|114537157|gb|EAU40284.1| probable two-component sensor histidine kinase protein [Fulvimarina
           pelagi HTCC2506]
          Length = 507

 Score =  184 bits (468), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/241 (42%), Positives = 149/241 (61%), Gaps = 12/241 (4%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           + RAE AN+ KS+FLA MSHELRTPLNAILGFSEV+  EIFG LGS  Y EY  DIH SG
Sbjct: 259 RRRAEDANRAKSQFLATMSHELRTPLNAILGFSEVMMNEIFGPLGSPNYKEYLTDIHSSG 318

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI----EKKI 648
           +HLL +IN IL++S++E  + +++++  DL  I  +    +   A+ K I I    E+ +
Sbjct: 319 KHLLGVINEILDLSRVEAGQYALNEEAVDLSRIAADCASTVRLRAEDKRIAIQMHFEEGL 378

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIITIADTGIGIP 705
           P+      D+R +++I+  +LSN++KFT  +G++++R   T+  GQ V   ++D G GIP
Sbjct: 379 PA---LWGDERALRQIVLNLLSNAVKFTPKSGEIILRVGWTAGGGQYV--GVSDNGAGIP 433

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +  +  +   F    N    +  G GLGL I  AL  LH G+ ++ S+EGKGT V    P
Sbjct: 434 QDEIPTVLASFGQGSNAIKNAEQGTGLGLPIVQALVKLHDGQFELSSREGKGTDVIAIFP 493

Query: 766 Q 766
           Q
Sbjct: 494 Q 494


>gi|163795590|ref|ZP_02189556.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
 gi|159179189|gb|EDP63722.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
          Length = 577

 Score =  184 bits (468), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 166/274 (60%), Gaps = 8/274 (2%)

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVE-------KERAETANKTKSEFLAKMS 551
           R+    ++DL  S   L  Q   L+ A  + + +       + +A++A+++KSEFLA +S
Sbjct: 294 RKAHRAMHDLEASHHALHVQADSLAAARDRAEAQQVLEAQLRAQADSASRSKSEFLALVS 353

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HELRTPLNAILGFSE+I ++ FG   + +   YA+DI+ SG HLL++IN+IL++SKIE  
Sbjct: 354 HELRTPLNAILGFSEIIAQQTFGPSTADRAQSYARDINESGNHLLSLINDILDLSKIEAG 413

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           +  + ++   L  +++    L+      KNI +     S +  NAD+R + +++  +LSN
Sbjct: 414 RYELMEETFVLRDVLDRCATLLRERVAEKNIGLTCHGTS-ICLNADRRAVMQVVINLLSN 472

Query: 672 SIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
           ++KFT+  G++ +  +     + I ++DTG+G+    L++  QPF    + + +S GG G
Sbjct: 473 AVKFTSPRGRVELFATVAHDAIEIAVSDTGVGMSHEDLQRSLQPFGQADSLHTRSSGGTG 532

Query: 732 LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LGL I++ LT LHGG L + S  G+GT+ TI +P
Sbjct: 533 LGLNIAEMLTKLHGGSLGLRSTLGEGTVATIRLP 566


>gi|209965762|ref|YP_002298677.1| signal transduction histidine-protein kinase BarA [Rhodospirillum
           centenum SW]
 gi|209959228|gb|ACI99864.1| signal transduction histidine-protein kinase BarA [Rhodospirillum
           centenum SW]
          Length = 780

 Score =  184 bits (468), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 132/512 (25%), Positives = 249/512 (48%), Gaps = 32/512 (6%)

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIPY-ENKTLSFRAIARLIH-YDNKKICEIARSVTGKH 324
           G+W++N       ++     I+G    E + +S     RL+H  D +K   +   V    
Sbjct: 216 GIWDWNPQTGVLIINERWAGIVGYTLAELQPVSIATWRRLVHPQDLEKAETLLEDVFAGR 275

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRTISGG--MNIIGIAMDLTEKYHLEKRYAEADQ 382
                    MRH +G  +W++   ++M   S G  + ++G  +D+TE+    ++  +   
Sbjct: 276 SPLYACDIRMRHKAGHWVWVRDSGRIMGRDSAGRALRMVGTHLDVTEERRTLEQALDYRG 335

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIE- 441
           ++   +    + ++  D++ R+   N   +  +G P   +V      ++ + Q       
Sbjct: 336 QIEAILAAVPDGIMTVDRDLRITRVNRAAEALFGWPADSIVGQTVDVLLPEGQAETHGRL 395

Query: 442 ----YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRES 497
               ++T +P+  + M+         W  +        G    G+   +L    A L + 
Sbjct: 396 ARAFFKTEEPDARRQMAG--------WRAVQ-------GRKRDGSLFPVLVTLSATLIDG 440

Query: 498 KRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
           +  + A + D++    ++E+QK +L     +   + + A+ AN  K+ FLA +SHELRTP
Sbjct: 441 QPMVVAALKDMT----VIEQQKADLRALADEVGEQLKAAQAANHAKNRFLAALSHELRTP 496

Query: 558 LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
           LNAI+GFSE++  +    +   K  EYA D+  +G HLL +I+++L++++IE  +I ++ 
Sbjct: 497 LNAIIGFSELVATDTDEHIDPEKRREYAADVAQAGTHLLALISDLLDLARIEANRIELEI 556

Query: 618 QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFT 676
           +      + ++ +R++G S + K I++E  +  +L    AD+R +++IL  +L N+ KFT
Sbjct: 557 EPCPPDGLTSDAVRMLGPSLRDKGIELEVAVAPDLPRVAADRRAVQQILTNLLGNAGKFT 616

Query: 677 NNNGKMMIRTS---KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
              G++ +       +   V  T+ DTG G+P   L  +GQPF  + ++   S  G GLG
Sbjct: 617 PKGGRVTVTVGLDRAVPGQVRFTVEDTGCGVPADKLPLLGQPFVQVGDKRRASAPGLGLG 676

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LAIS  L    GG L+I S+ G+ T V+  +P
Sbjct: 677 LAISRGLVERMGGMLRIESELGRWTRVSFGLP 708


>gi|118590259|ref|ZP_01547662.1| periplasmic sensor signal transduction histidine kinase [Stappia
           aggregata IAM 12614]
 gi|118437231|gb|EAV43869.1| periplasmic sensor signal transduction histidine kinase [Stappia
           aggregata IAM 12614]
          Length = 518

 Score =  184 bits (467), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 156/253 (61%), Gaps = 12/253 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  ANA     + RAE AN  KS FLA MSHELRTPLNAILGFSE++K E+ G++ +  
Sbjct: 241 ELESANAMSDEARRRAEAANLAKSRFLATMSHELRTPLNAILGFSEIMKDEVLGKMHNKN 300

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  YA+DIH SGQHLLN+IN IL++S+IE  +  + ++   L  I+ E   ++   A++K
Sbjct: 301 YQSYAEDIHGSGQHLLNLINEILDLSRIEAGRHELHEEPIFLDDIVEECGTMMKVRAKAK 360

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I +    E  +P      AD+R +++++  +LSN++KFT  NG++ I+   TS  GQ V
Sbjct: 361 TISLHHTHEPDLPRVW---ADERALRQVVLNLLSNAVKFTPVNGEVWIKVGPTSDGGQYV 417

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
             +I DTG GIP+  +  + + F    +    +  G GLGL+I  AL N+H G+  + S+
Sbjct: 418 --SIKDTGPGIPEDEIPTVLEAFGQGSHAIKTAEPGTGLGLSIVQALVNMHDGKFSLKSK 475

Query: 754 EGKGTIVTICMPQ 766
            G+GT V + +P+
Sbjct: 476 PGEGTEVIVTLPR 488


>gi|144900521|emb|CAM77385.1| PAS [Magnetospirillum gryphiswaldense MSR-1]
          Length = 815

 Score =  184 bits (467), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/228 (38%), Positives = 146/228 (64%), Gaps = 1/228 (0%)

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           +N+ K+EFLA MSHELRTPLNAI+GFSE+I+ E+ G + + +Y +YA DI+ SG+HLL +
Sbjct: 575 SNRAKTEFLATMSHELRTPLNAIIGFSEIIENELLGPVETKQYRDYAHDINESGRHLLTL 634

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNAD 657
           IN+IL+++++E  + ++ +   D+   I   ++L+G  A++  ++I ++IP  L +   D
Sbjct: 635 INDILDVARLEVGRFALMESEMDVGQTIRASVQLVGERAKAAGLRIGEQIPDGLPWLMGD 694

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
           +R IK+ +  ILSN++KFT+ +G++ +        + I ++DTGIGI    + KI  PF 
Sbjct: 695 ERRIKQTIANILSNAVKFTSADGRVTVTAKTDENGLDIVVSDTGIGIHADDMTKIMAPFG 754

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +   +   G GLGL ++    ++HGG L I S  G+GT+V +  P
Sbjct: 755 QAESSLSRRFDGAGLGLPLARRFMDMHGGTLSISSTPGQGTVVNLHFP 802


>gi|288957737|ref|YP_003448078.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288910045|dbj|BAI71534.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 767

 Score =  184 bits (467), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 204/395 (51%), Gaps = 28/395 (7%)

Query: 374 EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
           + R A A +R+   ++   +A+V +D N R++  N   +  +G+P+H +V     ++I  
Sbjct: 369 QARLARASRRIRGILDSMLDAVVTFDSNGRIITFNRAAELMFGMPEHRMVGQPIEALIPG 428

Query: 434 AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
           A+        T+             + D R          DGG  +       L      
Sbjct: 429 ARGGADDRDLTALRRDGHAFPVSFTVGDLRL---------DGGPCTPAA----LPAALGG 475

Query: 494 LRESKRRL-KATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +R  + R+    I D++  +Q    Q+ EL IA+      K +AE AN+ K+EFLA MSH
Sbjct: 476 VRPDEPRICVGVIRDMTRRKQ----QEAEL-IAS------KTQAELANRAKTEFLANMSH 524

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI+GF+EV+  E FG +   +      DIH SG+HLL+++N +L+MSK+E  +
Sbjct: 525 ELRTPLNAIIGFAEVLSSEFFGTVNE-RQKSCITDIHDSGRHLLDIVNAVLDMSKLEFGQ 583

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSN 671
             + +++ +    I + + ++   A +  I I  ++ + +     D+R  K+++  +LSN
Sbjct: 584 FDLSEESVEAHEAIGQCLMMVRDRAAAAGIAIHNEVTAAIALLWVDRRAFKQVILNLLSN 643

Query: 672 SIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           ++KFT + G++ +    +      +T+ADTGIGIP + +  + QPF    N  ++   G 
Sbjct: 644 AVKFTPDGGQITVSAGLEADGGFRLTVADTGIGIPAAFMADLFQPFRQAENTANRRYEGT 703

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGL+IS    +LHGG L   S  G GT +T+ +P
Sbjct: 704 GLGLSISKNFIDLHGGTLSCQSGLGAGTSMTVRLP 738


>gi|295690558|ref|YP_003594251.1| integral membrane sensor signal transduction histidine kinase
           [Caulobacter segnis ATCC 21756]
 gi|295432461|gb|ADG11633.1| integral membrane sensor signal transduction histidine kinase
           [Caulobacter segnis ATCC 21756]
          Length = 574

 Score =  184 bits (466), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 148/240 (61%), Gaps = 3/240 (1%)

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
           A  +  +  AE     ++ FLA MSHELRTPLNAI+GFS++++  +FG L S +Y EYA+
Sbjct: 300 AALEQARADAEGLAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPL-SDRYAEYAE 358

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            IH SG HLL++IN++L+MSKIE E+  + +   D    I   +RL+   + S  +++  
Sbjct: 359 LIHESGGHLLDLINDVLDMSKIEAERFELQRGVFDAREAIQAAMRLLRVQSDSAGVQLRG 418

Query: 647 KIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
            +P  EL  +AD+R +K+I+  ++SN++KFT   G++ +        + I +ADTG+GI 
Sbjct: 419 VLPPGELEVDADRRALKQIVLNLVSNALKFTPRGGQVTVTLDGYDGVLEIVVADTGVGIS 478

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              LE++G+P+E      +Q   G GLGL++  A   LHGG + I S+ G GT V++ +P
Sbjct: 479 PEDLERLGRPYE-QAGGAEQRARGTGLGLSLVRAFAKLHGGEMAIESRLGAGTTVSVRLP 537


>gi|163793613|ref|ZP_02187588.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159181415|gb|EDP65930.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 649

 Score =  183 bits (465), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 133/439 (30%), Positives = 218/439 (49%), Gaps = 53/439 (12%)

Query: 343 WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
           W+ +R    R   GG   +  + D+T+   +E+ Y E++QR    ++ +S+     D+N 
Sbjct: 232 WVVIRDH--RLPDGGT--VTTSQDITDIKRVEQAYRESEQRFHDFVDASSDRFWEMDENL 287

Query: 403 RLVMCNANYQKAYGL--PDHVLVPGNAR--SIIQDAQTRPIIEYRTS-----DPERSQDM 453
           R  M       A G   P    V G  R  +   D +  P+     +     +P R  D 
Sbjct: 288 RFTMV---VDTAVGRREPPVAQVLGKTRWANAGVDVEDDPLFTTHKAVLDAREPFR--DF 342

Query: 454 SKEIKLADS--RWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
             E+  AD   R  +++     D G    G                    + T  D +  
Sbjct: 343 RYEVPAADGSPRHWRVSGVPVFDEGGKFCG-------------------YRGTAADETEF 383

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
                   TEL+ A  + Q    +AE AN++KS FLA +SHELRTPLNAI+GFS+++ ++
Sbjct: 384 -------STELTRAQRELQEALRQAEIANRSKSLFLATVSHELRTPLNAIIGFSDLLAQK 436

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
           +FG LG  +Y  YA DI  SGQHLL++I ++L++S+IE  +I +     DL   I   + 
Sbjct: 437 VFGPLGDERYEGYAHDIQTSGQHLLSLIEDVLDLSRIEMGQIRLRLGLVDLPIEIQAAVA 496

Query: 632 LI----GSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
           ++    G    S  I++ +  P+    NAD R+I++IL  ++SN+ KFT  +G++++   
Sbjct: 497 MVRARRGQEIASIQIEVAEGFPT---LNADARLIRQILINLISNAAKFTPPSGRILVTAQ 553

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
            +   + I + D GIGI  +   K+ +PFE   N+  +   G GLGL ++ A   +H G+
Sbjct: 554 VVDDGISIAVIDDGIGIDPADHAKVLRPFEQADNRLSRRYEGVGLGLPLTKAFVEVHNGQ 613

Query: 748 LKIISQEGKGTIVTICMPQ 766
           L++ S  G+GT +TI +P+
Sbjct: 614 LQLESAIGEGTTITIRLPK 632



 Score = 55.5 bits (132), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQK---AYGLPDHVLVPGN----------ARSI 430
           L +A++   + L +WD  DRL+  NA  ++   A G P   L PG           A+++
Sbjct: 141 LQQALDYAPDGLRVWDAKDRLIYANARIRRVSEAEGTP---LRPGMTFEEHIRARVAKNL 197

Query: 431 IQDAQTRP--IIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLK 488
           + +A+  P   ++ R  +  R    S   +L D RW+ I +    DGGT++   DIT +K
Sbjct: 198 VAEAEADPEAYVQQRL-EMHRLGGRSYTTRLRDGRWVVIRDHRLPDGGTVTTSQDITDIK 256

Query: 489 HNQAQLRESKRRLKATINDLSTSR--QILERQKTELSIANAKYQVEKERAETANKTK 543
             +   RES++R    + D S+ R  ++ E  +  + +  A  + E   A+   KT+
Sbjct: 257 RVEQAYRESEQRFHDFV-DASSDRFWEMDENLRFTMVVDTAVGRREPPVAQVLGKTR 312


>gi|170740792|ref|YP_001769447.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium sp. 4-46]
 gi|168195066|gb|ACA17013.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium sp. 4-46]
          Length = 512

 Score =  183 bits (465), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 148/249 (59%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+FG   S  
Sbjct: 240 ELEQAKANSDEARRRAEEANLAKSRFLATMSHELRTPLNAILGFSEVMKNEVFGPHASPS 299

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L  ++ E   ++G  A++K
Sbjct: 300 YQEYSTDIHESGLHLLNLINEILDLSRIEAGRYELNEEAVQLAYVVEECRHMMGLRARAK 359

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
           N    + + PS     AD+R +++I+  ILSN+IKFT   G++ I+   TS  GQ V  +
Sbjct: 360 NQNFRELVDPSLPRLWADERAVRQIVLNILSNAIKFTPPGGEITIKVGWTSSGGQYV--S 417

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I DTG GIP+  +  +   F         +  G GLGL I   L +LHGG  ++ S+  +
Sbjct: 418 IKDTGPGIPEDEIPTVMSSFGRGSLAIKTAEQGSGLGLPIVKGLVDLHGGGFQLKSKPRE 477

Query: 757 GTIVTICMP 765
           GT V +  P
Sbjct: 478 GTEVIVTFP 486


>gi|83311949|ref|YP_422213.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82946790|dbj|BAE51654.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 676

 Score =  182 bits (462), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/431 (29%), Positives = 205/431 (47%), Gaps = 62/431 (14%)

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLS-------KAIECTSEALVLWDKNDRLVMCNAN 410
           +  IG+  D++E+   E    ++  RLS         I+   + + ++  +D L+  N +
Sbjct: 271 LTFIGVIRDVSERRKNELALLDSKNRLSLQADRLQGIIDNMPQGVAVFASDDALIALNES 330

Query: 411 YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER-----SQDMSKEIK------- 458
             +  GLP   + PG     I  +    ++    + P R     + D+++ ++       
Sbjct: 331 AVRMLGLPQAEITPGT----IDISLFMALLAANDTPPGRHSAQLTADLAESVRERPEMVF 386

Query: 459 --LADSRW-LQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
              A S   +++       GG I   TD+T  K  +  LRE+K                 
Sbjct: 387 EHFAPSGLIMEVRSSSMPGGGLILSFTDVTDRKRVEQTLREAK----------------- 429

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
                             + AE  N+ K+ FLA +SHELRTPLNAI+GFSE++K EIFG 
Sbjct: 430 ------------------DEAERGNRAKNTFLANISHELRTPLNAIIGFSEMMKHEIFGP 471

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           L    Y  Y  DIH SG HLL +IN+IL+MSK E     + +    +  ++   IRL+  
Sbjct: 472 LEPASYRTYVDDIHESGMHLLELINDILDMSKAEAGMTDLMEAAVHVPDLVRGAIRLLTR 531

Query: 636 SAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
            A++  I + E   P+     AD+R +++++  + SN++KFT++ G + I         I
Sbjct: 532 RAENAGITLSEDLPPTLPLLLADERRLRQVILNLGSNAVKFTDDGGAVTIGAKVTEAGFI 591

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           IT+ADTGIG+    L ++ +PF     +  +   G GLGL ++ AL   HGG L + SQ 
Sbjct: 592 ITVADTGIGMTPEELLRVMEPFVQADTRLSRKYEGSGLGLPLAKALICAHGGTLHLDSQP 651

Query: 755 GKGTIVTICMP 765
           G+GT+ T+  P
Sbjct: 652 GRGTVATVTFP 662



 Score = 50.8 bits (120), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 73/167 (43%), Gaps = 17/167 (10%)

Query: 377 YA-EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG---------- 425
           YA E+ ++L +A+  + + + L+DK +RL+ CN  Y++        LVPG          
Sbjct: 38  YALESQRQLLEALGNSRDGVALYDKTNRLITCNERYRQLLSPIKESLVPGARFEDLMAEL 97

Query: 426 -NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDI 484
            N   +      R +     +D   S D     K  D +W+ +N + T DGG + +  DI
Sbjct: 98  ANLEHMDAAWLGRKLSGGGLTDATASDD-----KFRDGQWITVNAYATLDGGQLRILRDI 152

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQV 531
           T  K  Q  L ++   LK  ++ +      ++   T LS   A  ++
Sbjct: 153 TQRKQAQISLEDTVSWLKGVMDTVVDGIVTIDETGTVLSFNPAAEKL 199


>gi|288959456|ref|YP_003449797.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288911764|dbj|BAI73253.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 680

 Score =  182 bits (461), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 140/230 (60%), Gaps = 6/230 (2%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N+ KS FLA MSHELRTPLNAI+GFS+++  E+FG LGS +Y +Y + +  SG+HLL++I
Sbjct: 438 NRAKSAFLATMSHELRTPLNAIIGFSDIMLHELFGPLGSPRYRDYVRHVQNSGRHLLDLI 497

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N++L+MSK+E  + ++D+   +    I     L    A +  + +E   P  L    AD+
Sbjct: 498 NDVLDMSKLEAGRYTLDESWLEPADAIETCRALAAIPADAGGVTLEVDCPPCLPKLLADE 557

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMI---RTSKIGQCVIITIADTGIGIPKSALEKIGQP 715
           R ++++L  +LSN++KFT   G++ +   R    G  + IT+ DTGIGIP  AL +I +P
Sbjct: 558 RALRQVLLNLLSNAVKFTPRGGRVTVSALREEDGG--IAITVRDTGIGIPADALARILEP 615

Query: 716 FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           F+   +      GG GLGL+I   L  LHGG L + S+ G GT  TI  P
Sbjct: 616 FQQADSSIPARFGGTGLGLSICRDLMALHGGGLSLDSEPGCGTAATIRFP 665


>gi|332706440|ref|ZP_08426501.1| PAS domain S-box protein [Lyngbya majuscula 3L]
 gi|332354324|gb|EGJ33803.1| PAS domain S-box protein [Lyngbya majuscula 3L]
          Length = 1299

 Score =  182 bits (461), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 136/514 (26%), Positives = 247/514 (48%), Gaps = 53/514 (10%)

Query: 267  GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN--KKICEIARSVTGKH 324
            G+W+ N    + +LS     ++G   +  T +F +  ++IH D+  + +      + G  
Sbjct: 525  GIWDCNLQTGEMYLSPRWKSMLGYKDDEITNTFESWTQIIHPDDLEQTLLSFNNYLEGNF 584

Query: 325  VKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQR 383
              Q  + F   H  G+  W+  R   +   +G    I G   D++E+    K+  EA + 
Sbjct: 585  F-QYQEEFRALHKDGSYRWLLTRGAALWDKTGKPYRIAGSHTDISER----KKAEEALKS 639

Query: 384  LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL--PD-------HVLVPGNARSIIQDA 434
               A+E  ++ + L +        N  + + +G   P+       H++ P      I+ +
Sbjct: 640  QLTALEAATDGIALVNPAGEYFYLNQTHLELFGYTQPNELVGRQWHIIYPPEEIERIEKS 699

Query: 435  QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQL 494
                + +      E +         A+   L + E    DGG I V  DIT  K  + Q+
Sbjct: 700  VFPQLFKTGKWSGEATAVRKDGSTFAEEFSLTLLE----DGGLIRVCRDITQRKQAEEQM 755

Query: 495  RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
            +++ +RL                     ++ANA+        E A + K EFLA MSHEL
Sbjct: 756  QQNHQRL---------------------AMANAQL-------ERATRLKDEFLASMSHEL 787

Query: 555  RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
            RTPLNAILG SE +++E++G + + +  +    I  SGQHLL +IN++L+++KIE+ K+ 
Sbjct: 788  RTPLNAILGLSEALQEEVYGSI-TDRQRKSLSTIQGSGQHLLELINDLLDLAKIESGKME 846

Query: 615  IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSI 673
            +      L  + N  +  + + A  KNIK+  ++  +L+    D+R I+++L  +LSN++
Sbjct: 847  LHICAVSLQKLCNSSLMFVRNQAHHKNIKLTSQVTEKLWEIEVDERRIRQVLINLLSNAV 906

Query: 674  KFTNNNGKMMIRTSK--IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
            KFT   G ++++  +  +   +  ++ DTGIGI K  + K+ Q F  + ++  +   G G
Sbjct: 907  KFTPTGGSVILKAEEDLLRNTICFSVMDTGIGIAKENMPKLFQSFVQIDSRLSRRYAGTG 966

Query: 732  LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            LGLA+      +HGGR+ + S+ G+G+   + +P
Sbjct: 967  LGLALVQRTIEIHGGRVDVESEVGQGSCFRVTLP 1000


>gi|16125315|ref|NP_419879.1| sensor histidine kinase DivJ [Caulobacter crescentus CB15]
 gi|13637937|sp|Q03228|DIVJ_CAUCR RecName: Full=Histidine protein kinase divJ
 gi|13422363|gb|AAK23047.1| sensor histidine kinase DivJ [Caulobacter crescentus CB15]
          Length = 597

 Score =  182 bits (461), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 145/231 (62%), Gaps = 3/231 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE     ++ FLA MSHELRTPLNAI+GFS++++  +FG L S +Y EYA+ IH SG HL
Sbjct: 322 AEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPL-SDRYAEYAELIHESGGHL 380

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFF 654
           L++IN++L+MSKIE E+  + +   D    +   +RL+   + +  +++   +P  EL  
Sbjct: 381 LDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEV 440

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD+R +K+I+  ++SN++KFT   G++ +        + I +ADTG+GI    LE++G+
Sbjct: 441 DADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGR 500

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P+E      +Q   G GLGL++  A   LHGG + I S+ G GT V++ +P
Sbjct: 501 PYE-QAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLP 550


>gi|221234053|ref|YP_002516489.1| histidine protein kinase DivJ [Caulobacter crescentus NA1000]
 gi|220963225|gb|ACL94581.1| histidine protein kinase DivJ [Caulobacter crescentus NA1000]
          Length = 600

 Score =  182 bits (461), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 145/231 (62%), Gaps = 3/231 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE     ++ FLA MSHELRTPLNAI+GFS++++  +FG L S +Y EYA+ IH SG HL
Sbjct: 325 AEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPL-SDRYAEYAELIHESGGHL 383

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFF 654
           L++IN++L+MSKIE E+  + +   D    +   +RL+   + +  +++   +P  EL  
Sbjct: 384 LDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEV 443

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD+R +K+I+  ++SN++KFT   G++ +        + I +ADTG+GI    LE++G+
Sbjct: 444 DADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGR 503

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P+E      +Q   G GLGL++  A   LHGG + I S+ G GT V++ +P
Sbjct: 504 PYE-QAGGAEQRARGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLP 553


>gi|269958992|ref|YP_003328781.1| sensor histidine kinase [Anaplasma centrale str. Israel]
 gi|269848823|gb|ACZ49467.1| sensor histidine kinase [Anaplasma centrale str. Israel]
          Length = 469

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 152/243 (62%), Gaps = 1/243 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN + Q +KE AE  + +KS+FLA +SHELRTPLN+I+GFSE+I+ E  G +GS +Y EY
Sbjct: 216 ANLELQEQKETAERESVSKSQFLANVSHELRTPLNSIIGFSEIIQSESLGPIGSEEYKEY 275

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K++++    DL  I++    ++   A+   +++
Sbjct: 276 ISDIHQSGVHLLSLINDILDFSKAEANKLTVEFVKFDLSKIVDSSFTMVLPRAKDAKVEL 335

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +K++P E +   AD + +K+++  ILSNS+KFT   G + + T   G+ +++ I+DTGIG
Sbjct: 336 KKEMPEEPVVMLADPKRMKQVIINILSNSVKFTPEGGLVKLCTEIRGEQLVVEISDTGIG 395

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L K+   F    +++ +   G GLGL +S  L  L  G   I S+   GTIVT+ 
Sbjct: 396 IAQQDLYKVMSVFGQADSKHSRKYEGTGLGLPLSKKLVELMHGTFSIKSEPNLGTIVTLT 455

Query: 764 MPQ 766
            P 
Sbjct: 456 FPH 458


>gi|154253591|ref|YP_001414415.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157541|gb|ABS64758.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 468

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/261 (39%), Positives = 160/261 (61%), Gaps = 6/261 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           +S   +  ER+++ L+ A AK ++     E  NK K+EFLA MSHELRTPLNAILGFSE 
Sbjct: 199 ISMREEAAERERS-LAQALAKTRLYASM-ERENKAKTEFLANMSHELRTPLNAILGFSEA 256

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           ++ E+FG LG  +Y EY  DIH++G HLL+++N+IL++S+IE E +S+  Q  D   + +
Sbjct: 257 MQMELFGPLGHPRYVEYMHDIHHAGTHLLSLVNDILDLSRIELEGMSLTPQRIDFSGVCH 316

Query: 628 EGIRLIGSSAQSKNIK-IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNG--KMMI 684
             + ++   A+   ++ I +  P       D+R +K++L  +LSN++KFT   G   + +
Sbjct: 317 NCLAIVRGRAERGGVQLIFECAPPFPEVETDERRLKQVLINLLSNAVKFTPAGGTVSLDV 376

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           R +  G   II I DTGIG+ ++ +E+  +PF       D+S  G GLGLA+   L  L 
Sbjct: 377 RPAPDGGG-IIRIRDTGIGMSETEVEQALRPFWQADAGLDRSFEGAGLGLALVSELLQLM 435

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG + I S+ G GT+VT+ +P
Sbjct: 436 GGSITIESERGAGTLVTVGLP 456


>gi|315497659|ref|YP_004086463.1| integral membrane sensor signal transduction histidine kinase
           [Asticcacaulis excentricus CB 48]
 gi|315415671|gb|ADU12312.1| integral membrane sensor signal transduction histidine kinase
           [Asticcacaulis excentricus CB 48]
          Length = 598

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 95/233 (40%), Positives = 151/233 (64%), Gaps = 4/233 (1%)

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           + +  ++ A+  N+ KS FLA MSHELRTPLNA++GFS+++++++FG L + KY EY+Q 
Sbjct: 305 ELETARQEAQALNEGKSRFLAGMSHELRTPLNAVIGFSDIMRQQMFGPL-TGKYAEYSQL 363

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           I  SGQH+L+++N++L+MSKIE  +  +  +  D    ++  +RLI ++A  K + ++  
Sbjct: 364 IWESGQHVLDLVNDVLDMSKIEASRYELSLERFDAREPVSAALRLILATAHEKGVTVKSV 423

Query: 648 I-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-ITIADTGIGIP 705
           + P+ L   ADKR IK++   +LSN++KFT   G + +  S+ GQ  I I I DTG+GI 
Sbjct: 424 LPPTPLEVTADKRAIKQMCLNLLSNAVKFTPQGGTITLMLSETGQHSIDIQITDTGVGIA 483

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
              L+++G+P+E      +Q   G GLGL++  AL  LH GR+ I S+ G GT
Sbjct: 484 PEDLKRLGKPYEQ-SGPMEQRAMGTGLGLSLVQALAGLHRGRMTIESELGVGT 535


>gi|220924683|ref|YP_002499985.1| histidine kinase [Methylobacterium nodulans ORS 2060]
 gi|219949290|gb|ACL59682.1| histidine kinase [Methylobacterium nodulans ORS 2060]
          Length = 513

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 147/249 (59%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+FG   S  
Sbjct: 240 ELEQAKANSDEARRRAEEANLAKSRFLATMSHELRTPLNAILGFSEVMKNEVFGPHASPS 299

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L  ++ E   ++   A++K
Sbjct: 300 YQEYSTDIHDSGMHLLNLINEILDLSRIEAGRYELNEEAVQLAYVVEECRHMMALRARAK 359

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
           N    + + PS     AD+R +++++  ILSN+IKFT   G++ I+   TS  GQ V  +
Sbjct: 360 NQVFRELVDPSLPRLWADERAVRQVVLNILSNAIKFTPPGGEITIKVGWTSSGGQYV--S 417

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I DTG GIP+  +  +   F         +  G GLGL I   L +LHGG  ++ S+  +
Sbjct: 418 IKDTGPGIPEDEIPTVMSSFGRGSLAIKTAEQGSGLGLPIVKGLVDLHGGGFRLKSKPRE 477

Query: 757 GTIVTICMP 765
           GT V +  P
Sbjct: 478 GTEVIVTFP 486


>gi|83312195|ref|YP_422459.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82947036|dbj|BAE51900.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 657

 Score =  181 bits (460), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/232 (40%), Positives = 148/232 (63%), Gaps = 3/232 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           A+ AN+TK++FLA MSHELRTPLNAILGFSE+I +E+FG +G  +Y  Y QDI+ +GQHL
Sbjct: 421 AQAANRTKTDFLAAMSHELRTPLNAILGFSEIIAREMFGPVGD-RYRIYGQDINSAGQHL 479

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FF 654
           L MIN+IL++S+IE    ++  +  +   +++  +RL+ + A++  I++ + +P  L   
Sbjct: 480 LAMINDILDISRIEIGAFTLCVEQVNPHELVDSCLRLVTTRAEAAGIRLREDLPETLPSL 539

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIG 713
             D R  K+IL  +L N++KFT   G + +R + +    +   +ADTGIG+ ++ +    
Sbjct: 540 MIDSRRTKQILINLLGNAVKFTPAGGSVTLRGALQSDGGMAFHVADTGIGMSEADIAIAL 599

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            PF  +    D+   G GLGL ++ +L  LHGG L+IIS  G+GT V++  P
Sbjct: 600 SPFGQVDTGLDRRFEGAGLGLPLAKSLAELHGGSLEIISTPGEGTTVSVYFP 651


>gi|254503637|ref|ZP_05115788.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Labrenzia alexandrii DFL-11]
 gi|222439708|gb|EEE46387.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Labrenzia alexandrii DFL-11]
          Length = 516

 Score =  181 bits (459), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 151/250 (60%), Gaps = 6/250 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  ANA     + RAE AN  KS FLA MSHELRTPLNAILGFSE++K E+ G + +  
Sbjct: 241 ELETANAMSDEARRRAEAANVAKSRFLATMSHELRTPLNAILGFSEIMKDEVLGPMKNDT 300

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  Y+ DIH SGQHLLN+IN IL++S+IE  +  + +++  L  +++E   ++   A +K
Sbjct: 301 YKSYSADIHGSGQHLLNLINEILDLSRIEAGRHELQEESLYLEEVVDECGSMMTVRANAK 360

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI---RTSKIGQCVIIT 696
           NI +   + P      AD+R +++++  ++SN++KFT   G++ I   RTS  GQ V IT
Sbjct: 361 NIMLHHTLEPDMPRVWADERALRQVVLNLISNAVKFTPVGGEVHIKVGRTSDDGQYVSIT 420

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
             DTG GIP+  +  + + F    +    +  G GLGL+I  AL  +H G+  I SQ G 
Sbjct: 421 --DTGPGIPEDEIPTVLEAFGQGSHAIKSAEPGTGLGLSIVQALVGMHDGKFVIKSQLGV 478

Query: 757 GTIVTICMPQ 766
           GT   + +P+
Sbjct: 479 GTEAIMSLPR 488


>gi|163792969|ref|ZP_02186945.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
 gi|159181615|gb|EDP66127.1| multi-sensor signal transduction histidine kinase [alpha
           proteobacterium BAL199]
          Length = 757

 Score =  181 bits (459), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 209/418 (50%), Gaps = 60/418 (14%)

Query: 362 GIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV 421
           G   D+TE    E    E   RL +A++   + + L+D ++RLV  N  Y+  +   D +
Sbjct: 377 GTGRDITE----EVSARETVDRLVRALDSIEDVVALFDADERLVFANRPYRALHPQFDGI 432

Query: 422 LVPGNARS-IIQDAQTRPIIE-YRTSDPERSQDMSKEIKLAD----SRWLQINEWCTHDG 475
           L+PG     I+ D   R II+   T  P+R           D     RW ++ +    DG
Sbjct: 433 LIPGKKLGEILNDFALRGIIDNPETEVPKRLHQFRNPSGPTDINRFGRWFRVKDQKLGDG 492

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
           GT+ + TD+T  K  + +LR++                                    + 
Sbjct: 493 GTLLIATDVTHSKDAELELRKAV-----------------------------------DT 517

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE AN  KS FLA+MSHELRTPLNAILG SE +   +   L   K  EY  D+  +G+ L
Sbjct: 518 AEEANAAKSGFLARMSHELRTPLNAILGLSETLML-MEDRLSPAKRREYLGDVMQAGRIL 576

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE----KKIPSE 651
           L+ I++IL  ++++ +  ++  Q  D    + E +RL+   A+S+++++E    + +PS 
Sbjct: 577 LSHIDDILNFARLDADGFAVTPQPTDPRRSVAEVVRLMRVVARSRSVRLEAALARNLPSV 636

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEK 711
           L   AD R I++IL  +LSN++KF+  +G + +   + G  +  +++D GIGIP   +++
Sbjct: 637 L---ADPRSIRQILINLLSNAVKFSPKHGVVQLMVIQDGSRLRFSVSDHGIGIPADQIDQ 693

Query: 712 IGQPFEPLHNQYDQSIG----GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           I   FEP H   + S+     G GLGL+I  +L + + G + + S  G+GT +++  P
Sbjct: 694 I---FEPFHQVGNPSLAVPDSGTGLGLSIVKSLVDRNAGAVAVDSTPGRGTTISVWFP 748


>gi|222147978|ref|YP_002548935.1| two component sensor kinase [Agrobacterium vitis S4]
 gi|221734966|gb|ACM35929.1| two component sensor kinase [Agrobacterium vitis S4]
          Length = 599

 Score =  181 bits (459), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 147/230 (63%), Gaps = 1/230 (0%)

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           +TAN+ KS FLA +SHELRTPLNAILGFS+++  + FG +   ++ EY + I  SG HLL
Sbjct: 270 QTANEAKSRFLAAVSHELRTPLNAILGFSDILMGDYFGRMEDERHREYVRLIRQSGGHLL 329

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FN 655
           +++N +L+M +IE  +  +  +   L   I++   ++   AQ K +K+  +I  ++    
Sbjct: 330 SVVNTMLDMCRIEAGRYELLVEPFSLSQAIHDCENMLALQAQEKGVKLTSRIGRDVSELT 389

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQP 715
           AD R +++IL  ++ N+IKFT   G + +  ++ G+ ++I+++DTGIGI +  +  +GQP
Sbjct: 390 ADPRAVRQILINLVGNAIKFTEPGGVVTVDAARFGKDLVISVSDTGIGIAQDRILLLGQP 449

Query: 716 FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           F  + + Y++   G GLGL++   L  LHGG   + S+EG+GT+V+I +P
Sbjct: 450 FVQVDSDYNRKFDGVGLGLSLVKGLVALHGGTFLLTSREGEGTVVSITLP 499


>gi|163759054|ref|ZP_02166140.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
 gi|162283458|gb|EDQ33743.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
          Length = 642

 Score =  181 bits (458), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 90/233 (38%), Positives = 148/233 (63%), Gaps = 1/233 (0%)

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           + A+ AN +K+ FLA +SHELRTPLNAILGFS+++ +E+FG+    +  EY + IH SG+
Sbjct: 363 DEADMANASKTRFLAAVSHELRTPLNAILGFSDILAREMFGKFNDERQREYVELIHQSGE 422

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF 653
           HLL ++N +L+MSKIE+ +  +  +   L  ++     ++   A+ + + + +++   L 
Sbjct: 423 HLLALVNTMLDMSKIESGRYEVFVEPFLLSEVVERCDAMLRLQAEQRGVVMTRRMAPGLG 482

Query: 654 -FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKI 712
              AD+R +++IL  ++ N+IKFT   G + +        ++++++DTGIGIP+  L  I
Sbjct: 483 EVVADRRAVQQILINLIGNAIKFTEAGGVINVDAGIHEGLLVLSVSDTGIGIPEEKLALI 542

Query: 713 GQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GQPF  + N   +   G GLGL++   L +LHGG+  I SQEG+GT+VTI +P
Sbjct: 543 GQPFVQVQNGLARHFEGTGLGLSLVKGLVDLHGGQFAIASQEGEGTVVTIRLP 595


>gi|328544444|ref|YP_004304553.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [polymorphum gilvum SL003B-26A1]
 gi|326414186|gb|ADZ71249.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Polymorphum gilvum SL003B-26A1]
          Length = 517

 Score =  180 bits (457), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 150/250 (60%), Gaps = 8/250 (3%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  ANA     + RAE AN  KS FLA MSHELRTPLNAILGFSE++K E+ G + +  
Sbjct: 241 ELEQANAVSDESRRRAEEANLAKSRFLATMSHELRTPLNAILGFSEIMKDEVLGPMANPT 300

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  YA DIH SGQHLLN+IN IL++S+IE  +  ++++   LI I+ +   ++   A++K
Sbjct: 301 YRSYAADIHGSGQHLLNLINEILDLSRIEAGRYELNEEAVTLIDIVEDCRTMMQIRAKAK 360

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT-SKIGQCVII 695
           +I I    E  +P      AD+R I++++  +LSN++KFT ++G++ IR  +  G    +
Sbjct: 361 DITIRESHEDGLPR---LWADERAIRQVILNLLSNAVKFTPSSGEVTIRIGAAPGGGQFV 417

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D G GIP+  +  + Q F         +  G GLGL+I  AL   HGG  ++ S+  
Sbjct: 418 SIRDNGPGIPEDEIPIVLQAFGQGAIAIKSAEAGTGLGLSIVQALVAQHGGTFELKSRLR 477

Query: 756 KGTIVTICMP 765
           +GT   + +P
Sbjct: 478 EGTEAIVTLP 487


>gi|227821337|ref|YP_002825307.1| two component sensor kinase [Sinorhizobium fredii NGR234]
 gi|227340336|gb|ACP24554.1| two component sensor kinase [Sinorhizobium fredii NGR234]
          Length = 527

 Score =  180 bits (457), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 142/228 (62%), Gaps = 1/228 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAILGFS+V+  E FG+L + +  EY   IH SG HLL+++
Sbjct: 243 NDAKTRFLAAVSHELRTPLNAILGFSDVLTGEYFGKLENDRQREYVSLIHRSGTHLLSVV 302

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N +L++SKIE  +  +  +   +   I     ++   A+ K +++  ++   +   NAD+
Sbjct: 303 NTMLDVSKIEAGRYELVPEPFRVADAIAACEAMLSHQAREKGVRLTSRVTRSVGEINADQ 362

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R +++IL  ++ N++KFT+  G + +     G  + +T++DTGIGI +  LEK+GQPF  
Sbjct: 363 RAVQQILINLVGNAVKFTDKGGLVTVDAEVDGAMLNLTVSDTGIGIAEDKLEKLGQPFVQ 422

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           + N Y +   G GLGL++   L  LHGG + I S EG+GT+V + +P+
Sbjct: 423 IQNDYTRRYEGTGLGLSLVKGLVELHGGGISIRSSEGEGTVVVVSIPR 470


>gi|288961571|ref|YP_003451881.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288913851|dbj|BAI75337.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 552

 Score =  180 bits (457), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 144/232 (62%), Gaps = 4/232 (1%)

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           ER   A     +FLA++SHE RTPLNAI+GFSE+IK ++FG     +Y +YA+DIH SGQ
Sbjct: 318 ERLAAALAVNRDFLARVSHEFRTPLNAIIGFSEIIKDQMFGPDAGPRYADYARDIHTSGQ 377

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE-KKIPSEL 652
           HLL +I++IL++S+++  K ++  ++ D +      IR++   A+ K+I +E K+ PS  
Sbjct: 378 HLLTLIDDILDLSRLQAGKFALLMEDVDPVAAAEWAIRIVTPQAEQKSIHLEIKRPPSPT 437

Query: 653 FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI--GQCVIITIADTGIGIPKSALE 710
              AD+R +K++L  +LSN++KFT  NG++++   +   G+C I+ I DTGIG+    L 
Sbjct: 438 LVRADERALKQMLLNLLSNALKFTPENGRVLVSVGRGTHGRC-IVRITDTGIGMTAEELR 496

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           +   PF            G GLGL I  +L   HGG L+I S+ G+G+ +T+
Sbjct: 497 QASVPFGQTAALVAHPGRGTGLGLPIVKSLIEAHGGSLRIDSRPGQGSQITL 548


>gi|57238945|ref|YP_180081.1| putative sensor protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58578878|ref|YP_197090.1| putative sensor protein [Ehrlichia ruminantium str. Welgevonden]
 gi|57161024|emb|CAH57930.1| putative histidine kinase sensor component of a two-component
           regulatory system [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417504|emb|CAI26708.1| Putative sensor protein [Ehrlichia ruminantium str. Welgevonden]
          Length = 477

 Score =  179 bits (454), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 150/244 (61%), Gaps = 3/244 (1%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
            N K +  KE AE  N +KS+FLA +SHELRTPLN+I+GFSE+IK E  G + +  Y EY
Sbjct: 224 VNLKLKEAKEMAEQENISKSQFLANVSHELRTPLNSIIGFSEMIKSESLGPIENSDYKEY 283

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K+ I+    DL  I++    ++   A+   + +
Sbjct: 284 INDIHSSGVHLLSLINDILDFSKAEANKLVIEFIKFDLGKIVSSCFNMMIPRAEQAKVHL 343

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVIITIADTG 701
           EK +PS+ +   AD + IK+++  +LSNSIKFT  NG  K+++R +   + +II I DTG
Sbjct: 344 EKVLPSDKVVMVADPKRIKQVIINLLSNSIKFTPENGTVKLVVRYNLEDKLIIIEITDTG 403

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  L K+   F  + +++ +   G GLGL +S  L  L  G  KI S+   GT++T
Sbjct: 404 IGIAQQDLYKVMSVFGQVDSKHSRKYEGTGLGLPLSKKLVELMNGIFKIKSEPNSGTVIT 463

Query: 762 ICMP 765
           +  P
Sbjct: 464 LTFP 467


>gi|239787555|emb|CAX84024.1| Sensor protein [uncultured bacterium]
          Length = 595

 Score =  179 bits (454), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 152/247 (61%), Gaps = 10/247 (4%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           A    Q  +E+AE AN+ K+E LA MSHELRTPLNAI+GFSE +K ++FG LGS KY EY
Sbjct: 343 AEQATQAAREQAEIANRAKTELLANMSHELRTPLNAIIGFSEGMKLQLFGPLGSAKYEEY 402

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
           A+DI+ SGQHLL +IN+IL++S IE  K ++ ++  +++ I    +RL+ + A+  ++ +
Sbjct: 403 AEDINASGQHLLKLINDILDVSAIEAGKTTLQEELLNVVEIAETSLRLVRARAEKGSVSL 462

Query: 645 ----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--KIGQCVIITIA 698
                  +P  L   AD R IK+IL  +LSN++KFT   G++ ++    ++G+ + + +A
Sbjct: 463 FLEASDGLPPLL---ADGRRIKQILLNLLSNAVKFTPEGGRVTLKAGIDEVGR-LHLAVA 518

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           DTGIG+ +  L      F  +    D+   G GLGL ++  L  +HGG   + S++G GT
Sbjct: 519 DTGIGMDEKELTLAMTEFGQVDGGLDRRHEGTGLGLPLTKGLVEIHGGIFSVESKKGHGT 578

Query: 759 IVTICMP 765
             +   P
Sbjct: 579 TASAIFP 585


>gi|163794545|ref|ZP_02188516.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159180269|gb|EDP64792.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 509

 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 157/255 (61%), Gaps = 5/255 (1%)

Query: 515 LERQKTELSIANAKYQVEKE---RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           L RQ T ++    + ++  E    AE AN+ KSEFLA MSHELRTPLNAI+GFSE++   
Sbjct: 226 LLRQATAIAAVTERERMAVEGQKAAEAANQAKSEFLAMMSHELRTPLNAIIGFSELMASG 285

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
           + G L   + + YA+DI  SG+HLLN+I NIL++++ E+++I++ + + +L  +I   +R
Sbjct: 286 LHGPL-PPRQHGYAKDIQQSGRHLLNVIGNILDLAEAESKQINLFEVDIELEAVIEPCLR 344

Query: 632 LIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           LI   A    +++   +P+ +    D   +++ L  +LSN++KFT+  G + +  S  G 
Sbjct: 345 LIAPQASEGRVQVTATLPTGVRLLCDVTKLRQTLLNLLSNAVKFTDPGGTVRVSVSVQGD 404

Query: 692 CVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
            ++ IT+ADTGIGI    + +I + FE + +Q  +S  G GLGL ++ ALT  HGG L++
Sbjct: 405 GLLDITVADTGIGIRPEDVPRILKRFEQVESQMHRSREGAGLGLPLAKALTEAHGGVLEV 464

Query: 751 ISQEGKGTIVTICMP 765
            S  G GT   I +P
Sbjct: 465 TSDFGHGTTARIILP 479


>gi|114766988|ref|ZP_01445907.1| cytoplasmic sensor hybrid histidine kinase [Pelagibaca bermudensis
           HTCC2601]
 gi|114540834|gb|EAU43897.1| cytoplasmic sensor hybrid histidine kinase [Roseovarius sp.
           HTCC2601]
          Length = 855

 Score =  179 bits (453), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 131/443 (29%), Positives = 219/443 (49%), Gaps = 83/443 (18%)

Query: 346 VRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLV 405
           ++ Q  R   GG  ++ + +D+TE             R+  AIE   +  V++D  DRL+
Sbjct: 173 IKIQDRRMPDGG--VVSLCVDITELM-----------RMWSAIEELPDGFVIYDAEDRLL 219

Query: 406 MCNANYQKAYGLPDHVLVPGNA-----RSIIQDAQ-------TRPIIEYRTSDPERS-QD 452
           MCNA Y+  Y      ++PG +     R  +   Q           +E R S   R+ Q+
Sbjct: 220 MCNAPYRNLYSDSAPAIIPGASFEDILRYGLSQGQYAEALGREEDWLEERLSAHRRAEQE 279

Query: 453 MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSR 512
           M ++++  D RWL+I E    DGG + +  DIT  K  Q +L E+KRR            
Sbjct: 280 MEQQLR--DGRWLRIYERALSDGGRVGLRIDITEAKRIQQELVEAKRR------------ 325

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
                                  AE A+  KS FLA MSHE+RTP+N ++G +E++++  
Sbjct: 326 -----------------------AEEASHAKSAFLANMSHEIRTPMNGVVGMAELLRESA 362

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
             +  ++    Y   I  SG+ LL +IN+IL+ SKIE E++ +  +  DL   ++E + +
Sbjct: 363 LSDEQAL----YVDTIRNSGEALLVIINDILDYSKIEAERLQLKPEPFDLERTVHEVLLM 418

Query: 633 IGSSAQSKNIKIEKKIPSELF----FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
           +  +A+ K +++   +  ++F    F  D   +++I   ++ N++KFTN  G ++IR + 
Sbjct: 419 LQPTAREKGLEL--LVDYDMFLPTRFVGDPGRVRQIFTNLVGNAVKFTNE-GHVLIRIT- 474

Query: 689 IGQCVI-------ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
            G+CV         T+ DTGIGIP   +E I   F  + +  ++   G GLGLAI+  LT
Sbjct: 475 -GRCVEEGEAAVHATVEDTGIGIPPDKIEHIFGEFNQVEDDRNRQFEGTGLGLAITKRLT 533

Query: 742 NLHGGRLKIISQEGKGTIVTICM 764
           +L GG + + S+ G+G+   + M
Sbjct: 534 DLMGGEIWVESEAGRGSCFGLRM 556


>gi|159184529|ref|NP_353940.2| two component sensor kinase [Agrobacterium tumefaciens str. C58]
 gi|159139836|gb|AAK86725.2| two component sensor kinase [Agrobacterium tumefaciens str. C58]
          Length = 510

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/268 (36%), Positives = 161/268 (60%), Gaps = 12/268 (4%)

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           RR+ A ++D++     +ER + +++   A+       AE+AN  KS FLA +SHELRTPL
Sbjct: 205 RRIVAQLSDVTE----MERLRRDVARKAAE-------AESANDAKSRFLAAVSHELRTPL 253

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           NA+LGFS+++  E FG L + +  EY   I  SG HLL+++N +L+MSK+E  +  +  +
Sbjct: 254 NAVLGFSDILAGEYFGRLENDRQREYVGLIRQSGAHLLSVVNTMLDMSKLEAGRYELLME 313

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTN 677
           +  +   I     ++G  A+ K + +  +I   +   +AD+R I+++L  +  N+IKFT+
Sbjct: 314 SFPISETIASCEAMLGLQAKEKGLTLTSRIQRGIGEISADQRAIRQVLINLAGNAIKFTD 373

Query: 678 NNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
             G + I  ++ G  + +T++DTGIGI    +E +GQPF  + N+Y +   G GLGL++ 
Sbjct: 374 AGGVVSIDAAREGGMLKLTVSDTGIGIASDKIELLGQPFMQVQNEYTRRYEGTGLGLSLV 433

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMP 765
             L  LHGG   I S+  +GT+VTI +P
Sbjct: 434 KGLVALHGGTFVITSKPAEGTVVTITLP 461


>gi|307945357|ref|ZP_07660693.1| two-component sensor histidine kinase [Roseibium sp. TrichSKD4]
 gi|307771230|gb|EFO30455.1| two-component sensor histidine kinase [Roseibium sp. TrichSKD4]
          Length = 512

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 151/253 (59%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +EL  ANA     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+ G + + 
Sbjct: 244 SELETANALSDESRRRAEAANMAKSRFLATMSHELRTPLNAILGFSEVMKDEVLGPMQNE 303

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
           +Y  YA DIH SGQHLLN+IN IL++S+IE  +  + ++   +  I+ E + ++   A  
Sbjct: 304 QYKSYAADIHGSGQHLLNLINEILDLSRIEAGRHELQEEEISVTEIVEECLNMMQIRADD 363

Query: 640 KNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           +NI     +EK++P      AD+R +++++  +LSN++KFT   G + I    TS  GQ 
Sbjct: 364 RNITLHNHLEKEMPKVW---ADERAVRQVVLNLLSNAVKFTPIGGDVRITVGWTSGGGQY 420

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           V  ++ D G GIP+  +  + + F         +  G GLGL+I  AL N+HGG+  + S
Sbjct: 421 V--SVKDNGPGIPEDEIPVVMEAFGQGSMAIKSAEQGTGLGLSIVQALVNMHGGKFTLRS 478

Query: 753 QEGKGTIVTICMP 765
           +  +GT   + +P
Sbjct: 479 KMHEGTEALMTLP 491


>gi|209965994|ref|YP_002298909.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
 gi|209959460|gb|ACJ00097.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
          Length = 693

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/323 (32%), Positives = 177/323 (54%), Gaps = 19/323 (5%)

Query: 446 DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
           DP R  +M ++++   +      E    DG T+ +      L+++  Q+       + + 
Sbjct: 355 DPARRGEMLRQMREKGTVQDFEAEMRRRDGSTVWLSLTARALRNSAGQITS----FQGSC 410

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
            D++  R+ +E             +V  +++E AN+ K EFLA MSHELRTPLNAI+GFS
Sbjct: 411 EDVTERRRAVE-----------IMRVAMQQSEMANRAKGEFLANMSHELRTPLNAIIGFS 459

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           E+I  +  G +G+  Y EYA DIH SG+ LL++IN IL++S IET +  + ++  D+  +
Sbjct: 460 EIIAAQSLGPIGNPAYAEYASDIHDSGRVLLDVINEILDLSAIETGRRELKERTVDIGRV 519

Query: 626 INEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM- 683
           +   +RLI   A    + +E  +   L    AD+  +K+IL  +LSN++KFT   G++  
Sbjct: 520 VRGSLRLIRERALQGGVTLETALDETLPLVRADETALKQILSNLLSNAVKFTPPGGRITA 579

Query: 684 -IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
             R ++ G+ +++T+ DTGIG+    L    +PF  +     +  GG GLGL +  AL +
Sbjct: 580 GARETEDGR-MLLTVRDTGIGMRPEDLAHAMEPFRQVEKPLTRHAGGAGLGLPLVKALVD 638

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           LHGG  ++ S    GT+ ++ +P
Sbjct: 639 LHGGSFELESTPDAGTLASVWLP 661


>gi|163792591|ref|ZP_02186568.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159182296|gb|EDP66805.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 385

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 171/323 (52%), Gaps = 37/323 (11%)

Query: 449 RSQDMSKEIKLADSR---WLQINEWCTHD-GGTISVGTDITLLKHNQAQLRESKRRLKAT 504
           R  D   E+    +R   W+  N W  HD  G I+                      + T
Sbjct: 84  RVGDFVSEVYRMHTRERIWVSENAWSVHDEAGRIAF--------------------YEGT 123

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           + D+ T R   +RQ   LS A       +  AE A+  KS FLA MSHELR+PLNAI+GF
Sbjct: 124 VQDV-TDRVSADRQ---LSGA-------RRAAEAASDAKSTFLAVMSHELRSPLNAIIGF 172

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           +E+I   + G     +Y+EYA+DI  SG HLL +I++IL++SKI   K+ +D+Q+ D+  
Sbjct: 173 AEIIAGRLLGPT-DPRYFEYAEDIRVSGTHLLELISDILDLSKIGAGKMHLDEQHVDISN 231

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
           +     RL  ++  +  +++   +P+      AD   + +I+  +++N+IKFT   G + 
Sbjct: 232 LTRRTARLFAANLSTAQLELVNAVPTGFPILRADPVRLGQIIVNLVANAIKFTPPGGTIT 291

Query: 684 IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
           +        V+I ++DTGIG+    + +  +PF      +++S GG GLGL+I   LT+L
Sbjct: 292 VNAEDTTDAVLIKVSDTGIGMTAQEVARAPEPFVQSGRPFNKSRGGTGLGLSICRDLTSL 351

Query: 744 HGGRLKIISQEGKGTIVTICMPQ 766
           HGG L I S +G GT VTI +P+
Sbjct: 352 HGGTLTIDSVKGTGTTVTIHLPR 374


>gi|58616936|ref|YP_196135.1| putative sensor protein [Ehrlichia ruminantium str. Gardel]
 gi|58416548|emb|CAI27661.1| Putative sensor protein [Ehrlichia ruminantium str. Gardel]
          Length = 477

 Score =  178 bits (452), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 150/244 (61%), Gaps = 3/244 (1%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
            N K +  KE AE  N +KS+FLA +SHELRTPLN+I+GFSE+IK E  G + +  Y EY
Sbjct: 224 VNLKLKEAKEMAEQENISKSQFLANVSHELRTPLNSIIGFSEMIKSESLGPIENSDYKEY 283

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K+ I+    DL  I++    ++   A+   + +
Sbjct: 284 INDIHSSGVHLLSLINDILDFSKAEANKLVIEFIKFDLGKIVSSCFNMMIPRAEQAKVHL 343

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVIITIADTG 701
           EK +PS+ +   AD + IK+++  +LSNS+KFT  NG  K+++R +   + +II I DTG
Sbjct: 344 EKVLPSDKVVMVADPKRIKQVIINLLSNSMKFTPENGTVKLVVRYNLEDKLIIIEITDTG 403

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  L K+   F  + +++ +   G GLGL +S  L  L  G  KI S+   GT++T
Sbjct: 404 IGIAQQDLYKVMSVFGQVDSKHSRKYEGTGLGLPLSKKLVELMNGIFKIKSEPNSGTVIT 463

Query: 762 ICMP 765
           +  P
Sbjct: 464 LTFP 467


>gi|126730008|ref|ZP_01745820.1| cytoplasmic sensor hybrid histidine kinase [Sagittula stellata
           E-37]
 gi|126709388|gb|EBA08442.1| cytoplasmic sensor hybrid histidine kinase [Sagittula stellata
           E-37]
          Length = 841

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 125/397 (31%), Positives = 205/397 (51%), Gaps = 64/397 (16%)

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-----RSIIQDAQTR 437
           R+  A+E   +  V++D  DRL+MCN  Y+  Y      +VPG       R  +++ Q  
Sbjct: 197 RMWSAVEELPDGFVIYDAEDRLLMCNQPYRDYYKASAPAMVPGTTFEDILRYGLKNGQYA 256

Query: 438 PII-------EYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
             +       E R +   R  ++  E +L D RWL+I E  T DGG + +  DIT +K +
Sbjct: 257 EAVGREEEWLEDRLTK-HRFAELEHEQQLDDGRWLRIYERETTDGGRVGLRVDITQIKED 315

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           Q +L+E      ATI                             RAE AN+ KS FLA M
Sbjct: 316 QQRLKE------ATI-----------------------------RAEAANRAKSAFLANM 340

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHE+RTP+N ++G ++++++    EL   +   YA  I  SG+ LL +IN+IL+ SKIE 
Sbjct: 341 SHEIRTPMNGVVGMADLLRET---ELNDEQKL-YADTIRSSGEALLVIINDILDYSKIEA 396

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF----FNADKRIIKKILF 666
           EK+ ++ +  DL   I++ + L+  +A+ K+I +   +  ++F    F  D   +++IL 
Sbjct: 397 EKLVLNPEPFDLERAIHDVVMLLQPTARDKDITL--LVDYDMFLPTHFVGDPGRVRQILT 454

Query: 667 PILSNSIKFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHN 721
            ++ N++KFT   G +++R   + +      V IT+ DTGIGIP   +E +   F  + +
Sbjct: 455 NLVGNAVKFTVQ-GYVLVRVVGVMEDGGSTAVHITVEDTGIGIPADKVEHVFGEFNQVED 513

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           + ++   G GLGLAI+  L  L GG + + S+ G+G+
Sbjct: 514 ERNRKFEGTGLGLAITRRLVELMGGEVWVESEPGRGS 550



 Score = 38.1 bits (87), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 83/199 (41%), Gaps = 31/199 (15%)

Query: 301 AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI 360
           A  RL+    K++ E  + +    +K   +I   RH        +VR+Q  R +      
Sbjct: 16  AAERLLELKQKELFEANKRLGDHALKLSHEIRETRHEVA-----EVRSQHKRVVQE---- 66

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           +G A   TEK  +        ++L  A+E   +   ++D+  RL + N  Y   +   DH
Sbjct: 67  LGQA---TEKIEV------VTEQLWSAMETIRDGFAMFDEERRLELANPAYLSVFEGLDH 117

Query: 421 VLVPGNA-RSIIQDAQTRPIIEYRTSDP-----------ERSQDMSKEIKLADSRWLQIN 468
           +  PG     I+       +I+ +  DP           E+    +  ++L + R++++ 
Sbjct: 118 I-APGVPYPDILATFAEEGLIDLQGEDPKGWQLRMLARWEQDPIPNTTLRLWNGRFVKVR 176

Query: 469 EWCTHDGGTISVGTDITLL 487
           E    DGG +S+  DIT L
Sbjct: 177 ERHLPDGGIVSLTVDITDL 195


>gi|167645203|ref|YP_001682866.1| multi-sensor signal transduction histidine kinase [Caulobacter sp.
           K31]
 gi|167347633|gb|ABZ70368.1| multi-sensor signal transduction histidine kinase [Caulobacter sp.
           K31]
          Length = 579

 Score =  178 bits (451), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 142/221 (64%), Gaps = 3/221 (1%)

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLNAI+GFS++++  +FG L + +Y EYA+ IH SG+HLL++IN++L+M
Sbjct: 326 FLANMSHELRTPLNAIMGFSDIMRARMFGPL-TDRYGEYAELIHESGRHLLDLINDVLDM 384

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKI 664
           SKIE E+  + +   D    +   +RL+   A +  +++   + P++L  +AD+R +K+I
Sbjct: 385 SKIEAERFELQRGEFDAREAVTAAMRLLRVQADAAGVQLRGVLPPTDLEVDADRRALKQI 444

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           +  ++SN++KFT   G++ +          + +ADTG+GI    LE++G+P+E      D
Sbjct: 445 VLNLVSNALKFTPRGGQVTVTADGHDGEFELVVADTGVGISPEDLERLGRPYE-QAGGVD 503

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           Q   G GLGL++  A   LHGG + I S+ G GT V++ MP
Sbjct: 504 QRAKGTGLGLSLVRAFAKLHGGEMHIESRMGAGTSVSVRMP 544


>gi|294495585|ref|YP_003542078.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292666584|gb|ADE36433.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 736

 Score =  177 bits (450), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 161/269 (59%), Gaps = 11/269 (4%)

Query: 502 KATINDLSTSRQILE----RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
           K  + D+S S   LE    RQK E S+   +       AE AN+TKSEFLA MSHELRTP
Sbjct: 472 KEVVGDISFSLYNLELEATRQKGEESLIEGRIV-----AEEANRTKSEFLANMSHELRTP 526

Query: 558 LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
           LN+++GFS+V++      L   K  +Y ++I+ SG HLL +INNIL++SK+E+ K+    
Sbjct: 527 LNSVIGFSQVLETNSSNHLDD-KEQKYVKNIYESGSHLLELINNILDISKVESGKMDYLP 585

Query: 618 QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFT 676
           +  +L  II++ I L+   A+ K++ +   I SE L  + D+   K+I++ +LSN+IKFT
Sbjct: 586 ETVNLTEIIDDTIVLVEPMAKKKSVDLHLNIKSEDLEIHVDRLKFKEIMYNLLSNAIKFT 645

Query: 677 NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
              G + + +  + +   I+++DTGIG+PK   E I  PF+ + +   +S GG GLGLA+
Sbjct: 646 PEKGTVSVNSKCVNKNFQISVSDTGIGVPKEKFESIFDPFKQVDSTSSRSFGGTGLGLAL 705

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICMP 765
                 +HGG + + S+ G G+  T  +P
Sbjct: 706 VRKYVEMHGGEIWVESEVGVGSTFTFTLP 734


>gi|227819691|ref|YP_002823662.1| sensor-regulator protein [Sinorhizobium fredii NGR234]
 gi|227338690|gb|ACP22909.1| putative sensor-regulator protein [Sinorhizobium fredii NGR234]
          Length = 989

 Score =  177 bits (450), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 136/475 (28%), Positives = 236/475 (49%), Gaps = 66/475 (13%)

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTE----KYHLEK----------RY 377
           F +R  +G   WI++     RT  GG+  +G   D+TE    + HLE+          R 
Sbjct: 117 FKLRLNNG--TWIRISEG--RTRDGGL--VGAYTDITELEEQREHLEELVETTEAATERA 170

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN----------- 426
             A ++L  AIE + E   L+D +DRLV+ N+ Y+  +  P+  ++P             
Sbjct: 171 KAAQRQLLDAIESSLEGFALYDADDRLVVYNSRYRDFFSGPERAVLPAGPFAVETPGTPF 230

Query: 427 -------ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKL--ADSRWLQINEWCTHDGGT 477
                  A S +     + + E+     ER ++      L   D   ++++E  T DGGT
Sbjct: 231 ELVIRTFAESGLSPLDGQTVDEWIAQRLERHRNPRGPFNLMHKDGTTIRVSERKTSDGGT 290

Query: 478 ISVGTDITLLKHNQAQLRE--SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
           I V +DIT L+ ++ +L E  +KR  K            LER+  +L  +  + +  ++ 
Sbjct: 291 ICVYSDITELEEHRHRLEELVAKRTAK------------LERRTEQLRKSREELERARDA 338

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE A+  KSEFLA MSHE+RTP+N ++G +E+++     E    +   Y   I +S   L
Sbjct: 339 AEQASIAKSEFLANMSHEIRTPMNGVIGIAELLEGTELSE----QQRRYVSIILHSADTL 394

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--F 653
           +++IN+IL+ SKIE  ++ ++     L   + + ++ +   A  K +++   IP E+   
Sbjct: 395 MDLINDILDFSKIEAGRLELETIPFVLRDTLGDTLQTLAKRAADKGLELACHIPPEVPDH 454

Query: 654 FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSA 708
              D   +++I+  ++ N+IKFT  NG++++  + +GQ      +   + DTGIGIP++ 
Sbjct: 455 LMGDPTRLRQIIVNLVGNAIKFT-ENGEVVVDVTLVGQGDHGAHLQFEVRDTGIGIPEAQ 513

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
            E+I + F        +  GG GLGLAI+  L    GGR+++ S+ G G++ T  
Sbjct: 514 QERIFEAFAQADASTTRQYGGTGLGLAIAAQLAEKMGGRMQLDSKPGVGSVFTFA 568



 Score = 45.1 bits (105), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 18/126 (14%)

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAY------GLPDHVLVPGNARSIIQDAQTR 437
           L   IE   E  VL+D +DR+V  N+ +++ +      G+    L+    RS ++     
Sbjct: 38  LLDGIESALEGFVLYDADDRMVAFNSRFEELFSPRVKLGMRFEDLI----RSAVEQG-VA 92

Query: 438 PIIEY-------RTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHN 490
           P+ E        R  +  R+     +++L +  W++I+E  T DGG +   TDIT L+  
Sbjct: 93  PVGELGVEEWVARRMERHRNPGPPFKLRLNNGTWIRISEGRTRDGGLVGAYTDITELEEQ 152

Query: 491 QAQLRE 496
           +  L E
Sbjct: 153 REHLEE 158


>gi|329849848|ref|ZP_08264694.1| histidine protein kinase divJ [Asticcacaulis biprosthecum C19]
 gi|328841759|gb|EGF91329.1| histidine protein kinase divJ [Asticcacaulis biprosthecum C19]
          Length = 570

 Score =  177 bits (450), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 149/241 (61%), Gaps = 14/241 (5%)

Query: 495 RESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHEL 554
           R +  RL   ++D S    ++  ++  L       +  +  AE+ N++K++FLA MSHEL
Sbjct: 280 RGADNRLHGVLSDAS----LIHAREVSL-------EASRAEAESLNQSKTKFLASMSHEL 328

Query: 555 RTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKIS 614
           RTPLNA++GFS+++++++FG+L S KY EYAQ I  SGQH+L+MIN++L+MSKIE +K  
Sbjct: 329 RTPLNAVIGFSDIMRQKLFGDL-SPKYTEYAQLIWESGQHVLDMINDVLDMSKIEAQKYE 387

Query: 615 IDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFFNADKRIIKKILFPILSNSI 673
           +  +  DL   ++  +RLI ++A  K I+I   +P S L   ADKR IK+I   +LSN++
Sbjct: 388 LTLETFDLREPVSGALRLIRAAAHDKAIEITSTMPVSSLTVTADKRAIKQICLNLLSNAV 447

Query: 674 KFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
           KFT   G + +        V ITI DTGIGI    L ++GQP+E      +Q   G GLG
Sbjct: 448 KFTPKGGDVALVLGHSANEVEITIRDTGIGIAPDDLSRLGQPYEQ-AGPAEQKAMGTGLG 506

Query: 734 L 734
           L
Sbjct: 507 L 507


>gi|56416592|ref|YP_153666.1| histidine kinase sensor protein [Anaplasma marginale str. St.
           Maries]
 gi|255002934|ref|ZP_05277898.1| histidine kinase sensor protein (barA) [Anaplasma marginale str.
           Puerto Rico]
 gi|56387824|gb|AAV86411.1| histidine kinase sensor protein [Anaplasma marginale str. St.
           Maries]
          Length = 468

 Score =  177 bits (450), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN + Q +KE AE  + +KS+FLA +SHELRTPLN+I+GFSE+I+ E  G +GS +Y EY
Sbjct: 215 ANLELQEQKETAERESVSKSQFLANVSHELRTPLNSIIGFSEIIQSESLGPIGSEEYKEY 274

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K++++    DL  I++    ++   A+   +++
Sbjct: 275 INDIHQSGVHLLSLINDILDFSKAEANKLTVEFVKFDLGKIVDSSFTMVLPRAKDAKVEL 334

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +K++P E +   AD + +K+++  +LSNS+KFT   G + +     G+ +I+ I+DTGIG
Sbjct: 335 KKEMPEEPIVMLADPKRMKQVIINVLSNSVKFTPEGGLVKLCAEIRGEQLIVEISDTGIG 394

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L K+   F    + + +   G GLGL +S  L  L  G   I S+   GTIVT+ 
Sbjct: 395 IAQQDLYKVMSVFGQADSTHSRKYEGTGLGLPLSKKLVELMQGTFSIKSEPNLGTIVTLT 454

Query: 764 MPQ 766
            P 
Sbjct: 455 FPH 457


>gi|150395841|ref|YP_001326308.1| histidine kinase [Sinorhizobium medicae WSM419]
 gi|150027356|gb|ABR59473.1| histidine kinase [Sinorhizobium medicae WSM419]
          Length = 525

 Score =  177 bits (449), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 141/227 (62%), Gaps = 1/227 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAILGFS+V+  E FG+L + +  EY   IH SG HLL+++
Sbjct: 237 NDAKTRFLAAVSHELRTPLNAILGFSDVLAGEYFGKLENDRQREYVSLIHQSGTHLLSVV 296

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N +L+MSKIE  +  + ++   +   I     ++   A+ K +++  ++   +   NAD+
Sbjct: 297 NTMLDMSKIEAGRYELLREPFRVAEAIAACEAMLSHQAREKGVRLASRVTRSVGEINADQ 356

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R +++IL  ++ N+IKFT+  G + +  ++ G  + +T++DTGIGI    L+ +GQPF  
Sbjct: 357 RAVQQILINLVGNAIKFTDRGGLVTVDAAREGALLKLTVSDTGIGIAADKLKMLGQPFVQ 416

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + N Y +   G GLGL++   L  LHGG + I S EG+GT V + +P
Sbjct: 417 IQNDYTRRYEGTGLGLSLVKGLAELHGGDVSIRSAEGEGTEVVVSIP 463


>gi|7272187|gb|AAA23034.2| histidine protein kinase [Caulobacter crescentus CB15]
          Length = 597

 Score =  177 bits (449), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 144/231 (62%), Gaps = 3/231 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE     ++ FLA MSHELRTPLNAI+GFS++++  +FG L S +Y EYA+ IH SG HL
Sbjct: 322 AEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPL-SDRYAEYAELIHESGGHL 380

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFF 654
           L++IN++L+MSKIE E+  + +   D    +   +RL+   + +  +++   +P  EL  
Sbjct: 381 LDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEV 440

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD+R +K+I+  ++SN++KFT   G++ +        + I +ADTG+GI    LE++G+
Sbjct: 441 DADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGR 500

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P+E      +Q   G GLGL++  A   L GG + I S+ G GT V++ +P
Sbjct: 501 PYE-QAGGAEQRARGTGLGLSLVRAFAQLLGGEMVIESRLGAGTTVSVRLP 550


>gi|21229307|ref|NP_635229.1| two component system histidine kinase [Methanosarcina mazei Go1]
 gi|20907888|gb|AAM32901.1| Two component system histidine kinase [Methanosarcina mazei Go1]
          Length = 892

 Score =  177 bits (449), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 139/439 (31%), Positives = 222/439 (50%), Gaps = 42/439 (9%)

Query: 332 FHM--RHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIE 389
           F M  R  +G  I ++V +  +    G   I  +A D+T +   EK   E+ +RL K I+
Sbjct: 166 FEMKFRKQNGEVIDVEVSSSFLSLEEG--EIQCVARDITTRKKAEKNERESRERLKKIID 223

Query: 390 CTSEALVLWDKND-RLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTR--PIIEYRTSD 446
                ++L D +   +V  N    +A GLP H L        I   +    PI +++   
Sbjct: 224 NALCGILLVDASTHEIVDANPAAVEAIGLPGHRLTGNVCHKFICPVEEGKCPITDFK--- 280

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
             +S D S+ + L               G +  V   +  +K  + +       L  +  
Sbjct: 281 --QSVDKSERMLL------------NGKGESFPVLKSVVPVKIGENEY------LIESFI 320

Query: 507 DLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE 566
           DLS      ER+KTE  +  AK       AE+AN+ KSEFL  MSHELRTPL AI+GFS+
Sbjct: 321 DLS------ERKKTEEELLQAKLA-----AESANRAKSEFLTNMSHELRTPLTAIIGFSD 369

Query: 567 VIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPII 626
           V+   I GE  S +  ++  +I  SG+HLL +INNIL++SKIE  K+ ++ +   +  + 
Sbjct: 370 VMLGGISGEF-SEQNKKFLNNIANSGKHLLTLINNILDLSKIEAGKMELEFEMFSVSEVF 428

Query: 627 NEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           N+   +  + A  K+I ++  + SE+   AD+   K+I++ ++SN+IKFT + G +++  
Sbjct: 429 NDTRAVTSALALKKDISMKYNVDSEILVYADRVRFKQIIYNLVSNAIKFTPDRGSVIVSA 488

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            K    V I+++DTGIGI +   + + QPF  +    ++   G GLGLA+     NLHGG
Sbjct: 489 LKTEDSVRISVSDTGIGISEENQKLLFQPFRQIDASINRHYEGTGLGLALVKKFVNLHGG 548

Query: 747 RLKIISQEGKGTIVTICMP 765
           R+   S+ GKG+     +P
Sbjct: 549 RVWAESEPGKGSTFEFELP 567


>gi|255004059|ref|ZP_05278860.1| histidine kinase sensor protein (barA) [Anaplasma marginale str.
           Virginia]
          Length = 442

 Score =  177 bits (449), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN + Q +KE AE  + +KS+FLA +SHELRTPLN+I+GFSE+I+ E  G +GS +Y EY
Sbjct: 189 ANLELQEQKETAERESVSKSQFLANVSHELRTPLNSIIGFSEIIQSESLGPIGSEEYKEY 248

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K++++    DL  I++    ++   A+   +++
Sbjct: 249 INDIHQSGVHLLSLINDILDFSKAEANKLTVEFVKFDLGKIVDSSFTMVLPRAKDAKVEL 308

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +K++P E +   AD + +K+++  +LSNS+KFT   G + +     G+ +I+ I+DTGIG
Sbjct: 309 KKEMPEEPIVMLADPKRMKQVIINVLSNSVKFTPEGGLVKLCAEIRGEQLIVEISDTGIG 368

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L K+   F    + + +   G GLGL +S  L  L  G   I S+   GTIVT+ 
Sbjct: 369 IAQQDLYKVMSVFGQADSTHSRKYEGTGLGLPLSKKLVELMQGTFSIKSEPNLGTIVTLT 428

Query: 764 MPQ 766
            P 
Sbjct: 429 FPH 431


>gi|150395544|ref|YP_001326011.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            medicae WSM419]
 gi|150027059|gb|ABR59176.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            medicae WSM419]
          Length = 1138

 Score =  177 bits (448), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 164/271 (60%), Gaps = 14/271 (5%)

Query: 504  TINDLSTS-------RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            TI  LS+S       R I + ++TE  + NAK       AETAN  K+EFLA++SHE+RT
Sbjct: 866  TIGRLSSSNGYCAVIRDITQWKRTEEELRNAKRA-----AETANAHKTEFLARVSHEIRT 920

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLNAI+GFS+++  E FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D
Sbjct: 921  PLNAIIGFSDMMASEHFGPIGHPRYIEYAGDIGRSGRHVLDIVNDLLDISKIEAGEMDLD 980

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKF 675
                DL   ++E + L+   A S+ + I   +   +    AD R IK+I   IL+N+I+F
Sbjct: 981  FGAVDLNEAVSEAVSLVQPQANSQRVIIRTSLSGSVPEVVADDRSIKQIALNILANAIRF 1040

Query: 676  TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            T + G++++ TS +    VI+ I DTGIG+ ++ L++  +PF  +     +   G GLGL
Sbjct: 1041 TPSGGQIVVSTSYEANGSVILRIRDTGIGMTRNELDQAMKPFRQVTTGGRKRGDGTGLGL 1100

Query: 735  AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             ++ A+T  +  +  I S   +GT+V +  P
Sbjct: 1101 PLTKAMTEANRAQFAITSAPNEGTLVEVSFP 1131


>gi|420780|pir||A46414 histidine protein kinase divJ - Caulobacter crescentus
          Length = 596

 Score =  177 bits (448), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 144/231 (62%), Gaps = 3/231 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE     ++ FLA MSHELRTPLNAI+GFS++++  +FG L S +Y EYA+ IH SG HL
Sbjct: 321 AEALAAGRARFLANMSHELRTPLNAIMGFSDIMRARMFGPL-SDRYAEYAELIHESGGHL 379

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFF 654
           L++IN++L+MSKIE E+  + +   D    +   +RL+   + +  +++   +P  EL  
Sbjct: 380 LDLINDVLDMSKIEAERFELQRGVFDAREAVQAAMRLLRVQSDTAGVQLRGVLPPGELEV 439

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD+R +K+I+  ++SN++KFT   G++ +        + I +ADTG+GI    LE++G+
Sbjct: 440 DADRRALKQIVLNLVSNALKFTPRGGQVTVTAHGYDGVLEIVVADTGVGISPEDLERLGR 499

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P+E      +Q   G GLGL++  A   L GG + I S+ G GT V++ +P
Sbjct: 500 PYE-QAGGAEQRARGTGLGLSLVRAFAQLLGGEMVIESRLGAGTTVSVRLP 549


>gi|222474959|ref|YP_002563374.1| histidine kinase sensor protein (barA) [Anaplasma marginale str.
           Florida]
 gi|222419095|gb|ACM49118.1| histidine kinase sensor protein (barA) [Anaplasma marginale str.
           Florida]
          Length = 474

 Score =  177 bits (448), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 150/243 (61%), Gaps = 1/243 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN + Q +KE AE  + +KS+FLA +SHELRTPLN+I+GFSE+I+ E  G +GS +Y EY
Sbjct: 221 ANLELQEQKETAERESVSKSQFLANVSHELRTPLNSIIGFSEIIQSESLGPIGSEEYKEY 280

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK E  K++++    DL  I++    ++   A+   +++
Sbjct: 281 INDIHQSGVHLLSLINDILDFSKAEANKLTVEFVKFDLGKIVDSSFTMVLPRAKDAKVEL 340

Query: 645 EKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           +K++P E +   AD + +K+++  +LSNS+KFT   G + +     G+ +I+ I+DTGIG
Sbjct: 341 KKEMPEEPIVMLADPKRMKQVIINVLSNSVKFTPEGGLVKLCAEIRGEQLIVEISDTGIG 400

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L K+   F    + + +   G GLGL +S  L  L  G   I S+   GTIVT+ 
Sbjct: 401 IAQQDLYKVMSVFGQADSTHSRKYEGTGLGLPLSKKLVELMQGTFSIKSEPNLGTIVTLT 460

Query: 764 MPQ 766
            P 
Sbjct: 461 FPH 463


>gi|288962184|ref|YP_003452479.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
 gi|288914450|dbj|BAI75935.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
          Length = 882

 Score =  177 bits (448), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 91/279 (32%), Positives = 157/279 (56%), Gaps = 3/279 (1%)

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
           +  +AQL  ++ R   T+   S  R    R  T L  A    +  ++ AE AN  K EFL
Sbjct: 308 RERRAQLALAEAR--NTVERTSAERDESARLATALDHARDMAETARQAAEAANHAKGEFL 365

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A +SHELRTPLNA++GF+++I +E  G +G+  Y +YA ++  SGQH+L +IN IL+ ++
Sbjct: 366 AGLSHELRTPLNAVIGFADLIAREAEGPVGTPSYRQYAANVRDSGQHVLELINEILDHAR 425

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILF 666
            E   ++I++   DL    +  +R++   A+   + +   + P+      D R I++IL 
Sbjct: 426 AEAGALTIEEGRCDLEAAADFAVRMLTPRAERAGVLLTAAVMPAARMLRGDDRRIRQILL 485

Query: 667 PILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            ++ N +K+T + G + +         +I + DTG+GIP   ++++ +PF  + +  +++
Sbjct: 486 NLIGNGVKYTPSGGSVTLSVLLEEGVPVIRVTDTGLGIPAGDVDRVLEPFARVESAANRA 545

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + G GLGL ++  L  LHGG L + S  G GT VT+ +P
Sbjct: 546 VEGAGLGLPLTRRLVELHGGVLTLRSTLGVGTTVTVRLP 584


>gi|312113023|ref|YP_004010619.1| integral membrane sensor signal transduction histidine kinase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311218152|gb|ADP69520.1| integral membrane sensor signal transduction histidine kinase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 508

 Score =  177 bits (448), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 99/254 (38%), Positives = 148/254 (58%), Gaps = 4/254 (1%)

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           +R   EL  A A     + RAE AN  KS+FLA MSHELRTPLNAI+GFSE+IK E+ G 
Sbjct: 222 DRLIEELERAKAASDEARVRAEAANVAKSKFLANMSHELRTPLNAIMGFSEMIKDEVLGP 281

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           + +  Y  YA DIH SG HLL +IN IL++S+IE  +  + ++  D+     E +RL+  
Sbjct: 282 IDNENYRSYAADIHESGSHLLKLINEILDLSRIEAGRYELTEKPIDVAATALESLRLMRI 341

Query: 636 SAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI--GQC 692
            A  KN+++     P      AD+R +++I   +LSN+IKFT ++G + +R   +  G+ 
Sbjct: 342 DAHQKNLRVVTDFRPDMPRIMADERALRQICLNLLSNAIKFTPDSGLIAVRAGILPSGEA 401

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           V +++ D G GIP+  + ++ + F            G GLGL I   L  LHGGR ++ S
Sbjct: 402 V-LSVRDNGPGIPEEEISQVLRAFGQGSLALKTGESGTGLGLPIVSGLAELHGGRFELRS 460

Query: 753 QEGKGTIVTICMPQ 766
           + G GT  ++ +P+
Sbjct: 461 KLGVGTEASLILPK 474


>gi|170748167|ref|YP_001754427.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170654689|gb|ACB23744.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 511

 Score =  177 bits (448), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 106/273 (38%), Positives = 157/273 (57%), Gaps = 7/273 (2%)

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
           S+R   +T+  L  SR   +    EL  A A     + RAE AN  KS FLA MSHELRT
Sbjct: 213 SRRLYTSTVGALR-SRAEKDAVFGELEQAKANSDEARRRAEEANLAKSRFLATMSHELRT 271

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           PLNAILGFSEV+K E+FG   +  Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++
Sbjct: 272 PLNAILGFSEVMKNEVFGTHTAPSYREYSHDIHDSGMHLLNLINEILDLSRIEAGRYELN 331

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKF 675
           ++   L  ++ E   ++G  A++KN      +   L    AD+R +++I+  +LSN++KF
Sbjct: 332 EEPVQLAHVVEECRHMMGLRAKAKNQTFHDLVDGSLPRLWADERALRQIVLNLLSNAVKF 391

Query: 676 TNNNGKMMIR---TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           T   G++ ++   T+  GQ V  ++ D+G GIP+  L  +   F         +  G GL
Sbjct: 392 TPPGGEIWLKVGWTASGGQYV--SVKDSGPGIPEDELGTVLSSFGRGSLAIKTAEQGSGL 449

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GL I   L  LHGG+ ++ S+  +GT V + +P
Sbjct: 450 GLPIVKGLVELHGGQFQLSSKPREGTEVVVTLP 482


>gi|27378849|ref|NP_770378.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
 gi|27351998|dbj|BAC49003.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
          Length = 546

 Score =  176 bits (447), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/252 (41%), Positives = 149/252 (59%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE+AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 256 ELEQAKAISDEARHRAESANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPV 315

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ I+ +   L+   A S+
Sbjct: 316 YKEYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVSLVGIVADCHHLMKLRASSR 375

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P      AD+R I++++  +LSNSIKFT   G++ ++   T+  GQ  
Sbjct: 376 GITIHEVFEQAMPR---LWADERAIRQVVLNLLSNSIKFTPQGGEIWLKAGWTASGGQ-- 430

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+  L +LHGG   + S+
Sbjct: 431 YLSVRDTGSGIPEDEIPVVLASFGQGSNSIKSAEQGAGLGLPIAKNLIDLHGGTFTLKSK 490

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 491 LRIGTEVIVTFP 502


>gi|163793550|ref|ZP_02187525.1| two component sensor kinase [alpha proteobacterium BAL199]
 gi|159181352|gb|EDP65867.1| two component sensor kinase [alpha proteobacterium BAL199]
          Length = 414

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 142/232 (61%), Gaps = 11/232 (4%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           + +K+ FLA MSHELRTPLNAI+G SE+I+ E++G +G  KY EYA DI+ SG HLL++I
Sbjct: 181 SDSKTRFLANMSHELRTPLNAIIGMSELIRSELWGAVGHPKYAEYATDINDSGLHLLDLI 240

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKR 659
           N+IL+ S++E  K+++  ++ D+  ++ +  R I    + +++    ++       AD+R
Sbjct: 241 NDILDFSRVEMGKVTLHDEDIDVTDLLEQSRRTIAGLLEERDLTCVVRVSGSPILTADRR 300

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPFEP 718
            ++++L  +LSN++K T   G++ I +   GQ  + I + DTG GIP   LE I +PF  
Sbjct: 301 AMRQMLLNLLSNAVKHTPPGGRVTITSDVDGQGGLAIVVEDTGRGIPAERLEWITEPF-- 358

Query: 719 LHNQYDQSI-----GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                D+ I     GG GLGLAI+  L   HGG++ I S EG GT V +  P
Sbjct: 359 ---NVDEEISVTRQGGAGLGLAITKRLVERHGGQISIDSSEGFGTSVRLSFP 407


>gi|294496206|ref|YP_003542699.1| multi-sensor signal transduction histidine kinase [Methanohalophilus
            mahii DSM 5219]
 gi|292667205|gb|ADE37054.1| multi-sensor signal transduction histidine kinase [Methanohalophilus
            mahii DSM 5219]
          Length = 1108

 Score =  176 bits (445), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/232 (42%), Positives = 145/232 (62%), Gaps = 2/232 (0%)

Query: 535  RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            +AE ANK+KSEFLA MSHELRTPLN+I+GFS+++  E FG+L + K  +Y  +I+ SG+H
Sbjct: 856  QAEYANKSKSEFLANMSHELRTPLNSIIGFSDILNGETFGKL-TQKQEKYTANINKSGKH 914

Query: 595  LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
            LL +IN IL++SKIE  K+     +  L  + ++   +I   AQ K+I +E     ++  
Sbjct: 915  LLYLINEILDLSKIEAGKMEFVCDDFKLNSVFSDIESIISLQAQKKSIDLEISKSVDIEI 974

Query: 655  NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIGIPKSALEKIG 713
            NADK  IK+I+F +LSN+IKFT+ NG++ +   K+ +  V I + DTGIGIP+   E I 
Sbjct: 975  NADKSKIKQIIFNLLSNAIKFTDENGRVSMSARKVDRDRVEIAVKDTGIGIPEDKFETIF 1034

Query: 714  QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             PF  +     +  GG GLGLA+       HGG + + S+ GKG+     +P
Sbjct: 1035 DPFMQVDASTSRKYGGTGLGLALVKKYVEKHGGEVWVESEIGKGSTFMFTIP 1086


>gi|307318980|ref|ZP_07598411.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            meliloti AK83]
 gi|306895394|gb|EFN26149.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            meliloti AK83]
          Length = 1133

 Score =  176 bits (445), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 163/271 (60%), Gaps = 14/271 (5%)

Query: 504  TINDLSTS-------RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            TI  LS+S       R I + ++TE  + NAK       AETAN  K+EFLA++SHE+RT
Sbjct: 861  TIGRLSSSNGYCAVIRDITQWKRTEEELRNAKRA-----AETANAHKTEFLARVSHEIRT 915

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLNAI+GFS+++  E FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D
Sbjct: 916  PLNAIIGFSDMMASEHFGPIGHPRYIEYAGDIGRSGRHVLDIVNDLLDISKIEAGEMDLD 975

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKF 675
                DL   ++E + L+   A S+ + I   +   +    AD R IK+I   IL+N+I+F
Sbjct: 976  FGAVDLNEAVSEAVSLVQPQANSQRVIIRTSLSGSVPEVVADDRSIKQIALNILANAIRF 1035

Query: 676  TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            T + G++++ TS +    VI+ I DTGIG+ ++ L++  +PF  +     +   G GLGL
Sbjct: 1036 TPSGGQIVVSTSYEANGSVILRIRDTGIGMTRNELDQAMKPFRQVTTGGRKRGDGTGLGL 1095

Query: 735  AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             ++ A+   +  +  I S   +GT+V I  P
Sbjct: 1096 PLTKAMAEANRAQFAITSAPNEGTLVEISFP 1126


>gi|154251811|ref|YP_001412635.1| histidine kinase [Parvibaculum lavamentivorans DS-1]
 gi|154155761|gb|ABS62978.1| histidine kinase [Parvibaculum lavamentivorans DS-1]
          Length = 288

 Score =  176 bits (445), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/274 (39%), Positives = 163/274 (59%), Gaps = 8/274 (2%)

Query: 495 RESKRRLKATINDLSTS-RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
           + S+ R K+ +   ST+  +++ RQ++E+++ +AK +     A+ A++TKSEFLA MSHE
Sbjct: 5   KASRGRRKSLLAGYSTNLGELMSRQRSEVALRSAKIE-----ADMASRTKSEFLANMSHE 59

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAI+GFSE I+        S K  EYA  I  +G+HLLN+I++IL+++KIE+   
Sbjct: 60  LRTPLNAIIGFSEFIQHIAASGKPSEKTGEYATHIAGAGRHLLNIISDILDIAKIESGTF 119

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIE-KKIPSELFFNADKRIIKKILFPILSNS 672
           S+  +  D+  +++  I LI    + K   +E K  PS      D R IK++L  +LSN+
Sbjct: 120 SLATEPYDVRELVDACIVLIEPRIREKKQVLEIKADPSLPEVPVDARRIKQVLINLLSNA 179

Query: 673 IKFTNNNGKM-MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
            KFT   G++ ++ T      V I +ADTGIG+ K  +     PF  +   Y +   G G
Sbjct: 180 HKFTGEGGRIVLVATQTPDGGVTIAVADTGIGMTKEQISHALTPFGQVQASYARGHEGTG 239

Query: 732 LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LGL I+ ALT LHGG  +I S+ GKGT V   +P
Sbjct: 240 LGLPIAAALTTLHGGEFQIFSEPGKGTTVFFTLP 273


>gi|71908897|ref|YP_286484.1| PAS/PAC sensor signal transduction histidine kinase [Dechloromonas
           aromatica RCB]
 gi|71848518|gb|AAZ48014.1| PAS/PAC sensor signal transduction histidine kinase [Dechloromonas
           aromatica RCB]
          Length = 856

 Score =  176 bits (445), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 199/408 (48%), Gaps = 57/408 (13%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           D+ +++  E +     QRL  AIE   +A  L+D  DRL++ N  + + +      +  G
Sbjct: 348 DIADRHAAEIKLQRFQQRLVDAIEAMDDAFALFDGEDRLILHNLRFAELFSPESSTIRIG 407

Query: 426 NARS-IIQDAQTRPIIEYRTS----------DPERSQDMSKEIKLADSRWLQINEWCTHD 474
            + S  I D   + +    T           +  R    S EI LA+  WL+I E  T +
Sbjct: 408 MSFSEFIHDIAVQGLYPQTTDGGNDWLATRMEMHRQAAGSSEIPLANGSWLRITERHTRE 467

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GGT+ + +D++ LK          R L A                               
Sbjct: 468 GGTVVIWSDVSNLK----------RALIA------------------------------- 486

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            A+  ++ KSEFLA+MSHELRTPLNAILGF+ V++K+    L   +  EY   I + GQH
Sbjct: 487 -ADQGSQAKSEFLARMSHELRTPLNAILGFARVLEKDAASPLNDAQQ-EYVHHILHGGQH 544

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
           LL +IN IL++S IE+ K+ ++ ++ DL  +++E + LI   A ++ I ++         
Sbjct: 545 LLGLINEILDLSAIESGKLKVEIEDIDLPSVLHECLALIKPLASNREITLKISGSESATV 604

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD++ +K++L  +LSN+IK+  + G++ +        + + I+DTG GIP    +++ Q
Sbjct: 605 AADRKRLKQVLLNLLSNAIKYNRHGGEVQVNIGATPSGIRLDISDTGQGIPPELAQRVFQ 664

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           PF+ L  +  +   G G+GLAI+  L  L GG +   S    GT   +
Sbjct: 665 PFDRLGLENSE---GTGIGLAITRRLVELMGGSICFESTVNIGTTFRV 709


>gi|88658417|ref|YP_507680.1| sensor histidine kinase [Ehrlichia chaffeensis str. Arkansas]
 gi|88599874|gb|ABD45343.1| sensor histidine kinase [Ehrlichia chaffeensis str. Arkansas]
          Length = 470

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 150/244 (61%), Gaps = 3/244 (1%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN K +  KE AE  N +KS+FLA +SHELRTPLN+I+GFSE++K E  G + +V Y EY
Sbjct: 217 ANLKLKEAKEVAEQENVSKSQFLANVSHELRTPLNSIIGFSEMMKAESMGAIENVHYKEY 276

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH +G HLL++IN+IL+ SK E +K+ ++    DL  +I+    +I   A+   +++
Sbjct: 277 INDIHNAGVHLLSLINDILDFSKAEADKLVVEFVKFDLGKVISSCFNMILPRAEEAKVRL 336

Query: 645 EKKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVIITIADTG 701
           E+ +PS ++   AD + +K+++  +LSNSIKFT  NG  K+++        ++I + D G
Sbjct: 337 EQVLPSNQIIMVADPKRMKQVIINLLSNSIKFTPENGCVKLVVEYDLENSMIVIEVIDNG 396

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  L K+   F  + +++ +   G GLGL +S  L  L  G  KI S+   GTIVT
Sbjct: 397 IGIAQQDLYKVMSVFGQVDSRHARKYEGTGLGLPLSKKLVELMDGVFKIKSEPNLGTIVT 456

Query: 762 ICMP 765
           +  P
Sbjct: 457 LMFP 460


>gi|15964474|ref|NP_384827.1| putative sensor histidine kinase protein [Sinorhizobium meliloti
            1021]
 gi|307308417|ref|ZP_07588121.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            meliloti BL225C]
 gi|15073651|emb|CAC45293.1| Two-component histidine kinase, stationary-phase regulator of cell
            surface physiology and symbiosis [Sinorhizobium meliloti
            1021]
 gi|306901020|gb|EFN31628.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
            meliloti BL225C]
          Length = 1134

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 163/271 (60%), Gaps = 14/271 (5%)

Query: 504  TINDLSTS-------RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            TI  LS+S       R I + ++TE  + NAK       AETAN  K+EFLA++SHE+RT
Sbjct: 862  TIGRLSSSNGYCAVIRDITQWKRTEEELRNAKRA-----AETANAHKTEFLARVSHEIRT 916

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLNAI+GFS+++  E FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D
Sbjct: 917  PLNAIIGFSDMMASEHFGPIGHPRYIEYAGDIGRSGRHVLDIVNDLLDISKIEAGEMDLD 976

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKF 675
                DL   ++E + L+   A S+ + I   +   +    AD R IK+I   IL+N+I+F
Sbjct: 977  FGAVDLNEAVSEAVSLVQPQANSQRVIIRTSLSGSVPEVVADDRSIKQIALNILANAIRF 1036

Query: 676  TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            T + G++++ TS +    VI+ I DTGIG+ ++ L++  +PF  +     +   G GLGL
Sbjct: 1037 TPSGGQIVVSTSYEANGSVILRIRDTGIGMTRNELDQAMKPFRQVTTGGRKRGDGTGLGL 1096

Query: 735  AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             ++ A+   +  +  I S   +GT+V I  P
Sbjct: 1097 PLTKAMAEANRAQFAITSAPNEGTLVEISFP 1127


>gi|88606773|ref|YP_505514.1| sensor histidine kinase [Anaplasma phagocytophilum HZ]
 gi|88597836|gb|ABD43306.1| Sensor histidine kinase PleC [Anaplasma phagocytophilum HZ]
          Length = 470

 Score =  175 bits (444), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 149/242 (61%), Gaps = 1/242 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN + Q +KE AE  + +KS+FLA +SHELRTPLN+I+GFSE++++E  G LG+ +Y EY
Sbjct: 217 ANLELQEKKENAEKESVSKSQFLANVSHELRTPLNSIIGFSEIVQRESLGPLGNAQYKEY 276

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
            ++I+++G HLL++IN+IL+ SK E  K+S++    DL  I++    ++   AQ   +++
Sbjct: 277 IKEINHAGVHLLSLINDILDFSKAEANKLSVELVKCDLRKIVDSCFNMMLPKAQEAKVEL 336

Query: 645 EKKIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
           ++ +P S++    D R +K+++  IL+NS+KFT   G + +   K  + V+I I D GIG
Sbjct: 337 KRDMPESQIVLMVDARRMKQVILNILTNSMKFTPEKGFVRLSVEKKQEEVVIEICDNGIG 396

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +  L K+   F    + + +   G GLGL +S  L  L  G   I  +   GT+VT+ 
Sbjct: 397 IAQQDLYKVMSVFGQADSTHSRKYEGTGLGLPLSKKLVELMNGTFSIKGEANLGTVVTLS 456

Query: 764 MP 765
            P
Sbjct: 457 FP 458


>gi|294496151|ref|YP_003542644.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292667150|gb|ADE36999.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 732

 Score =  175 bits (444), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 157/252 (62%), Gaps = 6/252 (2%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I E+++ E +I  AK       AE AN+TKS+FLA MSHELRTPLN+I+GFS+V+ +E F
Sbjct: 482 ITEKKEAEKAIIEAK-----GMAEAANQTKSQFLANMSHELRTPLNSIIGFSDVLLEEAF 536

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G+L   K  +Y  +I+ SG HLL++IN+IL++SKIE  K+ ++ +N  L  II+E    +
Sbjct: 537 GKLNE-KQKKYTHNINTSGHHLLDIINDILDLSKIEAGKMELNPENFGLEEIISELKNTL 595

Query: 634 GSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCV 693
               + K + ++     E    ADK  IK++L+ +LSN+IKFT   GK+ I      + +
Sbjct: 596 EPLVKKKQLILDLDTSLEYPVYADKLKIKQVLYNLLSNAIKFTPEKGKIAIDIDCGEEEI 655

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            I+++D+GIGIP    +K+ QPF  + +  ++   G GLGLA+   +  +HGG++ + S+
Sbjct: 656 TISVSDSGIGIPPEEQDKLFQPFRQIDSDSNRQYQGTGLGLALVKNIIEMHGGQIWVESE 715

Query: 754 EGKGTIVTICMP 765
            GKG+     +P
Sbjct: 716 AGKGSTFKFTLP 727


>gi|307319436|ref|ZP_07598863.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306894808|gb|EFN25567.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
           meliloti AK83]
          Length = 531

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 139/227 (61%), Gaps = 1/227 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAILGFS+V+  E FG+L + +  EY   IH SG HLL+++
Sbjct: 243 NDAKTRFLAAVSHELRTPLNAILGFSDVLAGEYFGKLENDRQREYVSLIHQSGTHLLSVV 302

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N +L+MSKIE  +  +  +   +   I     ++   A+ K +++  ++   +   NAD+
Sbjct: 303 NTMLDMSKIEAGRYELLLEPFRVAEAIAACEAMLSHQAREKGVRLTSRVTRSVGEINADQ 362

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R  ++IL  ++ N+IKFT+  G + +  +  G  + +T++DTGIGI    L+ +GQPF  
Sbjct: 363 RAFQQILINLIGNAIKFTDRGGLVTVDAALEGNMLKLTVSDTGIGIAADKLQMLGQPFVQ 422

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + N Y +   G GLGL++   L  LHGG + I S EG+GT++ + +P
Sbjct: 423 IQNDYTRRYEGTGLGLSLVKGLAELHGGDVSIRSAEGEGTVIVVTIP 469


>gi|227820916|ref|YP_002824886.1| predicted sensor histidine kinase protein with ATP-binding domain
            [Sinorhizobium fredii NGR234]
 gi|227339915|gb|ACP24133.1| predicted sensor histidine kinase protein with ATP-binding domain
            [Sinorhizobium fredii NGR234]
          Length = 1117

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 164/271 (60%), Gaps = 14/271 (5%)

Query: 504  TINDLSTS-------RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            TI  LS+S       R I + ++TE  + NAK       AETAN  K+EFLA++SHE+RT
Sbjct: 845  TIGRLSSSNGYCAVIRDITQWKRTEEELRNAKRS-----AETANAHKTEFLARVSHEIRT 899

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLNAI+GFS+++  E FG +G+ +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D
Sbjct: 900  PLNAIIGFSDMMASEHFGPIGNPRYIEYAGDIGRSGRHVLDIVNDLLDISKIEAGEMELD 959

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKF 675
                DL   ++E + L+   A S+ + I   +   +    AD R IK+I   IL+N+I+F
Sbjct: 960  FSAVDLNEAVSEAVSLVQPQANSQRVIIRTSLSGSVPEVVADGRSIKQIALNILANAIRF 1019

Query: 676  TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
            T + G++++ TS +    VI+ I DTGIG+ ++ L++  +PF  +     +   G GLGL
Sbjct: 1020 TPSGGQIVVSTSYETNGSVILRIRDTGIGMTRNELDQAMKPFRQVTTGGRKRGEGTGLGL 1079

Query: 735  AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             ++ A+   +  +  I S   +GT+V I  P
Sbjct: 1080 PLTKAMAEANRAQFGISSAPNEGTLVEISFP 1110


>gi|163758106|ref|ZP_02165194.1| putative two-component regulator sensor histidine kinase protein
            [Hoeflea phototrophica DFL-43]
 gi|162284395|gb|EDQ34678.1| putative two-component regulator sensor histidine kinase protein
            [Hoeflea phototrophica DFL-43]
          Length = 1325

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 161/257 (62%), Gaps = 9/257 (3%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  +  AK       AETAN  KS+FLA++SHE+RTPLNAI+GFSE++ +E
Sbjct: 1068 RDITQWKRTEEELRTAKRD-----AETANSHKSDFLARVSHEIRTPLNAIIGFSEMMSEE 1122

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +GS +Y EYA DI  SG+H+L+++N++L++SKIE  ++ ++     L   + E + 
Sbjct: 1123 RFGPIGSPRYLEYAHDIGNSGKHVLDIVNDLLDISKIEAGQVDMEFTAVSLNDHLAESVS 1182

Query: 632  LIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-K 688
            L+   A S+ + I   + SE   +  AD+R +K+I   +LSN+I++T + G++++ TS +
Sbjct: 1183 LLQPMANSQRVIIRTSL-SESVPDVVADQRSVKQIALNLLSNAIRYTPSGGQIVVSTSYE 1241

Query: 689  IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
                V+I I DTGIG+ +  LE+  +PF  +     Q   G GLGL ++ A+   +  + 
Sbjct: 1242 PSGNVVIRIRDTGIGMNRKELEQAMKPFGQVGAGPRQRGEGTGLGLPLTKAMVEANRAQF 1301

Query: 749  KIISQEGKGTIVTICMP 765
             I+S  G+GT+V+I  P
Sbjct: 1302 DIVSAAGEGTLVSIAFP 1318


>gi|73666846|ref|YP_302862.1| sensor histidine kinase [Ehrlichia canis str. Jake]
 gi|72393987|gb|AAZ68264.1| ATP-binding region, ATPase-like:Histidine kinase A, N-terminal
           [Ehrlichia canis str. Jake]
          Length = 470

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 151/244 (61%), Gaps = 3/244 (1%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN K +  KE AE  N +KS+FLA +SHELRTPLN+I+GFSE++K E  G + +V Y EY
Sbjct: 217 ANLKLKEAKEVAEQENISKSQFLANVSHELRTPLNSIIGFSEMMKSESMGAIDNVHYKEY 276

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
             DIH SG HLL++IN+IL+ SK+E  K+ ++    DL  II+    ++   A+   +K+
Sbjct: 277 INDIHNSGVHLLSLINDILDFSKVEANKLVVEFVKFDLSKIISSCFNMMVPRAEQAKVKL 336

Query: 645 EKKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVIITIADTG 701
           EK +PS ++   AD + +K+++  +LSN+IKFT  NG  K+++  +   + + I + D G
Sbjct: 337 EKVLPSNKVIMVADPKRMKQVIINLLSNAIKFTPENGVVKLVVEYNIEEKLIDIEVIDNG 396

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  L K+   F  + +++ +   G GLGL +S  L  L  G  KI S+   GTIVT
Sbjct: 397 IGIAQQDLYKVMSIFGQVDSRHARKYEGTGLGLPLSKKLVELMDGVFKIKSEPNLGTIVT 456

Query: 762 ICMP 765
           +  P
Sbjct: 457 LTFP 460


>gi|307304331|ref|ZP_07584083.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
 gi|306902799|gb|EFN33392.1| PAS/PAC sensor signal transduction histidine kinase [Sinorhizobium
           meliloti BL225C]
          Length = 531

 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 139/227 (61%), Gaps = 1/227 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAILGFS+V+  E FG+L + +  EY   IH SG HLL+++
Sbjct: 243 NDAKTRFLAAVSHELRTPLNAILGFSDVLAGEYFGKLENDRQREYVSLIHQSGTHLLSVV 302

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N +L+MSKIE  +  +  +   +   I     ++   A+ K +++  ++   +   NAD+
Sbjct: 303 NTMLDMSKIEAGRYELLLEPFRVAEAIAACEAMLSHQAREKGVRLTSRVTRSVGEINADQ 362

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R  ++IL  ++ N+IKFT+  G + +  +  G  + +T++DTGIGI    L+ +GQPF  
Sbjct: 363 RAFQQILINLIGNAIKFTDRGGLVTVDAALEGNMLKLTVSDTGIGIAADKLQMLGQPFVQ 422

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + N Y +   G GLGL++   L  LHGG + I S EG+GT++ + +P
Sbjct: 423 IQNDYTRRYEGTGLGLSLVKGLAELHGGDVSIRSAEGEGTVIVVTIP 469


>gi|163795844|ref|ZP_02189808.1| adenylate/guanylate cyclase [alpha proteobacterium BAL199]
 gi|159178877|gb|EDP63413.1| adenylate/guanylate cyclase [alpha proteobacterium BAL199]
          Length = 700

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/233 (36%), Positives = 155/233 (66%), Gaps = 10/233 (4%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N+ KS FLA MSHELRTPLNA++GFS+++  E FG+LG  +Y  YA+DI  +G+HLL ++
Sbjct: 460 NRAKSAFLANMSHELRTPLNAVIGFSDLLGNEPFGKLGDDRYKTYAEDIRMAGEHLLTLV 519

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADK 658
           N++L+ S+IE  K+ + + + D+  ++    R++   A+++ + ++  I ++L   +AD+
Sbjct: 520 NDLLDHSRIEAGKVELHEIDVDVRAVVRRVGRMMEDLAKNRGLTLDLHIDADLPRLHADE 579

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALEKIG 713
           R+++++L  ++SN++KFT + G    R   +G+      + + +ADTGIG+ +  + +  
Sbjct: 580 RLVRQVLLNLVSNAVKFTQSGG----RVEVVGRLEPDDRIALVVADTGIGMDRGDIARAM 635

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           +PF  L+++YD+S GG GLGL + +++  LHGG L + S +G GT V++  P+
Sbjct: 636 EPFVQLNDRYDKSYGGTGLGLPLVNSMVRLHGGTLTVDSMKGHGTTVSVRFPE 688


>gi|15964755|ref|NP_385108.1| putative sensor histidine kinase protein [Sinorhizobium meliloti
           1021]
 gi|7531256|sp|Q52969|Y1002_RHIME RecName: Full=Uncharacterized sensor-like histidine kinase R01002
 gi|15073933|emb|CAC45574.1| Putative sensor histidine kinase [Sinorhizobium meliloti 1021]
          Length = 525

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 139/227 (61%), Gaps = 1/227 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  K+ FLA +SHELRTPLNAILGFS+V+  E FG+L + +  EY   IH SG HLL+++
Sbjct: 237 NDAKTRFLAAVSHELRTPLNAILGFSDVLAGEYFGKLENDRQREYVSLIHQSGTHLLSVV 296

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N +L+MSKIE  +  +  +   +   I     ++   A+ K +++  ++   +   NAD+
Sbjct: 297 NTMLDMSKIEAGRYELLLEPFRVAEAIAACEAMLSHQAREKGVRLTSRVTRSVGEINADQ 356

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R  ++IL  ++ N+IKFT+  G + +  +  G  + +T++DTGIGI    L+ +GQPF  
Sbjct: 357 RAFQQILINLIGNAIKFTDRGGLVTVDAALEGNMLKLTVSDTGIGIAADKLQMLGQPFVQ 416

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + N Y +   G GLGL++   L  LHGG + I S EG+GT++ + +P
Sbjct: 417 IQNDYTRRYEGTGLGLSLVKGLAELHGGDVSIRSAEGEGTVIVVTIP 463


>gi|153869805|ref|ZP_01999330.1| sensor histidine kinase FexB [Beggiatoa sp. PS]
 gi|152073733|gb|EDN70674.1| sensor histidine kinase FexB [Beggiatoa sp. PS]
          Length = 681

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 149/542 (27%), Positives = 258/542 (47%), Gaps = 78/542 (14%)

Query: 258 ETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDN-KKICEI 316
           E A+     GLW+ N++ +K + S    +++G   E+++++   I   +H D+  K+   
Sbjct: 76  ELAMRGASDGLWDINYETEKAYYSPRFKQMLGFS-EHESMTPDDIIHWVHPDDFDKVLLN 134

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEK 375
           +++   K + +    F +RH  G  IW+  RA  +    G  + ++G  MDLT +  +E+
Sbjct: 135 SKAYVEKKIPKFQHTFRLRHKKGHYIWVLSRAIAVWNEQGQPLRMVGTNMDLTIQKQIEE 194

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL--PDHVL------VPGNA 427
           +  +  + L   I+   + +   D+N R + CN N+ +   +  P  ++      +P  A
Sbjct: 195 KLRQQQEFLRLVIDSIPQFIFWKDRNSRYLGCNQNFAQIANVNTPKQIIDKTDFDLPWTA 254

Query: 428 RSIIQDAQT-RPIIEYRTSDPERSQDMSKEIKLADS--RWLQINEWCTHDGGTISVGTDI 484
             I       R ++E  T  PE    + + I+LAD   RWL  N+   H+     +G   
Sbjct: 255 EQITYYRNVDRRVMEGDT--PEYH--IIETIQLADGQQRWLDTNKIPLHNVQGQVIGI-- 308

Query: 485 TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
                                  L +   I ER++ E+ +  A      + AETAN TKS
Sbjct: 309 -----------------------LGSFEDITERKQAEVQLQKAL-----QTAETANHTKS 340

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
            FLA MSHELRTPLNA+LG++++ +++   +  + +  E    IH +G++LL +IN+IL+
Sbjct: 341 VFLANMSHELRTPLNAVLGYTQIFQQD---DTLNKQQREGIDIIHRNGEYLLTLINDILD 397

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIK 662
           +SK+E  ++    ++  L   +   ++L     Q K I+   K  S L    +AD++ ++
Sbjct: 398 ISKVEAGQLEFYPKDMKLSQFLQGIVQLFQMRTQQKKIEFSYKPLSALPEIIHADEKRLR 457

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVI---------------------ITIADTG 701
           +I   +LSN+IKFT+     +  T K  Q  I                       I DTG
Sbjct: 458 QIFINLLSNAIKFTDKGS--VTFTVKTEQAKIKNEPSWVKNTLSTFYSYSRLHFQIEDTG 515

Query: 702 IGIPKSALEKIGQPFEPLH-NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           IGI    L+KI  PF+    N Y++ +G  GLGL+I+  L ++  G + + S  GKG+I 
Sbjct: 516 IGIASHELDKIFLPFQQADKNHYNKPMGT-GLGLSITKNLVDMMDGSIHVESLLGKGSIF 574

Query: 761 TI 762
            +
Sbjct: 575 WV 576


>gi|299133494|ref|ZP_07026688.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
 gi|298591330|gb|EFI51531.1| multi-sensor signal transduction histidine kinase [Afipia sp.
           1NLS2]
          Length = 600

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 153/259 (59%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           +S  R + ER+  E ++     +  ++ AE A  +KS FLA MSHELRTPLNAI+GFSE+
Sbjct: 315 VSVMRDVTERKMQEQAL-----EAARQEAEQAGASKSRFLATMSHELRTPLNAIIGFSEM 369

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I +E   +L + +  EYA  I+ SG HLL+++N IL+MSK+E+ K  +  +       ++
Sbjct: 370 IAREDEMKLDAARRREYAGLINESGLHLLSVVNGILDMSKMESGKFELVSEPFAPREALS 429

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A+   I +  ++PS+L     D R  K+IL  +LSN+IKFT   G + +  
Sbjct: 430 SCCNLMVLKARDNGIDLTTRMPSDLPQMTGDARAFKQILLNLLSNAIKFTGEGGSVTVSA 489

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G+ +++ +ADTGIGI K  L ++G PF      Y     G GLGL+I  +L +LHGG
Sbjct: 490 QVEGRELLLRVADTGIGIGKDDLARLGNPFFQAGASYQGRREGTGLGLSIVKSLVSLHGG 549

Query: 747 RLKIISQEGKGTIVTICMP 765
            +K+ S+  +GT +++ +P
Sbjct: 550 EMKVESELDRGTTISVRLP 568


>gi|241203748|ref|YP_002974844.1| histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857638|gb|ACS55305.1| histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 503

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 139/228 (60%), Gaps = 1/228 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE+AN  KS FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HL
Sbjct: 225 AESANDAKSRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVGLVRESGAHL 284

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-F 654
           L+++N +L+MSKIE  +  +  +  D+   +     ++   A++K + +  +I  +L   
Sbjct: 285 LSVVNTMLDMSKIEAGRYELILEAFDISSSVKSCESMLALQAKTKGLTLTSRIQRDLGEV 344

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R I++IL  ++ N+IKFT   G + +  +     + +T++DTGIGIP   L  +GQ
Sbjct: 345 VADQRAIQQILINLVGNAIKFTEAGGVVSVDAAARDGILKLTVSDTGIGIPADKLALLGQ 404

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           PF  + N Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 405 PFVQIQNDYTRRFEGSGLGLSLVKGLVALHGGYFAIASQPGEGTIITI 452


>gi|307824658|ref|ZP_07654882.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
 gi|307734312|gb|EFO05165.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
            SV96]
          Length = 1278

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 141/514 (27%), Positives = 251/514 (48%), Gaps = 52/514 (10%)

Query: 267  GLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNK-KICEIARSVTGKHV 325
            G W++N    K   S  +  + G P + + +SF+     IH D++ K+ +   +   +  
Sbjct: 651  GTWDWNIQTGKVICSERIGSLFGYPEDKREISFKYFLDGIHPDDRQKVIDAVDACVQQGA 710

Query: 326  KQLDQIFHMRH----ASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEA 380
            +     +++ H      G   W+  R  ++R   G  +N++G+  D+T +   E +  E 
Sbjct: 711  E-----YNIEHRCVWPDGTVRWLLERGDVVRDGDGTPLNMLGVVQDITHRKFAELKILEK 765

Query: 381  DQRL---SKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDA--- 434
              RL   +  IE  ++A++  D    +   N   +K +G     ++  N   ++ +    
Sbjct: 766  QARLVIFNHIIENVADAVITIDSVGTISSFNPAAEKLFGYSAAEIINRNVNLLMPEPYRS 825

Query: 435  -QTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTI-SVGTDITLLKHNQA 492
               R I  +    P  S  + K+++L             H  GTI S+   +TL+     
Sbjct: 826  KHGRYIDLHNAGQP--SGIIGKQLELPGQ----------HKDGTIFSLELAVTLM----- 868

Query: 493  QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
            ++ +SK       + +   R I ER++ E  I  A+     + AE+AN  KSEFL+ MSH
Sbjct: 869  EIDDSK-------HFVGILRDISERKQYEQEIIAAR-----DEAESANNAKSEFLSNMSH 916

Query: 553  ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
            ELRTP+NAILGF +++  EI   L      +Y  +I  +G HLL +IN +L++++IE+  
Sbjct: 917  ELRTPMNAILGFGQLL--EIEAGLNE-DQADYVDEILKAGHHLLELINEVLDLARIESGN 973

Query: 613  ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNS 672
            I++  +      +I E + LI   AQ + I I      +    AD+  +K++L  +LSN+
Sbjct: 974  INLSLEPLSCAELIGECLTLIKPIAQVRGITINDAAIGDYVIRADRTRLKQVLINLLSNA 1033

Query: 673  IKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
            IK+    G+++++ +     V + ++DTG GIP +  +++ QPF  L  + D  I G G+
Sbjct: 1034 IKYNRPQGEVLVQVAVQDGFVRLEVSDTGYGIPATRRQELFQPFSRLGVE-DADIEGTGI 1092

Query: 733  GLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            GL IS  L  + GG + + S+EG+G    I +P+
Sbjct: 1093 GLTISRRLMKMMGGAIGMDSEEGRGCTFWIELPE 1126


>gi|188580116|ref|YP_001923561.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
 gi|179343614|gb|ACB79026.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium populi BJ001]
          Length = 513

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 150/271 (55%), Gaps = 6/271 (2%)

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           RRL A+      SR   +    EL  A A     + RAE AN  KS FLA MSHELRTPL
Sbjct: 214 RRLYASAVGTLQSRAEKDAIFAELEQAKANSDEARRRAEEANLAKSRFLATMSHELRTPL 273

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           NAILGFSEV+K E+FG   +  Y EYA DIH SG HLLN+IN IL++S+IE  +  + ++
Sbjct: 274 NAILGFSEVMKNEVFGAHAAPAYREYATDIHDSGMHLLNLINEILDLSRIEAGRYDLSEE 333

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTN 677
              L   + E   ++   A+SK       I   L    AD+R +++I+  +LSN++KFT 
Sbjct: 334 AVQLAHTVEECRHMMTLRARSKGQTFASLIDDSLPRLWADERALRQIVLNLLSNAVKFTP 393

Query: 678 NNGKMMIR---TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
             G++ I+   TS  GQ V  ++ D+G GIP+  L  +   F         +  G GLGL
Sbjct: 394 PGGEITIKVGWTSSGGQYV--SVKDSGPGIPEDELGTVMSSFGRGSLAIKTAEQGSGLGL 451

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            I   L +LHGG  ++ S+  +GT V +  P
Sbjct: 452 PIVKGLIDLHGGGFQLKSKPREGTEVIVTFP 482


>gi|323136675|ref|ZP_08071756.1| integral membrane sensor signal transduction histidine kinase
           [Methylocystis sp. ATCC 49242]
 gi|322397992|gb|EFY00513.1| integral membrane sensor signal transduction histidine kinase
           [Methylocystis sp. ATCC 49242]
          Length = 511

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 106/273 (38%), Positives = 153/273 (56%), Gaps = 10/273 (3%)

Query: 501 LKATINDLSTSRQILERQK----TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
           L    + L++  Q    +K    TEL  A A     + RAE AN  KS FLA MSHELRT
Sbjct: 217 LAKRFHQLASESQFFRAEKNELITELEQAKANSDEARRRAEEANLAKSRFLATMSHELRT 276

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           PLNAILGFSEV+K E+FG   +  Y +Y+ DIH SGQHLL +IN IL++S++E  +  + 
Sbjct: 277 PLNAILGFSEVLKGELFGPHANPAYRDYSNDIHSSGQHLLMLINEILDLSRVEAGRYELK 336

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIK-IEKKIPSELFFNADKRIIKKILFPILSNSIKF 675
           +++  L+ +  E   L+   AQ ++I+ IE   PS     AD+R +++++  +L+N+IKF
Sbjct: 337 EESVSLVGVAQECRHLLTIRAQKRDIRMIEVVEPSLPRIWADERAVRQVILNLLTNAIKF 396

Query: 676 TNNNGKMMIR---TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGL 732
           T   G++ I+   TS  GQ   I I D G GIP+  +  +   F         +  G GL
Sbjct: 397 TPQGGQVTIKVGWTSAGGQ--YIAIKDNGPGIPEDEIAVVMSSFGRGMLAQKNADEGTGL 454

Query: 733 GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GL I   L  LHGG+  + S+  +GT   +  P
Sbjct: 455 GLPIVKGLVELHGGQFVLKSKVREGTDAIVVFP 487


>gi|148254486|ref|YP_001239071.1| multi-sensor signal transduction histidine kinase [Bradyrhizobium
           sp. BTAi1]
 gi|146406659|gb|ABQ35165.1| multi-sensor signal transduction histidine kinase [Bradyrhizobium
           sp. BTAi1]
          Length = 587

 Score =  174 bits (442), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 148/254 (58%), Gaps = 9/254 (3%)

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
           R  T+  +     ++ +  AE A+  K+ FLA MSHELRTPLNAI+GFSE++ +E    L
Sbjct: 304 RDVTDRKLQEQALELARSAAERADAAKTRFLATMSHELRTPLNAIIGFSEMLMQEQALVL 363

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ----NADLIPIINEGIRL 632
            + +  EYAQ I+ SGQHLL+++N IL+MSK+E+    +  +     A LI   N    L
Sbjct: 364 NAARRREYAQLINDSGQHLLSVVNGILDMSKMESGNFELTPEPFAPRAALINCCN----L 419

Query: 633 IGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +   A+   + +   +P +L     D R  K+I+  ++SN+IKFT   G++M+  +  G 
Sbjct: 420 LALRARENGVDLSADVPHDLPTITGDPRAFKQIVINLVSNAIKFTERGGRVMVSAAIEGP 479

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            +++ I DTG+GI    L++IG PF      Y +   G GLGL+I  +L NLHGG + I 
Sbjct: 480 QLLLRITDTGVGIAADDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVKSLVNLHGGEMSIE 539

Query: 752 SQEGKGTIVTICMP 765
           S+  +GT V+I +P
Sbjct: 540 SKLDEGTTVSIALP 553


>gi|327193898|gb|EGE60773.1| hypothetical protein RHECNPAF_1340019 [Rhizobium etli CNPAF512]
          Length = 538

 Score =  174 bits (441), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 155/280 (55%), Gaps = 15/280 (5%)

Query: 487 LKHNQAQLRESKRRLKATI---NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           L+ +    R++   L A I    D+S  +Q+            A+ Q     AE+AN  K
Sbjct: 219 LRMDMTARRDADGELAAVIAQLRDVSVEQQL-----------RAEAQSRAADAESANDAK 267

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HLL+++N +L
Sbjct: 268 SRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVGLVRESGAHLLSVVNTML 327

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIK 662
           +MSKIE  +  +  +  D+   +     ++   A++K + +  +I   L    AD+R I+
Sbjct: 328 DMSKIEAGRYELILEAFDISASVRSCESMLALQAKTKGVTLTSRIQRSLGEIVADQRAIQ 387

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           +IL  ++ N++KFT   G + I  +     + +T++DTGIGI    L  +GQPF  + N 
Sbjct: 388 QILINLVGNAVKFTEAGGVVSIDAAARDGILKLTVSDTGIGIAADKLALLGQPFVQIQND 447

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 448 YTRRFEGTGLGLSLVKGLVALHGGNFAIASQPGEGTIITI 487


>gi|190890965|ref|YP_001977507.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652]
 gi|190696244|gb|ACE90329.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 652]
          Length = 513

 Score =  174 bits (441), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 155/280 (55%), Gaps = 15/280 (5%)

Query: 487 LKHNQAQLRESKRRLKATI---NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           L+ +    R++   L A I    D+S  +Q+            A+ Q     AE+AN  K
Sbjct: 194 LRMDMTARRDADGELAAVIAQLRDVSVEQQL-----------RAEAQSRAADAESANDAK 242

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HLL+++N +L
Sbjct: 243 SRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVGLVRESGAHLLSVVNTML 302

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIK 662
           +MSKIE  +  +  +  D+   +     ++   A++K + +  +I   L    AD+R I+
Sbjct: 303 DMSKIEAGRYELILEAFDISASVRSCESMLALQAKTKGVTLTSRIQRGLGEIVADQRAIQ 362

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           +IL  ++ N++KFT   G + I  +     + +T++DTGIGI    L  +GQPF  + N 
Sbjct: 363 QILINLVGNAVKFTEAGGVVSIDAAARDGILKLTVSDTGIGIAADKLALLGQPFVQIQND 422

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 423 YTRRFEGTGLGLSLVKGLVALHGGNFAIASQPGEGTIITI 462


>gi|146341638|ref|YP_001206686.1| putative sensor histidine kinase membrane protein [Bradyrhizobium
           sp. ORS278]
 gi|146194444|emb|CAL78469.1| putative sensor histidine kinase, putative membrane protein
           [Bradyrhizobium sp. ORS278]
          Length = 532

 Score =  174 bits (441), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 104/252 (41%), Positives = 149/252 (59%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 241 ELEQAKAISDEARYRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPV 300

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ +I +   L+   A S+
Sbjct: 301 YKEYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVALVHVIADCHHLLKLRASSR 360

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+K+P      AD+R I++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 361 GITIHEVFEQKMPR---LWADERAIRQVVLNLLSNAIKFTPQGGEIWLKAGWTASGGQ-- 415

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP++ +  +   F    N    +  G GLGL I+  L  +HGG   + S+
Sbjct: 416 YLSVKDTGSGIPENEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKNLIEMHGGTFTLKSK 475

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 476 VRIGTEVIVTFP 487


>gi|71907402|ref|YP_284989.1| PAS/PAC sensor hybrid histidine kinase [Dechloromonas aromatica
           RCB]
 gi|71847023|gb|AAZ46519.1| PAS/PAC sensor hybrid histidine kinase [Dechloromonas aromatica
           RCB]
          Length = 1169

 Score =  174 bits (440), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 145/534 (27%), Positives = 244/534 (45%), Gaps = 82/534 (15%)

Query: 261 LSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPY-ENKTLSFRAIARLIHYDNKKICE--IA 317
           LS    G W ++ D+ K  L  +   ++G    E       A    IH +++ + E  +A
Sbjct: 451 LSGTGAGPWEWDIDSGKLILDGASSNLVGRSLAEFGDDHLEAWFSRIHPEDRLVLEKSLA 510

Query: 318 RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG--GMNIIGIAMDLTEKYHLEK 375
             + G   ++ +  + ++HA    +WIQVR +++        + + G+ +D+T     E+
Sbjct: 511 DHLAGDS-ERFEIEYRIQHADQRWVWIQVRGKVIDWSKDRKPLTMYGVHLDITAHKQAEE 569

Query: 376 RYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA-RSIIQ-- 432
           +    +  L  AIE   E   +++  DRL  CN  Y++ Y +     VPGN+   II+  
Sbjct: 570 QRQYLESILHSAIEAIGEGFSVYNAADRLTWCNEQYRRLYTISAPAFVPGNSFEEIIRYG 629

Query: 433 -------DAQTRP-------IIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTI 478
                  +AQ  P       ++ +R S+    Q      KLAD RWL + E  T DG  +
Sbjct: 630 IEHGQYPEAQANPEAWVQRRLLAHRQSESNFIQ------KLADGRWLDVRERKTADGSIV 683

Query: 479 SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
               DIT L H                                           K+ AE 
Sbjct: 684 GFRVDITELMH------------------------------------------AKQAAEA 701

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           AN+ KSEFLA MSHE+RTP+N+ILG ++++      ++   +  +Y + I  SG+ LL +
Sbjct: 702 ANRAKSEFLATMSHEIRTPMNSILGMAQILCGP---DVSDPRSRDYGRVILESGKTLLTI 758

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI--EKKIPSELFFNA 656
           +N++L+++K+E+ ++ +D        +  + + L    AQ K + I  E   P    + A
Sbjct: 759 LNDVLDLAKVESGRVELDPTPWLPQQLAQDILALFRGVAQGKGLIISAEWDGPRTQEYLA 818

Query: 657 DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEK 711
           D   +K++L  ++SN++KFT   G + IR S+I +      +  ++ DTGIGI     + 
Sbjct: 819 DGYRLKQMLSNLVSNALKFT-AIGSVDIRISEIDRTNDFATLEFSVTDTGIGISSEKQQG 877

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + QPF        +  GG GLGL+I   L  L GG   + S+E KG+ +   +P
Sbjct: 878 LFQPFTQADGSTTRRYGGSGLGLSIVRHLAELMGGEAGLESEEKKGSRLWFRIP 931


>gi|91202234|emb|CAJ75294.1| similar to histidine kinase [Candidatus Kuenenia stuttgartiensis]
          Length = 395

 Score =  173 bits (439), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 154/255 (60%), Gaps = 5/255 (1%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R +LE++  E +    K  +  E+A    + KSEFLA MSHELRTPLNAI+GF+EV+K  
Sbjct: 135 RHLLEKKVQEKTSDLQKTNIALEKA---YRLKSEFLATMSHELRTPLNAIIGFAEVLKDG 191

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
           + G +   +  EY  DI+ SG+HLLNMINN+L++SKIE  K+ +  +   +   I++ + 
Sbjct: 192 LVGPIND-EQREYVDDIYSSGKHLLNMINNVLDISKIEAGKLELKYEEICVKETIDDVLN 250

Query: 632 LIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
            +   A  KNI I+  I S++  F  D+  +K+ILF +LSN+IKFT  NG + I T+   
Sbjct: 251 TVSGIANKKNITIKNTIQSDIPTFVVDQLKLKQILFNLLSNAIKFTPKNGNVCIDTTLKD 310

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             V   IADTGIGI +  +EKI + F  + +   ++  G GL LA++  L  LHGG + +
Sbjct: 311 LYVQFAIADTGIGIKQEDIEKIFEAFSQVDSSLARNYEGAGLSLALTKRLVELHGGEIWV 370

Query: 751 ISQEGKGTIVTICMP 765
            S  GKG+  T  +P
Sbjct: 371 ESFYGKGSTFTFILP 385


>gi|116251150|ref|YP_766988.1| two-component sensor histidine kinase transcriptional regulatory
           protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255798|emb|CAK06879.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 526

 Score =  173 bits (439), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 138/228 (60%), Gaps = 1/228 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE+AN  KS FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HL
Sbjct: 248 AESANDAKSRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVGLVRESGAHL 307

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-F 654
           L+++N +L+MSKIE  +  +  +  D+   +     ++   A++K + +  +I   L   
Sbjct: 308 LSVVNTMLDMSKIEAGRYELILEAFDISSSVKSCESMLALQAKTKGLTLTSRIQRGLGEV 367

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R I++IL  ++ N+IKFT   G + +  +     + +T++DTGIGIP   L  +GQ
Sbjct: 368 VADQRAIQQILINLVGNAIKFTEAGGVVSVDAAARDGILKLTVSDTGIGIPADKLALLGQ 427

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           PF  + N Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 428 PFVQIQNDYTRRFEGSGLGLSLVKGLVALHGGYFAIASQPGEGTIITI 475


>gi|218674838|ref|ZP_03524507.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli GR56]
          Length = 332

 Score =  173 bits (439), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 155/280 (55%), Gaps = 15/280 (5%)

Query: 487 LKHNQAQLRESKRRLKATI---NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           L+ +    R++   L A I    D+S  +Q+            A+ Q     AE+AN  K
Sbjct: 13  LRMDMTARRDADGELAAVIAQLRDVSVEQQL-----------RAEAQSRAADAESANDAK 61

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HLL+++N +L
Sbjct: 62  SRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVGLVRESGAHLLSVVNTML 121

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIK 662
           +MSKIE  +  +  +  D+   +     ++   A+SK + +  +I   L    AD+R I+
Sbjct: 122 DMSKIEAGRYELILEAFDISASVRSCESMLALQAKSKGVTLTSRIQRGLGEIVADQRAIQ 181

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           +IL  ++ N++KFT   G + +  +     + +T++DTGIGI    L  +GQPF  + N 
Sbjct: 182 QILINLVGNAVKFTEAGGVVSVDAAARDGILKLTVSDTGIGIAADKLAMLGQPFVQIQND 241

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 242 YTRRFEGTGLGLSLVKGLVALHGGNFAIASQPGEGTIITI 281


>gi|91201393|emb|CAJ74453.1| similar to ammonium transport protein amtB possibly fused to
           histidine kinase [Candidatus Kuenenia stuttgartiensis]
          Length = 679

 Score =  173 bits (438), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 151/266 (56%), Gaps = 13/266 (4%)

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           I  L     ILE++  E     A  Q+     E AN+ KSEFL  MSHELRTPLNAI+GF
Sbjct: 416 ITRLQDINTILEKRVQE---KTADLQMANVALEKANRLKSEFLTTMSHELRTPLNAIIGF 472

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           +EV++ EI G L S    EY  DIH SG HLL+MINNIL++SKIET K+ +  +   +  
Sbjct: 473 AEVLRDEIAGSL-SKDQKEYVTDIHSSGHHLLDMINNILDLSKIETGKMHLQYEEFCIED 531

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
            IN+ + +I +SA +K I +   I       +ADK   ++IL+ +LSN++KFT  NGK+ 
Sbjct: 532 AINDTLTIINASANNKGISVHTNIQDNTPLLSADKTKFRQILYNLLSNAVKFTPENGKIT 591

Query: 684 IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG----GFGLGLAISDA 739
           I   +    +   I DTGIGI     EK+   FE  H Q D S+     G GLGL ++  
Sbjct: 592 INVFQKDNSLQFEIVDTGIGIKPEDKEKL---FEAFH-QADASLTREYEGTGLGLHLTKR 647

Query: 740 LTNLHGGRLKIISQEGKGTIVTICMP 765
           L  LHGG++   S  GKG+     +P
Sbjct: 648 LVELHGGKIWAESTFGKGSTFFFILP 673


>gi|86356892|ref|YP_468784.1| two-component sensor histidine kinase protein [Rhizobium etli CFN
           42]
 gi|86280994|gb|ABC90057.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CFN 42]
          Length = 513

 Score =  173 bits (438), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 140/237 (59%), Gaps = 1/237 (0%)

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
           A+ Q     AE+AN  KS FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY  
Sbjct: 226 AEAQNRAADAESANDAKSRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVS 285

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            +  SG HLL+++N +L+MSKIE  +  +     D+   +     ++   A++K + +  
Sbjct: 286 LVRESGAHLLSVVNTMLDMSKIEAGRYELILDAFDISSSVRSCESMLALQAKTKGVTLTS 345

Query: 647 KIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
           +I   L    AD+R I++IL  ++ N++KFT   G + +  +     + +T++DTGIGIP
Sbjct: 346 RIQRGLGEIVADQRAIQQILINLVGNAVKFTEAGGVVSVDAAARDGILKLTVSDTGIGIP 405

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
              L  +GQPF  + N Y +   G GLGL++   L  LHGG   I S+ G+GTI+T+
Sbjct: 406 ADKLAMLGQPFVQIQNDYTRRFEGSGLGLSLVKGLVALHGGNFAIASRPGEGTIITV 462


>gi|86750506|ref|YP_487002.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris HaA2]
 gi|86573534|gb|ABD08091.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris HaA2]
          Length = 530

 Score =  173 bits (438), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 148/252 (58%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 242 ELEQAKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 302 YKEYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAISLVHVVTDCHHLLKLRASSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R +++++  +LSNSIKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAVRQVVLNLLSNSIKFTPQGGEIWLKVGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 417 YLSVKDTGSGIPEEEIPVVLASFGQGSNSIKSAEQGAGLGLPIAKSLVDMHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRIGTEVIVTFP 488


>gi|222085300|ref|YP_002543830.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
 gi|221722748|gb|ACM25904.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
          Length = 510

 Score =  172 bits (437), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 137/231 (59%), Gaps = 1/231 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE+AN  KS FLA +SHELRTPLNAILGFS+++  E FG+L + +  EY   I  SG HL
Sbjct: 232 AESANDAKSRFLAAVSHELRTPLNAILGFSDILSGEYFGKLENNRQREYVGLIRQSGAHL 291

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-F 654
           L+++N +L+MSKIE  +  +  +   +   I     ++   A+ K + +  ++   L   
Sbjct: 292 LSVVNTMLDMSKIEAGRYELVPEPFPIEASIGACEAMLALQAKEKGLTLTSRVQRGLGDI 351

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R I+++L  ++ N+IKFT+  G + I  +     + +++ DTGIGI    L  +GQ
Sbjct: 352 VADQRAIQQVLINLVGNAIKFTDAGGAVTIDAAMADGMLKLSVCDTGIGIAADRLASLGQ 411

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           PF  + N Y +   G GLGL++   L  LHGG   I S  G+GT++TI +P
Sbjct: 412 PFVQIQNDYTRRYAGTGLGLSLVKGLVGLHGGSFAIASAPGEGTVITILIP 462


>gi|78778120|ref|YP_394435.1| PAS/PAC sensor signal transduction histidine kinase [Sulfurimonas
           denitrificans DSM 1251]
 gi|78498660|gb|ABB45200.1| PAS/PAC sensor signal transduction histidine kinase [Sulfurimonas
           denitrificans DSM 1251]
          Length = 697

 Score =  172 bits (437), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 149/230 (64%), Gaps = 2/230 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           A +A K KS FLA MSHELRTPLNA++GFS+++  +   ++   K   + + I+ SG+HL
Sbjct: 466 ALSAEKAKSTFLATMSHELRTPLNAVIGFSQILMAK--DDMPKEKIRTFVEKINISGKHL 523

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN 655
           LN++NNIL+ SKIE+ +++++K+   L   INE I L+ + A  K+I+I KK   E+  +
Sbjct: 524 LNLVNNILDFSKIESGRMNLNKREILLENFINETILLVENEALKKDIEIIKKGFFEISLS 583

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQP 715
           AD++++K+++  ILSN+IKF+N N  + I      +  II+I D G+G+ +  LEK+ +P
Sbjct: 584 ADEQLLKQVILNILSNAIKFSNQNSAINISYKNDEENHIISICDEGVGLSQEQLEKLFKP 643

Query: 716 FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           F  +    + ++ G GLGL IS  +  LH G +++ +Q GKG+   I +P
Sbjct: 644 FSQVQEHQNTALKGTGLGLVISQKIVELHNGNIEVKTQSGKGSCFYISIP 693


>gi|209548487|ref|YP_002280404.1| integral membrane sensor signal transduction histidine kinase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534243|gb|ACI54178.1| integral membrane sensor signal transduction histidine kinase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 513

 Score =  172 bits (437), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 155/280 (55%), Gaps = 15/280 (5%)

Query: 487 LKHNQAQLRESKRRLKATI---NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTK 543
           L+ +    R++   L A I    D+S  +Q+            A+ Q     AE+AN  K
Sbjct: 194 LRMDMTARRDADGELAAVIAQLRDVSVEQQL-----------RAEAQNRVADAESANDAK 242

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA +SHELRTPLNAILGFS+++  E FG+  + +  EY   +  SG HLL+++N +L
Sbjct: 243 SRFLAAVSHELRTPLNAILGFSDILIGEYFGKFENDRQREYVSLVRESGAHLLSVVNTML 302

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIK 662
           +MSKIE  +  +  +  D+   +     ++   A++K + +  +I   L    AD+R I+
Sbjct: 303 DMSKIEAGRYELILEPFDIASSVKSCESMLALQAKTKGLTLTSRIQRGLGEIVADQRAIQ 362

Query: 663 KILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ 722
           +IL  ++ N+IKFT   G + +  +     + +T++DTGIGI    L  +GQPF  + N 
Sbjct: 363 QILINLVGNAIKFTEAGGVVSVDAAARDGILKLTVSDTGIGIAADKLALLGQPFVQIQND 422

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           Y +   G GLGL++   L  LHGG   I SQ G+GTI+TI
Sbjct: 423 YTRRFEGTGLGLSLVKGLVALHGGHFAIASQPGEGTIITI 462


>gi|222084929|ref|YP_002543458.1| two-component sensor histidine kinase protein [Agrobacterium
            radiobacter K84]
 gi|221722377|gb|ACM25533.1| two-component sensor histidine kinase protein [Agrobacterium
            radiobacter K84]
          Length = 1190

 Score =  172 bits (437), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 158/257 (61%), Gaps = 9/257 (3%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 933  RDITQWKRTEEELRNAKRA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 987

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ ++  +  L   I E + 
Sbjct: 988  RFGPIGHSRYVEYATDIGRSGRHVLDIVNDLLDISKIEAGEMDLEFASVGLNEAIAEAVS 1047

Query: 632  LIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            L+   A S+ + I   + S+   N  AD R IK+I   ILSN+I+FT + G++++ TS  
Sbjct: 1048 LVQPQANSQRVIIRTAL-SQAVPNVVADLRSIKQIALNILSNAIRFTPSGGQIVVSTSYE 1106

Query: 690  GQ-CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G   V++ I DTG+G+ +S LE+  +PF  +     +   G GLGL ++ A+ + +    
Sbjct: 1107 GNGSVVMRIRDTGVGMTRSELEQAMKPFRQVSTNSRKRGDGTGLGLPLTKAMVDANRATF 1166

Query: 749  KIISQEGKGTIVTICMP 765
             I S   +GT+V +  P
Sbjct: 1167 AINSSPNEGTLVEVTFP 1183


>gi|288957536|ref|YP_003447877.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288909844|dbj|BAI71333.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 423

 Score =  172 bits (437), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 127/426 (29%), Positives = 208/426 (48%), Gaps = 43/426 (10%)

Query: 354 ISGGMNIIGIAMDLTEKYHLEKRYAEA-DQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
           ++ G    G+   LT+        AEA  + L+ A++ ++E+  L+D  DRLV  N   +
Sbjct: 5   VAAGPTPGGLCAVLTDLGPETSSIAEALAENLTAALDLSAESFALFDHEDRLVHANERLK 64

Query: 413 KAYGLPDHVLVPGN-----ARSIIQDAQTRPIIEYRTS------DPERSQDMSKEIKLAD 461
           +        LVPG      AR            E R +      D     +    + LAD
Sbjct: 65  RDLPTIADRLVPGVPFEELARGFALADPRLATEEERAAWIAARLDRHHRLEPPMVVPLAD 124

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            RWL   E     GG +   TD+T+LK N+ +                            
Sbjct: 125 GRWLLSREHAV-PGGVLVHYTDVTMLKLNEER---------------------------- 155

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
           L +  A+ +  +  AE A++ KS FLA+MSHELRTPLNA+LGFSE++  E FG LG+ +Y
Sbjct: 156 LRLREAEARAARGEAEAASRAKSAFLAQMSHELRTPLNAVLGFSEMLLTEAFGPLGNPRY 215

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
             Y  DI  +G HLL +I++ILE+S+++   + +  +  DL  +    +  +  +A    
Sbjct: 216 RSYVGDIRDAGTHLLALIDDILELSRLDGGGMPMAAEGVDLDMLSLRVVTALREAAAEGG 275

Query: 642 IKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-ITIAD 699
           + + +++  +L     D + + ++L  +LSN++  T   G++++    +    I + +AD
Sbjct: 276 VIMRREVAPDLPLLQGDAQSLTQMLTNLLSNAVTHTRPGGEVVLTAHLMPDGGIGVMVAD 335

Query: 700 TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
           TG+GIP + L +I  PF+P  +   ++  G GLGL I   L  +HGGR+++ SQ G GT 
Sbjct: 336 TGVGIPTADLPRILDPFDPPDSTIARNSCGTGLGLPIVKRLVEMHGGRMELTSQPGVGTS 395

Query: 760 VTICMP 765
           V +  P
Sbjct: 396 VVLVFP 401


>gi|254415932|ref|ZP_05029689.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196177359|gb|EDX72366.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1821

 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 134/464 (28%), Positives = 222/464 (47%), Gaps = 64/464 (13%)

Query: 330  QIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYH-----------LEKRYA 378
            Q  + +   G +  I+V    ++T +G   +I    D+TE+             LE +  
Sbjct: 1120 QDLYAKRQDGTEFPIEVGLSTIQTKNGTF-VIAFLTDITERQQAEHEIKRLNQKLESQIR 1178

Query: 379  EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD---------HVLVPGNARS 429
            E + R ++ +E   E + + D        N    +  G  +           L PG+ R 
Sbjct: 1179 ETETRYAQIVELAEEGIWVTDVQGNTTYINQAMARMLGYTEVEILGHAIADFLPPGDNR- 1237

Query: 430  IIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQIN-EWCTHDGGTI----SVGTDI 484
                A + P+   +       Q++    K  ++ W  ++      D G +    ++  DI
Sbjct: 1238 -FTSASSIPLHPNQV----HRQEVELRTKSGNTIWAYMSTSPVLDDQGNLLWSCALVYDI 1292

Query: 485  TLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKS 544
            T  K  + QLRES  R                     +S+ANA+          A + K 
Sbjct: 1293 TERKQAEKQLRESNER---------------------ISLANAEL-------ARATRLKD 1324

Query: 545  EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
            EFLA MSHELRTPLNAILG +E +++E++G L + K ++    I  SG+HLL++IN+IL+
Sbjct: 1325 EFLASMSHELRTPLNAILGLAEALQEEVYGSL-TPKQHKSLATIEQSGKHLLDLINDILD 1383

Query: 605  MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKK 663
            +SKIE+ K+S+      +  +    +  I   AQ KNI++E  I P       D+R I++
Sbjct: 1384 LSKIESGKMSLSVSLVSVDSLCESSLTFIKQQAQQKNIRLEYHIAPGLSEIEVDERRIRQ 1443

Query: 664  ILFPILSNSIKFTNNNGK--MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
            +L  +LSN++KFT + GK  + + T   G+ + +++ DTGIGI    L+K+ +PF  L +
Sbjct: 1444 VLVNLLSNAVKFTPDGGKVSLQVTTDPDGEKLQLSVTDTGIGIAPENLDKLFKPFVQLDS 1503

Query: 722  QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               +   G GLGLA+   +  L GG + + S+ GKG+  T+ +P
Sbjct: 1504 SLSRRYAGTGLGLALVRRIVELQGGSIALESEVGKGSCFTVNLP 1547


>gi|20091380|ref|NP_617455.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19916516|gb|AAM05935.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 726

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 161/267 (60%), Gaps = 7/267 (2%)

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           ++  TI  L T  +I ER+  E+ +  AK     + AE AN+ KS FLA MSHELRTPLN
Sbjct: 460 KIGNTIAVLETGVEITERKNYEIELFRAK-----QDAEVANRAKSAFLANMSHELRTPLN 514

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           +I+GFS+++ ++++GEL ++K  +   +I  SG+HLLN+IN IL++SK+E     +    
Sbjct: 515 SIIGFSDLLYEKVYGEL-NLKQTKAVGNISNSGKHLLNLINEILDLSKVEAGSFELHYST 573

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNN 678
             L  +  E   +I   A SK +KIE +I S L    ADK  I ++L  +++N++KF+N 
Sbjct: 574 FWLAEVFAEVRDMIFPFATSKGLKIELEIDSNLSRVYADKERILQVLSNLVTNAVKFSNE 633

Query: 679 NGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
           NG + ++  ++   + IT+AD GIGI  +  EK+ +PF  + + + +   G GLGLA+  
Sbjct: 634 NGCVKVKAVQMDGFLKITVADDGIGIAAADHEKLFKPFSQIDSSFSKRYQGTGLGLALVK 693

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
            +  LHGG +   S+ GKG++    +P
Sbjct: 694 EIVQLHGGTVWFESEVGKGSVFGFSIP 720


>gi|296447262|ref|ZP_06889191.1| integral membrane sensor signal transduction histidine kinase
           [Methylosinus trichosporium OB3b]
 gi|296255224|gb|EFH02322.1| integral membrane sensor signal transduction histidine kinase
           [Methylosinus trichosporium OB3b]
          Length = 514

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 143/249 (57%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+FG      
Sbjct: 239 ELEQAKANSDEARRRAEEANLAKSRFLATMSHELRTPLNAILGFSEVLKNELFGVHAVAA 298

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SGQHLL +IN IL++S++E  +  + +++  L  ++ +   L+   AQ +
Sbjct: 299 YKDYSNDIHSSGQHLLMLINEILDLSRVEAGRYELKEESVSLATMVEDCRHLLTIRAQKR 358

Query: 641 NIK-IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
            I+ IE   P      AD+R +++I+  +L+N+IKFT   G++ ++   TS  GQ V   
Sbjct: 359 GIEMIEMTEPDLPRLWADERAVRQIVLNLLTNAIKFTPQGGQVTLKVGWTSAGGQYV--A 416

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I DTG GIP+  +  +   F         +  G GLGL I   L +LHGG  K+ S+  +
Sbjct: 417 IRDTGPGIPEEEIAVVMSSFGRGTLAQKNAEEGTGLGLPIVKGLIDLHGGLFKLASKVRE 476

Query: 757 GTIVTICMP 765
           GT   +  P
Sbjct: 477 GTEAIVVFP 485


>gi|288959744|ref|YP_003450084.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
 gi|288912052|dbj|BAI73540.1| two-component hybrid sensor and regulator [Azospirillum sp. B510]
          Length = 1082

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 140/471 (29%), Positives = 223/471 (47%), Gaps = 91/471 (19%)

Query: 332 FHMRHASGADI-WIQVRAQMMRTISGGMNIIGI-AMDLTEKYHLEK--RYAEADQR-LSK 386
           F  +H+ G    W +V    +R  SG + ++ + A D+T ++  E+  R +EA  R L++
Sbjct: 338 FEEQHSQGGVTRWWEVSQVPIRDESGAIVMLSVGARDITRRHEAERAIRVSEARYRQLAR 397

Query: 387 AIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
            +      + L D   R   C+ + +   G P   LV             RP++E    D
Sbjct: 398 GVTDIIGRIGL-DGVRRF--CSESTRDRLGSPPAELV------------GRPLVERMHPD 442

Query: 447 -------------PERSQ-DMSKEIKLADSRWLQIN---EWCTHDGGT----ISVGTDIT 485
                        PER     +  ++ AD RWL         T D G     +SV  DIT
Sbjct: 443 DRDAAAAGLSRLTPERPTLKTTYRLRHADGRWLWFEAAVRLVTDDWGAPQEYVSVERDIT 502

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
                                    SR+I+E          A+ Q  ++ AE A++ K+E
Sbjct: 503 -------------------------SRKIME----------AELQDARQAAEAASRGKTE 527

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA +SHELRTP+NA++GF+++I +E  G +G+ +Y ++A +I  SGQHLL +IN IL+ 
Sbjct: 528 FLASLSHELRTPMNAVIGFADLIAREAEGPVGNAQYRDFAINIRDSGQHLLELINEILDQ 587

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKI 664
            + E  ++ +D +  DL       IRL+   A    I I  K+ P+      D+R I++I
Sbjct: 588 VRAEAGQLVLDDEPVDLDAAATFAIRLLTPRAARAGIAIAAKVEPAARHMRGDERRIRQI 647

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPFEPLHNQY 723
           L  +LSN++K+T   G + + T       +++ + DTG+GIP+  LE++     P + + 
Sbjct: 648 LLNLLSNAVKYTPAGGSVSLTTGPAPDGGLLLEVRDTGVGIPEPELERV----PPAYTRV 703

Query: 724 DQSIG---------GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           D   G         G GLGL ++  L  LHGG L + S+ G+GT VT+  P
Sbjct: 704 DGPDGRRAESRRIEGSGLGLPLTRRLVELHGGTLTLASRVGRGTTVTVHFP 754


>gi|21229203|ref|NP_635125.1| two component system histidine kinase [Methanosarcina mazei Go1]
 gi|20907772|gb|AAM32797.1| Two component system histidine kinase [Methanosarcina mazei Go1]
          Length = 715

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 158/259 (61%), Gaps = 8/259 (3%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T R + ER++ E      +   EK+ AE AN+TKSEFLA MSHELRTPLN+I+GFS++
Sbjct: 458 LQTCRDVTERKEAE------RLLHEKQIAEIANRTKSEFLANMSHELRTPLNSIIGFSDL 511

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           + ++++GEL   K      +I  SG+HLLN+IN+IL++SK+E  K+ +D +  +L   +N
Sbjct: 512 LYEKVYGELNE-KQARAVGNISRSGKHLLNLINDILDLSKVEAGKMELDYKEFELAGKLN 570

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A  KNI+I+ ++   L    AD+    +I++ ++ N+IKF++ NG + +R 
Sbjct: 571 AIKSLLSPIADRKNIEIDIEVDKGLTHIRADEARFVQIMYNLMDNAIKFSHENGLVKVRA 630

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            + G  V IT+ D GIGI +    K+ +PF  + +   ++  G GLGL++   + NLHGG
Sbjct: 631 ERKGDLVEITVKDKGIGIKEEDQCKLFKPFSQVDSFSSKTFQGTGLGLSLVKQIVNLHGG 690

Query: 747 RLKIISQEGKGTIVTICMP 765
            +   S+ G+G+     +P
Sbjct: 691 EVWFNSKIGEGSTFAFTVP 709


>gi|163792404|ref|ZP_02186381.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
 gi|159182109|gb|EDP66618.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
          Length = 374

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 197/379 (51%), Gaps = 38/379 (10%)

Query: 386 KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS 445
           +A+E  ++A  L+D  D+L+ CN+ +++    PD  L P     +  +   R     R  
Sbjct: 16  QAMESMTDAFALFDPADKLIFCNSRFKELN--PD--LAPDIYVGMTFEEMVR-----RNL 66

Query: 446 DPERSQD-MSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAT 504
           D  R  D + KE +   +R     +   H  G   V    +  K  Q  L    R     
Sbjct: 67  DSGRILDAVGKEDQFLKARM----DAHRHPSGEAIV----SRRKDGQILLLREVR----- 113

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           + D ST   ++   +TEL       +  K  AETAN+ KS+FLA +SHELRTPLNAILGF
Sbjct: 114 LEDGSTF--LINSDQTELRQRETDLERAKNEAETANRAKSDFLANVSHELRTPLNAILGF 171

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           SE+IK +    L S +Y +YA  IH SGQHLL++IN+IL+++ IE+ +  I  +  +L  
Sbjct: 172 SEIIKSDT---LDSGRYPDYAAAIHKSGQHLLSLINDILDLNAIESGRFVISPERLNLHA 228

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELFFNA---DKRIIKKILFPILSNSIKFTNNNG- 680
           +    + ++   AQ   I++   +P +  F A   D+R +++ L  +LSN+IKF++  G 
Sbjct: 229 LTTSIVEMVRPIAQDAGIRLRTTVPKD--FPAVLLDRRAMEQCLLNLLSNAIKFSHRGGA 286

Query: 681 -KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
             + +  +  G  V I + DTG+G+    ++ IGQPF       D+   G GLGLAI+ +
Sbjct: 287 VDLSVGAAPTG-GVCIAVVDTGVGMASETIKAIGQPFASPGGHVDKR--GAGLGLAITKS 343

Query: 740 LTNLHGGRLKIISQEGKGT 758
           +     G L+I S  G+GT
Sbjct: 344 IVGAMKGELEIQSTPGQGT 362


>gi|163795854|ref|ZP_02189818.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159178887|gb|EDP63423.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 476

 Score =  171 bits (434), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 145/243 (59%), Gaps = 7/243 (2%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
            A Y VE E    AN+ KS FLA MSHELRTPLNAI+GFSEV++ E FG +G  +Y EYA
Sbjct: 233 TADYAVEHE----ANRAKSAFLANMSHELRTPLNAIIGFSEVLQTETFGPIGQKRYIEYA 288

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
            DI+ +G HLL++I+ +L++SKIE  K+ ++    D   +I   + ++G  ++   ++I+
Sbjct: 289 TDINMAGYHLLHVIDEVLDLSKIEAGKVDLNLSTIDPTGVIAAALDMLGPDSERHGVEIQ 348

Query: 646 KKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ--CVIITIADTGI 702
           + + + +     D+  +++I+  ++SNS+K+T   G + + T          ITI+DTG+
Sbjct: 349 RALTATIPVMETDEGKLRQIVLNLVSNSLKYTKPGGSVTVSTEVDTDLSATQITISDTGV 408

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           G+ K  L     PF  + +    + GG GLGL ++ +  +L GG  +I S  G GT V+I
Sbjct: 409 GMSKDELALAMTPFGRIDSAMSYTRGGTGLGLPLTKSFVDLLGGSFQIDSVPGVGTTVSI 468

Query: 763 CMP 765
            +P
Sbjct: 469 QLP 471


>gi|148254874|ref|YP_001239459.1| putative sensor histidine kinase membrane protein [Bradyrhizobium
           sp. BTAi1]
 gi|146407047|gb|ABQ35553.1| putative sensor histidine kinase, putative membrane protein
           [Bradyrhizobium sp. BTAi1]
          Length = 532

 Score =  171 bits (433), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 148/252 (58%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 241 ELEQAKAISDEARYRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPV 300

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 301 YKEYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVALVHVVADCHHLLKLRASSR 360

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            + I    E+ +P      AD+R I++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 361 GLTIHEVFEQNMPR---LWADERAIRQVVLNLLSNAIKFTPQGGEIWLKAGWTASGGQ-- 415

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP++ +  +   F    N    +  G GLGL I+  L  +HGG   + S+
Sbjct: 416 YLSVKDTGSGIPENEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKNLIEMHGGTFTLKSK 475

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 476 VRIGTEVIVTFP 487


>gi|163850345|ref|YP_001638388.1| ATPase domain-containing protein [Methylobacterium extorquens PA1]
 gi|218528903|ref|YP_002419719.1| histidine kinase [Methylobacterium chloromethanicum CM4]
 gi|240137418|ref|YP_002961889.1| putative integral membrane sensor signal transduction histidine
           kinase [Methylobacterium extorquens AM1]
 gi|254559597|ref|YP_003066692.1| integral membrane sensor signal transduction histidine kinase
           [Methylobacterium extorquens DM4]
 gi|163661950|gb|ABY29317.1| ATP-binding region ATPase domain protein [Methylobacterium
           extorquens PA1]
 gi|218521206|gb|ACK81791.1| histidine kinase [Methylobacterium chloromethanicum CM4]
 gi|240007386|gb|ACS38612.1| putative integral membrane sensor signal transduction histidine
           kinase [Methylobacterium extorquens AM1]
 gi|254266875|emb|CAX22674.1| putative integral membrane sensor signal transduction histidine
           kinase [Methylobacterium extorquens DM4]
          Length = 513

 Score =  171 bits (433), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 150/271 (55%), Gaps = 6/271 (2%)

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           RRL A+      SR   +    EL  A A     + RAE AN  KS FLA MSHELRTPL
Sbjct: 214 RRLYASAVGTLQSRAEKDAIFAELEQAKANSDEARRRAEEANLAKSRFLATMSHELRTPL 273

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           NAILGFSEV+K E+FG   +  Y EYA DIH SG HLLN+IN IL++S+IE  +  + ++
Sbjct: 274 NAILGFSEVMKNEVFGAHVAPAYREYATDIHDSGMHLLNLINEILDLSRIEAGRYDLTEE 333

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTN 677
              L   + E   ++   A+SK       I   L    AD+R +++I+  +LSN++KFT 
Sbjct: 334 AVQLAHTVEECRHMMTLRARSKGQTFASLIDDSLPRLWADERALRQIVLNLLSNAVKFTP 393

Query: 678 NNGKMMIR---TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
             G++ I+   TS  GQ   +++ D+G GIP+  L  +   F         +  G GLGL
Sbjct: 394 PGGEITIKVGWTSSGGQY--LSVKDSGPGIPEDELGTVMSSFGRGSLAIKTAEQGSGLGL 451

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            I   L +LHGG  ++ S+  +GT V +  P
Sbjct: 452 PIVKGLIDLHGGGFQLKSKPREGTEVIVTFP 482


>gi|299133592|ref|ZP_07026786.1| integral membrane sensor signal transduction histidine kinase
           [Afipia sp. 1NLS2]
 gi|298591428|gb|EFI51629.1| integral membrane sensor signal transduction histidine kinase
           [Afipia sp. 1NLS2]
          Length = 525

 Score =  171 bits (432), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 146/249 (58%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN +KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 236 ELEQAKAISDEARHRAEAANVSKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGSHAVAV 295

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 296 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEPFSLVHVVADCHHLLKLRASSR 355

Query: 641 NIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
            I I +    E+     D+R  ++I+  +LSN+IKFT   G++ ++   T+  GQ   ++
Sbjct: 356 GITIHEVFEDEMPKLWGDERATRQIVLNLLSNAIKFTPQGGEIWLKSGWTASGGQ--YLS 413

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           + DTG GIP+  +  +   F    N    +  G GLGL I+  L ++HGG   + S+   
Sbjct: 414 VKDTGSGIPEDEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKNLIDMHGGTFTLKSKLRI 473

Query: 757 GTIVTICMP 765
           GT V I  P
Sbjct: 474 GTEVIITFP 482


>gi|172060290|ref|YP_001807942.1| multi-sensor hybrid histidine kinase [Burkholderia ambifaria
           MC40-6]
 gi|171992807|gb|ACB63726.1| multi-sensor hybrid histidine kinase [Burkholderia ambifaria
           MC40-6]
          Length = 989

 Score =  171 bits (432), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 145/546 (26%), Positives = 257/546 (47%), Gaps = 54/546 (9%)

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF---DNKK-FHLSRSMY 285
           + I+F    Q ++ +E + IL E N  +E A+     G+W  +    D+K+ F    ++Y
Sbjct: 247 IVIVFRDVTQKRRAQEAE-ILRETNARLEMAMYGSNVGVWEIDMPEGDHKRGFARYSNIY 305

Query: 286 EIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM----RHASGAD 341
           E +G       L + A   ++H D++   + A       ++  D +F +    RH  G D
Sbjct: 306 EWLGFDTPQARLDYEAYMSVLHPDHRDSTDRA---VASFLESGDGLFELENRLRHRDGTD 362

Query: 342 IWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
            W+ VR    R   G  +  +G  +D+TE    E+    +++R     E  +  +   D 
Sbjct: 363 RWVLVRGTARRDAMGKPVRFVGSLVDITELKMTEQALRASEERFRGTFENAAVGVAHCDL 422

Query: 401 NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ-DAQTRPIIEYRTSDPERSQDMSKEIKL 459
           + R +  N    +  G P   L       +I  D     I  +R     + +  S+E+ L
Sbjct: 423 DGRFLRVNHRSGEIVGWPRDALQHRRLHDLIHADFSVASIERFRLLTEGKLKHYSEEVPL 482

Query: 460 ADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
              R+     W T     +SV      L+H+ +        +   I D+S      ER+ 
Sbjct: 483 V--RFDGERVWVT-----LSVA-----LQHDASG---QTAHVIVIIQDIS------ERKA 521

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI---FGEL 576
            E ++     +V K+ AE A++ K +FLA +SHELRTPLN ILG+++++++++     +L
Sbjct: 522 LEETV-----RVAKDAAEAASRAKDQFLANISHELRTPLNGILGYAQILQRDVRLDTRQL 576

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
            SV        I  SGQHLL +IN+IL+ +++   K+ +      L   +     ++   
Sbjct: 577 ASVGV------IEQSGQHLLTLINDILDFARLGAGKLELQVGEVPLRGFLETIAEIVAVR 630

Query: 637 AQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
           AQ K + +      +L      D+R ++++L  +L+N+++FT + G++ +  S+     +
Sbjct: 631 AQQKRLVLNYVAAPDLPAVVRVDERRLRQVLLNLLANAVQFT-DRGEVTLSVSRGAAGRL 689

Query: 695 -ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
              + DTGIG+    LE I QPFE   +   +S GG GLGLAIS  L  + GG +++ S 
Sbjct: 690 RFEVRDTGIGVSADRLEAIFQPFEQAGDHTRRS-GGAGLGLAISQQLVRMMGGEIEVTSS 748

Query: 754 EGKGTI 759
            G+G++
Sbjct: 749 AGEGSV 754


>gi|209966271|ref|YP_002299186.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
 gi|209959737|gb|ACJ00374.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
          Length = 818

 Score =  171 bits (432), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 152/251 (60%), Gaps = 8/251 (3%)

Query: 523 SIANAKYQVE------KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
           +IA A ++ E      K  AE  ++TKSEFLA MSHELRTPLNAI+GF+EV++ E+  + 
Sbjct: 554 AIAIASHEAERLLEQAKAAAELGSRTKSEFLANMSHELRTPLNAIIGFAEVLESELKQQG 613

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
             +    YA DI  SG+HLLN+IN+IL++SK+E  K+ + ++  D   ++    R++ + 
Sbjct: 614 SPIAKAGYASDIAASGRHLLNLINDILDVSKMEAGKVELRERICDPGELLAGCERIVRAR 673

Query: 637 AQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT-SKIGQCVI 694
           A  + I +  ++P  L     D    K+I+  +LSN+IKFT  +G + ++  +   + + 
Sbjct: 674 AMERRIDLRLEVPPGLPPVLVDDVKFKQIVLNLLSNAIKFTAPSGSVRVKVQADPARGLS 733

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           I ++DTGIGI    LEK+  PF  + N Y +   G GLGLA+S  L  LHGG+L I S  
Sbjct: 734 IAVSDTGIGIRAEDLEKVFIPFNQVDNIYARINPGTGLGLALSRGLAELHGGQLFIESVF 793

Query: 755 GKGTIVTICMP 765
           G+GT  T+ +P
Sbjct: 794 GEGTTATLRLP 804


>gi|309791219|ref|ZP_07685751.1| two-component hybrid sensor and regulator [Oscillochloris
           trichoides DG6]
 gi|308226781|gb|EFO80477.1| two-component hybrid sensor and regulator [Oscillochloris
           trichoides DG6]
          Length = 657

 Score =  171 bits (432), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 97/258 (37%), Positives = 154/258 (59%), Gaps = 12/258 (4%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R++ ER   +L +ANA+        E A++ K EFLA MSHELRTPLN ILG +E++ +
Sbjct: 245 ARRVEER-TADLMVANAEL-------ERASRLKDEFLANMSHELRTPLNTILGRAEILAE 296

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
            I+G +   + +E  + +  SG+HLL +IN+IL++SKIE  K+ +     D++ +    I
Sbjct: 297 GIYGPINQ-EQHEAVRSMSESGRHLLALINDILDLSKIEAGKLELQLSLVDMVTLCEASI 355

Query: 631 RLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGK--MMIRTS 687
           R++  SA  K I++   I P      AD+R +K+IL  +LSN++KFT   G+  + ++T 
Sbjct: 356 RMVAQSALKKEIRLHSSISPQVDVIYADERRLKQILVNLLSNAVKFTPAGGQVELEVQTD 415

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
              Q V  T++DTGIGI ++ + ++ QPF  +     +   G GLGL +   LT  HGG 
Sbjct: 416 PDQQSVSFTVSDTGIGIAEADMARLFQPFVQIDAGLTRQHDGTGLGLVLVQRLTEAHGGS 475

Query: 748 LKIISQEGKGTIVTICMP 765
           + + SQEG G+  T+ +P
Sbjct: 476 VAVQSQEGLGSSFTVRLP 493


>gi|21228875|ref|NP_634797.1| two component system histidine kinase [Methanosarcina mazei Go1]
 gi|20907403|gb|AAM32469.1| Two component system histidine kinase [Methanosarcina mazei Go1]
          Length = 807

 Score =  170 bits (431), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 139/448 (31%), Positives = 230/448 (51%), Gaps = 52/448 (11%)

Query: 329 DQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQRLSKA 387
           D    +RH  G    +   A + R  +G +  +   A D+TE     K+  E  + L+ A
Sbjct: 397 DYQLEIRHKHGHITPVLYNASIYRDENGRVTGVFAAARDITEL----KKAEEKIKALANA 452

Query: 388 IECTSEALVLWDKNDRLVMCNANYQKAYG-LPDHVLVPGNARSIIQDAQTRPIIEYRTSD 446
           +E +++A++    +  +   N   ++ YG L + V+  G   SI++    +  I+     
Sbjct: 453 VESSNDAIITGTLDGTITSWNKGAEQIYGYLAEEVM--GKNVSILEPDNLKGEIKQLFDK 510

Query: 447 PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN 506
            ++     K++K  ++  L+       DG  I+V   +TL                + I 
Sbjct: 511 IKQG----KKVKRYETLRLK------KDG--IAVNVSVTL----------------SPIF 542

Query: 507 DLS--------TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           D+S         +R I E++ TE  +       EK+ AE AN+TKSEFLA MSHELRTPL
Sbjct: 543 DVSGNPVAFSGIARDITEKKITENLLH------EKQMAEFANRTKSEFLANMSHELRTPL 596

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           N+I+GFS+++ ++ +GEL   K      +I  SG+HLLN+IN IL++SKIE  K+ +D +
Sbjct: 597 NSIIGFSDMLYEQAYGELNQ-KQLRAISNISNSGKHLLNLINGILDLSKIEANKMELDYK 655

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTN 677
             +L   ++    ++   A  KNI+IE  + S +    AD+    +I+F ++ N+IKF+ 
Sbjct: 656 EFELASSLDLIRNILSPIADKKNIEIETGVDSSISKICADEDRFIRIMFNLVDNAIKFSF 715

Query: 678 NNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
            N  + I T K G+ V IT+ DTGIGI      K+ +PF  +++   +   G GLGL++ 
Sbjct: 716 ENSLVKIGTRKKGELVEITVEDTGIGIKTEDQNKLFKPFSQVNSFSSKKFQGTGLGLSLV 775

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMP 765
             + NLHGG +   S++GKG+     +P
Sbjct: 776 KQIVNLHGGYVWFKSEQGKGSTFAFAIP 803



 Score = 38.1 bits (87), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 67/162 (41%), Gaps = 6/162 (3%)

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
           L E+  C+  A      G WN+N  + + + S  +Y I G+  +    ++ A    +H +
Sbjct: 195 LKESEKCLAEAQKIAHLGSWNWNIVSNELYWSDEIYRIFGLSPQEFGATYDAFLSYVHPE 254

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG---MNIIGIAMD 366
           ++  C +  +V G    +   I H     G +  I V  Q       G   + + GI  D
Sbjct: 255 DRD-C-VNNAVKGALEGKPYSIDHRIILKGGEERI-VHEQGEVIFENGNVPVRMAGIVQD 311

Query: 367 LTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCN 408
           +TE+  +EK    A+      IE + + LV    + ++   N
Sbjct: 312 ITERKKIEKALGMANAYNRSLIEVSLDPLVTIGPDGKITDVN 353


>gi|163793548|ref|ZP_02187523.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
 gi|159181350|gb|EDP65865.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
          Length = 514

 Score =  170 bits (431), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 145/232 (62%), Gaps = 3/232 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           A+  +++K+ FLA +SHELRTPLNAI+G SE+I+ E++G +G+ KY EYA DI+ SG HL
Sbjct: 260 AKEGSESKTRFLANVSHELRTPLNAIIGMSEIIRDEMWGGIGNPKYREYATDINDSGLHL 319

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN 655
           L++IN IL+ S+IE +K+++     D++ ++++  R +        +  E +    L   
Sbjct: 320 LDVINAILDYSRIEMDKVTLHDDQVDVVGVLDQSRRTVQRLLDEGGLTCELQAKGPLVLV 379

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ--CVIITIADTGIGIPKSALEKIG 713
           AD+R ++++L  +LSN+IK T   G++ + T++ G    +++T+ D+G GIP+  L  + 
Sbjct: 380 ADRRSVRQMLLNLLSNAIKHTPPGGRITL-TAEAGNEGELVLTVRDSGEGIPRERLALVT 438

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +PF    +      GG GLGLAI+  L   HGG + I S+ G+GT V +  P
Sbjct: 439 EPFNLDEDISVSRQGGTGLGLAITKGLIKRHGGAMSINSRVGEGTTVRLVFP 490


>gi|222148514|ref|YP_002549471.1| two component sensor kinase [Agrobacterium vitis S4]
 gi|221735500|gb|ACM36463.1| two component sensor kinase [Agrobacterium vitis S4]
          Length = 511

 Score =  170 bits (431), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 148/248 (59%), Gaps = 2/248 (0%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+ +E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANMAKSRFLASMSHELRTPLNAILGFSEVMAQEVLGPLNNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY+ DIH SGQHLLN+IN IL++S+IE  K  + +++  L+ +  + + ++   A++
Sbjct: 299 LYREYSGDIHRSGQHLLNLINEILDLSRIEAGKYDLSEESISLLEVAEDCVGMVQLRAKA 358

Query: 640 KNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITI 697
           K+IKI ++    L    AD++ +++++  +LSN++KFT   G+++++    +G    ++I
Sbjct: 359 KDIKISQQYEINLPALWADEKALRQVVLNLLSNAVKFTPPGGEILVKVGWTVGGGQYVSI 418

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
            D G GI +  +  +   F         +  G GLGL I  A+   HGG  K+ S+  +G
Sbjct: 419 KDNGPGIAEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHGGEFKLKSKLREG 478

Query: 758 TIVTICMP 765
           T V   +P
Sbjct: 479 TEVIAILP 486


>gi|316934854|ref|YP_004109836.1| integral membrane sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
 gi|315602568|gb|ADU45103.1| integral membrane sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris DX-1]
          Length = 530

 Score =  170 bits (430), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 149/252 (59%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  + A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 242 ELEQSKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPA 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++++   L+   A S+
Sbjct: 302 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAISLVHVVSDCHHLLKLRATSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R +++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAVRQVVLNLLSNAIKFTPQGGEIWLKAGWTASGGQY- 417

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 418 -LSVKDTGSGIPEEEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRIGTEVIVTFP 488


>gi|158422717|ref|YP_001524009.1| sensor protein [Azorhizobium caulinodans ORS 571]
 gi|158329606|dbj|BAF87091.1| sensor protein [Azorhizobium caulinodans ORS 571]
          Length = 553

 Score =  170 bits (430), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 148/244 (60%), Gaps = 7/244 (2%)

Query: 528 KYQVEKE-----RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYY 582
           K Q+E++      AE AN  KS FLA MSHELRTPLN ILGFSE++  +    + + +  
Sbjct: 281 KIQLEEDHRARTEAERANLAKSRFLAAMSHELRTPLNTILGFSELLATDTEQRIDARRKE 340

Query: 583 EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
           +YA+ IH SGQHLL ++N+IL++S++E     +  ++ D+  +++  + ++G  A  +NI
Sbjct: 341 DYARIIHESGQHLLGVVNDILDLSRVEAGAYELSFEHIDMAHLVDGCVEMVGLDAARRNI 400

Query: 643 KIEKKIPSELFFN-ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
           K+   +P+ L    AD+R ++++   +LSN++KF+ + G + +  S     V +++ D+G
Sbjct: 401 KVTTLLPARLPRPMADQRAVRQMTLNLLSNAVKFSEHGGLVEVNVSAQNGVVSLSVRDSG 460

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
            G+  + +E++G+PF       ++   G GLGLA+  AL  LH G  ++ S  G GT VT
Sbjct: 461 AGMSPAEVERLGEPFFQA-GDAERRARGSGLGLAVVRALVKLHDGAFEVTSSVGGGTTVT 519

Query: 762 ICMP 765
           I +P
Sbjct: 520 ISLP 523


>gi|39935041|ref|NP_947317.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris CGA009]
 gi|39648892|emb|CAE27413.1| sensor histidine kinase [Rhodopseudomonas palustris CGA009]
          Length = 532

 Score =  170 bits (430), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 148/252 (58%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  + A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 243 ELEQSKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPA 302

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 303 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAISLVHVVTDCHHLLKLRATSR 362

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R +++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 363 GITIHEVFEQGMPR---IWGDERAVRQVVLNLLSNAIKFTPQGGEIWLKAGWTASGGQY- 418

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 419 -LSVKDTGSGIPEEEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLKSK 477

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 478 LRIGTEVIVTFP 489


>gi|167043517|gb|ABZ08213.1| putative histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
           [uncultured marine microorganism HF4000_APKG2J17]
          Length = 669

 Score =  170 bits (430), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/420 (31%), Positives = 214/420 (50%), Gaps = 36/420 (8%)

Query: 354 ISGGMNIIGIA---MDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNAN 410
           I    +IIGI    +D+T +   E+   E + R    +      + L D++ + ++ N  
Sbjct: 270 IGADGSIIGIGGTNVDITARVQAEEARREVESRFRTVVNSAPMGISLKDRDGKFLLVN-- 327

Query: 411 YQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEW 470
             K +G                DA    I E +T     ++  + EI+  D +  +  E 
Sbjct: 328 --KTFG-------------TWMDADPAEI-EGKTFHELFAEKQAGEIESLDRKIFETGEE 371

Query: 471 CTHDGGTI-SVGTDITLLKHNQAQLRESKRRLKATINDLSTSR-QILERQKTELSIANAK 528
              +   +   G   T+  H     +   R     I  +ST    I +R++ E S+  A 
Sbjct: 372 SVDEAIRLFQDGVTRTIFTH-----KSPVRSATGGIVAVSTIMIDITDRKQAEESLRKAM 426

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
                ERAE AN+ K+EFLA MSHELRTPLNAILG+S+++K ++FG LG+ KY +Y ++I
Sbjct: 427 -----ERAEFANRAKAEFLAHMSHELRTPLNAILGYSDILKSQVFGPLGNEKYSDYVENI 481

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
             +G HLL ++++IL++SK+E  ++ I+    D+   I E   ++   A    + +   +
Sbjct: 482 SAAGGHLLGILSDILDVSKVEAGELDIEDSEIDIAAAIKECKIMMLERADIAKVSLASLV 541

Query: 649 PSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT-SKIGQCVIITIADTGIGIPK 706
             +     AD+R +++IL  +LSN++KF++  GK+ I   +     ++I +ADTGIGI  
Sbjct: 542 AGDLPRLRADRRRLRQILLNLLSNAVKFSHEKGKVSIAAETDAAGAIVIRVADTGIGIAP 601

Query: 707 SALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             + KI QPF  +   Y    G G GLGL++ ++L +LHGG L I S  G+GT + I  P
Sbjct: 602 ENMGKILQPFGQVKESYVGKPGEGSGLGLSLVNSLMDLHGGTLDIDSTPGEGTTMNIIFP 661


>gi|192290576|ref|YP_001991181.1| integral membrane sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
 gi|192284325|gb|ACF00706.1| integral membrane sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris TIE-1]
          Length = 531

 Score =  170 bits (430), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 148/252 (58%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  + A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 242 ELEQSKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPA 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 302 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAISLVHVVTDCHHLLKLRATSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R +++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAVRQVVLNLLSNAIKFTPQGGEIWLKAGWTASGGQY- 417

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 418 -LSVKDTGSGIPEEEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRIGTEVIVTFP 488


>gi|91772161|ref|YP_564853.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanococcoides burtonii DSM 6242]
 gi|91711176|gb|ABE51103.1| HATPase domain-containing multisensor signal transduction histidine
           kinase [Methanococcoides burtonii DSM 6242]
          Length = 763

 Score =  169 bits (429), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 152/253 (60%), Gaps = 7/253 (2%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I +R+K E  +  AK       AE  N+TKSEFLA MSHELRTPLN+I+GFSE++ ++  
Sbjct: 506 ITKRKKAEDMVIQAKLD-----AEATNRTKSEFLANMSHELRTPLNSIIGFSELLLEKTI 560

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G++ + K   Y  +I   GQHLL++IN IL++SK+E+ K+ +      +  +I++ + L+
Sbjct: 561 GDINN-KQERYISNILTGGQHLLSLINEILDISKVESGKMELHYDEFAISSMISDIVILL 619

Query: 634 GSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              A +  I+I   I   L   NADK  IK+IL+ +LSN+IKFTN NG + I      + 
Sbjct: 620 NPLAITNRIEIITDIDKRLSLINADKIKIKQILYNLLSNAIKFTNENGTISIEAIFDDKL 679

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           + I I D GIGI K  +EK+ QPF+ + +   +   G GLGLA+      +HGG + + S
Sbjct: 680 MQICIKDNGIGIEKENIEKLFQPFQQIDSAASRKYQGTGLGLALVKNFVEMHGGNIWVDS 739

Query: 753 QEGKGTIVTICMP 765
           + GKG+  T  +P
Sbjct: 740 EMGKGSAFTFTIP 752


>gi|146339710|ref|YP_001204758.1| sensor histidine kinase [Bradyrhizobium sp. ORS278]
 gi|146192516|emb|CAL76521.1| Putative sensor histidine kinase with a PAS domain [Bradyrhizobium
           sp. ORS278]
          Length = 610

 Score =  169 bits (428), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 149/267 (55%), Gaps = 3/267 (1%)

Query: 502 KATINDLSTSRQILE--RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           +A +    T ++++   R  T+  +     ++ +  AE A+  K+ FLA MSHELRTPLN
Sbjct: 310 RAGVTCAGTDQEVVAVMRDVTDRKLQEQALELARSAAERADAAKTRFLATMSHELRTPLN 369

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AI+GFSE++ +E    L + +  EYAQ I+ SGQHLL+++N IL+MSK+E+    +  + 
Sbjct: 370 AIIGFSEMLMQEQVLVLNAARRREYAQLINDSGQHLLSVVNGILDMSKMESGHFELTPEP 429

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNN 678
                 +     L+   A+   + +    P +L     D R  K+I+  ++SN+IKFT  
Sbjct: 430 FAPRTALFNCCNLLALRARENGVDLAADAPHDLPVITGDPRAFKQIVINLVSNAIKFTER 489

Query: 679 NGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
            G++ +     G  +++ I DTG+GI    L++IG PF      Y +   G GLGL+I  
Sbjct: 490 GGRVTVSAGVDGARLLLRITDTGVGIAADDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVK 549

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
           +L  LHGG + I S+  +GT VTI +P
Sbjct: 550 SLVTLHGGEMSIESKLDEGTTVTIALP 576


>gi|15887959|ref|NP_353640.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
 gi|15155563|gb|AAK86425.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
          Length = 1275

 Score =  169 bits (428), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 164/269 (60%), Gaps = 8/269 (2%)

Query: 500  RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
            RLK++    +  R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLN
Sbjct: 1005 RLKSSHGYCAVIRDITQWKRTEEELRNAKRA-----AETANAHKTDFLARVSHEIRTPLN 1059

Query: 560  AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
            AI+GFS+++  E FG +G+ +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D   
Sbjct: 1060 AIIGFSDMMATERFGPIGNPRYVEYANDIGRSGRHVLDIVNDLLDISKIEAGQMDVDFIA 1119

Query: 620  ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNN 678
              L   + E + L+   A ++ + I   +   +    AD R IK+I+  ILSN+I+FT +
Sbjct: 1120 VPLNETVAEAVSLVQPQANNQRVIIRTALAQSVPQIVADLRSIKQIVLNILSNAIRFTPS 1179

Query: 679  NGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAI 736
             G++++ T+ +    V + I DTGIG+ ++ LE+  +PF  + +   +  G G GLGL +
Sbjct: 1180 GGQIVVSTAYEANGSVSLRIRDTGIGMTRAELEQAMKPFRQVASSGKRVRGDGTGLGLPL 1239

Query: 737  SDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + A+ + +     I S   +GT+V I  P
Sbjct: 1240 TKAMVDANRANFSITSTPNEGTLVEITFP 1268


>gi|288957783|ref|YP_003448124.1| two-component sensor histidine kinase [Azospirillum sp. B510]
 gi|288910091|dbj|BAI71580.1| two-component sensor histidine kinase [Azospirillum sp. B510]
          Length = 593

 Score =  169 bits (428), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 139/241 (57%), Gaps = 4/241 (1%)

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           + Q EKE AE AN+ KSEFLA MSHELRTPLNAI+GF++V+   IFG     K+ EY   
Sbjct: 354 RLQSEKELAEAANQAKSEFLANMSHELRTPLNAIIGFADVLMSGIFGP-APPKHAEYLTA 412

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE-K 646
           IH SG+HLL+++N +L+M+KIE  ++ +      L   + + + L+ + A  K + +   
Sbjct: 413 IHQSGRHLLDLVNELLDMAKIEAGRLELFPTRIALDDFLTDCLGLVEALALRKGVTLTGD 472

Query: 647 KIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--KIGQCVIITIADTGIGI 704
            I   L   AD   +++ +  +LSN+IKFT   G + +  +    G   +IT+ D+GIG+
Sbjct: 473 AIAPGLLVTADGVRMRQAVLNLLSNAIKFTPAGGTVRLEATADPDGSGTVITVRDSGIGM 532

Query: 705 PKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
               +    +PF  +HN   ++  G GLGL ++      HGG L + S+ G GT VTI +
Sbjct: 533 NAEEMLIAMEPFRQVHNYLTKAEAGTGLGLPLARRFVEAHGGTLTLDSRPGAGTTVTIRL 592

Query: 765 P 765
           P
Sbjct: 593 P 593


>gi|329890535|ref|ZP_08268878.1| non-motile and phage-resistance protein [Brevundimonas diminuta
           ATCC 11568]
 gi|328845836|gb|EGF95400.1| non-motile and phage-resistance protein [Brevundimonas diminuta
           ATCC 11568]
          Length = 250

 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 88/240 (36%), Positives = 144/240 (60%), Gaps = 3/240 (1%)

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
           A+    +  AE  N  K+ FLA MSHELRTPLNA++GFS+ +++E+FG +   +Y +YA 
Sbjct: 7   AELDAARAEAEAQNLGKTRFLAHMSHELRTPLNAVVGFSDAMRQELFGPVPP-RYADYAA 65

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            IH +G HLL++IN++L++S+IE ++  +  +  D    +   + L+   A  K +++  
Sbjct: 66  SIHEAGGHLLDLINDVLDVSRIEADRYQLSLERFDAREPVLAALALVRIQADDKGVELAA 125

Query: 647 KIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
            +P E L   AD+R +K++   +L+N++KFT   G + +        + +T+ADTG+GI 
Sbjct: 126 VLPPEALSVRADRRALKQMALNLLANAVKFTPPGGTVTVSVQAADDALEVTVADTGVGIS 185

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              L ++G+P+E   +  +Q   G GLGLA+  AL  LHGG L + S  G GT  T+ +P
Sbjct: 186 AEDLARLGRPYEQAGDA-EQRAQGSGLGLALVRALAGLHGGTLALDSALGVGTAATVRLP 244


>gi|320354604|ref|YP_004195943.1| multi-sensor hybrid histidine kinase [Desulfobulbus propionicus DSM
            2032]
 gi|320123106|gb|ADW18652.1| multi-sensor hybrid histidine kinase [Desulfobulbus propionicus DSM
            2032]
          Length = 1626

 Score =  169 bits (427), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 145/527 (27%), Positives = 244/527 (46%), Gaps = 66/527 (12%)

Query: 260  ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKI--CEIA 317
            AL     GLW+++ D  + + S S + ++G          ++   L+H D++     E  
Sbjct: 634  ALEASNDGLWDWDLDTGRVYCSPSFFTMLGYTPGELVPHIQSWHELVHPDDRAWVSAEAY 693

Query: 318  RSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG--MNIIGIAMDLT--EKYHL 373
            R +  +   +L+  +  R   G  +W+  R +++     G  + ++G+  DLT  ++  L
Sbjct: 694  RRIAEEGGFELE--YRSRTKDGRSLWVLSRGKVVARAPDGRPLRVVGVHTDLTTHKRIEL 751

Query: 374  EKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD 433
            E R    +Q   +AI   +   + + K+  +V CN   ++ +G         +A   +  
Sbjct: 752  ELRTVAEEQ---QAILNAAPVGICFIKDRTVVRCNRKLEEIFG---------HAPGAMAG 799

Query: 434  AQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
              T P  E        S+   +EI                 G TI+       L H + Q
Sbjct: 800  TSTLPWYE--------SEAEYQEI-----------------GRTIAHALKEQALFHAERQ 834

Query: 494  L-RESKRRLKATI-------NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
            L R+   R  A +        DLS     +    T+   A+A     KERAE A + KSE
Sbjct: 835  LVRQDGSRFWARMTAQALAPGDLSKGLVGMLEDITDEREASAALHAAKERAEAATRAKSE 894

Query: 546  FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
            FLA MSHE+RTP+NAILGF+ +IK++      +       + +  +  HLLN+IN+IL++
Sbjct: 895  FLANMSHEIRTPMNAILGFAHLIKRDPL----TPSQLAQLEKLSAATHHLLNIINDILDI 950

Query: 606  SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI---EKKIPSELFFNADKRIIK 662
            SKIE  K+ +  ++ DL  II+    L+  S  +K++++      +PS      D   + 
Sbjct: 951  SKIEANKMELGVEDFDLARIIDRIAALVADSVLAKHLELFVDLDHVPS--MLRGDGSRLG 1008

Query: 663  KILFPILSNSIKFTNNNG---KMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIGQPFEP 718
            +IL  ++SN+IKFT        + +  ++  + V+   I DTGIG+    +E+   PFE 
Sbjct: 1009 QILLNVVSNAIKFTEQGAVDITVRVVDAREDRPVLRFEIRDTGIGMSAEQVERAFLPFEQ 1068

Query: 719  LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +   +  GG GLGL IS  L  L GGR+ + S+ G GT+  + +P
Sbjct: 1069 ADSSMTRRFGGTGLGLTISRQLVELMGGRMGVESELGHGTLCWLEIP 1115


>gi|222086249|ref|YP_002544781.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
 gi|221723697|gb|ACM26853.1| two-component sensor histidine kinase protein [Agrobacterium
           radiobacter K84]
          Length = 509

 Score =  169 bits (427), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 146/253 (57%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 237 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLNNA 296

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY  DIH SGQHLLN+IN IL++S+IE  K  ++++   L+ +  + I ++   A+ 
Sbjct: 297 TYREYTTDIHRSGQHLLNLINEILDLSRIEAGKYELNEEAISLLDVAEDCIGMVQLRARG 356

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E ++PS     AD++ I++++  +LSN++KFT   G++ ++   TS  GQ 
Sbjct: 357 KNISISPQFELQLPS---VWADEKSIRQVILNLLSNAVKFTPQGGEITVKVGWTSGGGQY 413

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           V   I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 414 V--AIRDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFMLKS 471

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 472 KLREGTEVIAILP 484


>gi|21228731|ref|NP_634653.1| sensory transduction histidine kinase [Methanosarcina mazei Go1]
 gi|20907241|gb|AAM32325.1| hypothetical sensory transduction histidine kinase [Methanosarcina
           mazei Go1]
          Length = 716

 Score =  169 bits (427), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 151/259 (58%), Gaps = 8/259 (3%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T R I ER+  E      K   EK+ AE AN+TKSEFLA MSHELRTPLN+I+GFS++
Sbjct: 458 LGTFRDITERKAIE------KLLQEKQVAEIANRTKSEFLANMSHELRTPLNSIIGFSDL 511

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +  +I+G+L   K  +Y  +I  SG+HLLN+IN+IL++SK+E  K+ +D +  +L   +N
Sbjct: 512 LCDQIYGKLNE-KQLKYTNNISKSGKHLLNLINDILDLSKVEAGKMELDYREFELADRLN 570

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A  KNIKIE  +  +L    AD+    +I++ ++ N+IKF+  N  + I  
Sbjct: 571 SVKSLLSPIAARKNIKIEINVNKDLTTICADEARFVQIMYNLVDNAIKFSFENNPVRIEA 630

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            + G+ +  T+ D GIGI      K+ QPF  +     +   G GLGL++   + NLHGG
Sbjct: 631 RRKGEFLETTVTDIGIGIKPEDQHKLFQPFSQVAAFSSKKFQGTGLGLSLVKQIVNLHGG 690

Query: 747 RLKIISQEGKGTIVTICMP 765
            +   S  G+G+     +P
Sbjct: 691 YVWFRSIPGEGSTFAFAIP 709


>gi|254474320|ref|ZP_05087709.1| two component sensor kinase [Pseudovibrio sp. JE062]
 gi|211956595|gb|EEA91806.1| two component sensor kinase [Pseudovibrio sp. JE062]
          Length = 767

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 154/257 (59%), Gaps = 11/257 (4%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R I + ++ E  + +A+Y     +AE AN  KSE+L K+SHE+RTPLNA++GFSEV+++E
Sbjct: 512 RDITQFKRAEEELVSARY-----KAEEANTHKSEYLTKISHEIRTPLNAVIGFSEVMQEE 566

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FGELG+V+Y EYA+DIH S  H+L +IN++L+++KIE  K+ +  +      IINE + 
Sbjct: 567 RFGELGNVRYKEYARDIHRSCSHMLTLINDLLDLAKIEAGKMDLAFEAVSAADIINECVA 626

Query: 632 LIGSSAQSKNIKIEKKIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR--TSK 688
           L+   A  + + I    P S     AD + +++I   +LSN+IKF  + G++++      
Sbjct: 627 LLQPQANEQRVIIRASTPLSVPKIVADPKTLRQITLNLLSNAIKFNRSGGQVIVSLVLDP 686

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G+ V + + DTG G+ K+ LE   QPF  L+     S  G GLGL ++ AL   +    
Sbjct: 687 NGE-VHLRVRDTGHGMSKADLEAALQPFRRLNASA--STEGSGLGLPLTKALVEANRASF 743

Query: 749 KIISQEGKGTIVTICMP 765
            I S+E +GT+  +  P
Sbjct: 744 SINSEEDEGTLAEVTFP 760


>gi|116250541|ref|YP_766379.1| two-component regulator sensor histidine kinase protein [Rhizobium
            leguminosarum bv. viciae 3841]
 gi|115255189|emb|CAK06263.1| putative two-component regulator sensor histidine kinase protein
            [Rhizobium leguminosarum bv. viciae 3841]
          Length = 1310

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 158/257 (61%), Gaps = 8/257 (3%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 1052 RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1106

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1107 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1166

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A S+ + I   +   +    AD R IK+I   ILSN+I+FT + G++++ TS + 
Sbjct: 1167 LVQPQANSQRVIIRTALSHAVPEVVADLRSIKQIALNILSNAIRFTPSGGQIVVSTSYEA 1226

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRL 748
               V++ + DTGIG+ +S L++  +PF  + +   +  G G GLGL ++ A+ + +    
Sbjct: 1227 NGSVVLRVRDTGIGMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANRATF 1286

Query: 749  KIISQEGKGTIVTICMP 765
             I S   +GT+V I  P
Sbjct: 1287 SINSAPNEGTLVEITFP 1303


>gi|319783623|ref|YP_004143099.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169511|gb|ADV13049.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 506

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 145/250 (58%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL  A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G + + 
Sbjct: 238 AELETAKSMSDEARRRAEDANLAKSRFLASMSHELRTPLNAILGFSEVMSNEVLGPMSNP 297

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +YA D+H SGQHLL++IN IL++S+IE  +  ++++   L+ I+ +   ++   A++
Sbjct: 298 TYRDYAHDVHESGQHLLDLINEILDLSRIEAGRYQLNEEPVMLLGIVEDCCHMMELRARN 357

Query: 640 KNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           K+I++ +    EL    AD+R +++I   +LSN+IKFT   G++ +R   T+  GQ   I
Sbjct: 358 KDIRVVQDFEHELPRLFADERAVRQITLNLLSNAIKFTATGGEIRVRVGWTAGGGQ--YI 415

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D G GIP+  +  +   F         +  G GLGL I   L  +HGG  ++ S+  
Sbjct: 416 SIKDNGPGIPEDEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQGLLAMHGGEFELHSKLR 475

Query: 756 KGTIVTICMP 765
           +GT      P
Sbjct: 476 EGTEAIAIFP 485


>gi|170741016|ref|YP_001769671.1| integral membrane sensor hybrid histidine kinase [Methylobacterium
           sp. 4-46]
 gi|168195290|gb|ACA17237.1| integral membrane sensor hybrid histidine kinase [Methylobacterium
           sp. 4-46]
          Length = 927

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 130/429 (30%), Positives = 211/429 (49%), Gaps = 70/429 (16%)

Query: 363 IAMDLTEKYHLEKRYAEADQR---LSKAIECTSEALVLWDKNDRLVMCNANYQK------ 413
           IA+  T +   E+   EA+ +   L  A+ C  E   L+D++DRLVM NA Y +      
Sbjct: 249 IALLRTAQAERERLTREAEHQRLILEDAVACMQEGFALYDRDDRLVMANARYSEMLMGQS 308

Query: 414 ---AYGLPDHVLVPG-NARSIIQDAQTR----PIIEYRTSDPERSQDMSKEIKLADSRWL 465
              A GLP   L+    AR    DA+        I  R ++  RS   + E ++   RWL
Sbjct: 309 AAAAMGLPFETLIQQVAARRDESDAEADLDHDAWIAQRLAEHRRSGS-TTETRVR-GRWL 366

Query: 466 QINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIA 525
           QI +  THDGGT+++  DIT LK  + +L +++                           
Sbjct: 367 QIAKHRTHDGGTVTLVMDITDLKQREIELDQAR--------------------------- 399

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
                     AE AN+ KSEFLA MSHELRTPLNAI+G+S++++++   + G+       
Sbjct: 400 --------AEAERANQVKSEFLANMSHELRTPLNAIIGYSQMLREDAADD-GNDGAVADL 450

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
             I  +G+HLL++IN+IL++SKIE  K+ +  +  + IP + E +RL+     ++N   +
Sbjct: 451 TKIEGAGKHLLDLINDILDLSKIEAGKMDVFLEEIN-IPELLEDVRLLIEPVAARN---D 506

Query: 646 KKIPSELFFNADKRI-----IKKILFPILSNSIKFTNNNGKMMIRT----SKIGQCVIIT 696
            ++       A + +     +K+ L  +LSN+ KFT   G + +       + G  +   
Sbjct: 507 NRLVVACAAGASRMVTDVTKLKQSLLNLLSNAAKFT-KGGLLTLSVDPDPDRAGN-LCFA 564

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           ++DTGIG+    + ++ Q F+   N   +  GG GLGLAI+ +   + GG + + S  G 
Sbjct: 565 VSDTGIGLSPEQVGRLFQAFQQADNSTTRKFGGTGLGLAITRSFARMLGGDIAVTSALGA 624

Query: 757 GTIVTICMP 765
           G+   I +P
Sbjct: 625 GSTFVITLP 633


>gi|20091382|ref|NP_617457.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19916518|gb|AAM05937.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 740

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 155/259 (59%), Gaps = 8/259 (3%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T R + ER++ E      K   EK+ AE AN+TKSEFLA MSHELRTPLN+I+GFS++
Sbjct: 462 LQTCRDVTERKEAE------KLLQEKQVAEVANRTKSEFLANMSHELRTPLNSIIGFSDL 515

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           + ++I+G+L   K  +   +I  SG+HLLN+IN+IL++SK+E  K+ ++ +  +L   +N
Sbjct: 516 LYEKIYGDLNE-KQLKAVGNISRSGKHLLNLINDILDLSKVEAGKLELEYKEFELSSKLN 574

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A  K I+++ ++   L    AD+    +I++ +L N+IKF+  NG + I  
Sbjct: 575 SIKNLLSPIADRKMIEVQIQVDESLNTIRADEARFAQIMYNLLDNAIKFSKENGLVEIDA 634

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            + G  V IT+ D GIGI      K+ +PF  + +   + + G GLGLA+   + NLHGG
Sbjct: 635 KRKGDTVEITVKDYGIGIKVEDQSKLFKPFSQIASFSSKKVQGTGLGLALVKQIVNLHGG 694

Query: 747 RLKIISQEGKGTIVTICMP 765
            +   S+ G+G+     +P
Sbjct: 695 YIWFNSRIGEGSTFAFTIP 713


>gi|115523991|ref|YP_780902.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris BisA53]
 gi|115517938|gb|ABJ05922.1| signal transduction histidine kinase [Rhodopseudomonas palustris
           BisA53]
          Length = 545

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 155/274 (56%), Gaps = 12/274 (4%)

Query: 499 RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           RRL +T      +R   +    EL  A A     + RAE AN  KS FLA+MSHELRTPL
Sbjct: 231 RRLHSTTLATLEARAEKDALIGELEQAKAISDEARHRAEAANVAKSRFLAQMSHELRTPL 290

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           NAILGFSEV+K EIFG      Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++
Sbjct: 291 NAILGFSEVMKSEIFGAHAVAVYKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEE 350

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIK 674
              L+ ++ +   L+   A ++ I I    E+ +P      AD+R  ++I+  +LSNSIK
Sbjct: 351 AVSLVHVVADCHHLLKLRASNRGITIHEVFEQGMPR---IWADERAARQIVLNLLSNSIK 407

Query: 675 FTNNNGKMMIR---TSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFG 731
           FT   G++ ++   T+  GQ   +++ DTG GI +  +  +   F    N    +  G G
Sbjct: 408 FTPQGGEIWLKVGWTASGGQ--YLSVKDTGSGIAEDEIPIVLASFGQGSNSIKSAEQGAG 465

Query: 732 LGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           LGL I+ +L ++HGG   + S+   GT V +  P
Sbjct: 466 LGLPIAKSLIDMHGGTFTLKSKLRIGTEVIVTFP 499


>gi|241205034|ref|YP_002976130.1| histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858924|gb|ACS56591.1| histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 511

 Score =  168 bits (426), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 299 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 359 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 473

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 474 KLREGTEVIAILP 486


>gi|218662726|ref|ZP_03518656.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli IE4771]
          Length = 570

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 184 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 243

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 244 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 303

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 304 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 359

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 360 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 418

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 419 KLREGTEVIAILP 431


>gi|209967043|ref|YP_002299958.1| histidine protein kinase DivJ (or putative bacteriophytochrome)
           [Rhodospirillum centenum SW]
 gi|209960509|gb|ACJ01146.1| histidine protein kinase DivJ (or putative bacteriophytochrome)
           [Rhodospirillum centenum SW]
          Length = 894

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 150/235 (63%), Gaps = 2/235 (0%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           +++A +A + + +F+A  SHELRTPLNAI+GFSE+I+ + FG +G  +Y EYA DI  +G
Sbjct: 652 RQQAISAMEQQRKFIAAASHELRTPLNAIIGFSEMIQMQTFGPVGDTRYQEYATDILNAG 711

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK-IEKKIPSE 651
           +HLL++IN+IL + +++    +       L   I + +R++   A++++I  + ++ P  
Sbjct: 712 RHLLDLINDILTLGRMQPGAAAAADAPVCLNDEIRQALRMVEDQARARSIAVVWEEPPYR 771

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKM-MIRTSKIGQCVIITIADTGIGIPKSALE 710
           +  + + R +++IL  +LSN++KFT   G++ ++     G+ + + I+DTGIGI ++ +E
Sbjct: 772 ILLDMEARAVRQILLNLLSNAVKFTPPGGQVSVVLGGHDGEDLWLEISDTGIGIAEADME 831

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + +PF    N Y +S  G GLGL+I  AL   HGGR+ + S+ G+GT + I +P
Sbjct: 832 HVFEPFFRAGNVYTRSTEGTGLGLSIVRALMEAHGGRVSLRSRYGQGTTLRITLP 886


>gi|75676406|ref|YP_318827.1| Signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421276|gb|ABA05475.1| signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
          Length = 605

 Score =  168 bits (425), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 153/259 (59%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           ++  R + +R++ E ++      + +  AE A+  K+ FLA MSHELRTPLNAI+GFS++
Sbjct: 316 VAVMRDVTDRKQQEHAL-----DLARTAAERADAAKTRFLATMSHELRTPLNAIIGFSDM 370

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I +E    L + +  EYAQ I+ SGQHLL+++N+IL+MSK+E+    I  +      ++ 
Sbjct: 371 IVQEATLPLDATRRKEYAQLINDSGQHLLSVVNSILDMSKMESGSFEILPEPFAPREVLL 430

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            G  L+   A+  +I++  ++P  L     D R  ++I+  ++SN+IKFT   G++ I  
Sbjct: 431 SGSNLLALKARDNDIELVTRVPENLPQMVGDPRAFRQIVLNLVSNAIKFTERGGRVTISA 490

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G  +++ + D G+GI +  L++IG PF      Y +   G GLGL+I  +L  LHGG
Sbjct: 491 RVEGARMVLRVVDNGVGIAQEDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVKSLVGLHGG 550

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S+  +GT VT+ +P
Sbjct: 551 EIDVQSKVEEGTTVTVMLP 569


>gi|154251573|ref|YP_001412397.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154155523|gb|ABS62740.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 502

 Score =  168 bits (425), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 144/234 (61%), Gaps = 2/234 (0%)

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
           R+E AN+ K++FLA MSHELRTPLNAI+GFSE+I  ++FG +G  KY +YA DI  SG H
Sbjct: 253 RSEAANRAKNDFLAIMSHELRTPLNAIIGFSEIISNQMFGPVGQPKYVDYAADIRSSGAH 312

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-F 653
           LL++IN+IL++SK E  K+ ++++  D +  +N  +R+    A    +++  ++  ++ +
Sbjct: 313 LLSIINDILDISKAEAGKLQLEEEPIDPVEALNSTMRMFRQRASELGVELSFRVRDDIPW 372

Query: 654 FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKI 712
             AD R+  ++   + SN++KFT  NG++ +         +++ + DTGIGI  +   +I
Sbjct: 373 IIADPRLFNQVAINLTSNALKFTPENGEVSVELGLNPAGDMVLAVRDTGIGIKAADTTRI 432

Query: 713 GQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            +PF  + +   ++  G GLGL +   + NLHGG +++ S   +GTI     P+
Sbjct: 433 FEPFVQVEDAMSRTQQGTGLGLPLVRKIMNLHGGSIELESVVDEGTIARATFPR 486


>gi|91976523|ref|YP_569182.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris BisB5]
 gi|91682979|gb|ABE39281.1| ATP-binding region, ATPase-like [Rhodopseudomonas palustris BisB5]
          Length = 530

 Score =  168 bits (425), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/252 (38%), Positives = 148/252 (58%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 242 ELEQAKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVPV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++++   L+   A S+
Sbjct: 302 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAISLVHVVSDCHHLLKLRASSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R +++++  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAVRQVVLNLLSNAIKFTPQGGEIWLKVGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GIP+  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 417 YLSVKDTGSGIPEEEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLVDMHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
               T V +  P
Sbjct: 477 LRISTEVIVTFP 488


>gi|209885662|ref|YP_002289519.1| periplasmic sensor signal transduction histidine kinase
           [Oligotropha carboxidovorans OM5]
 gi|209873858|gb|ACI93654.1| periplasmic sensor signal transduction histidine kinase
           [Oligotropha carboxidovorans OM5]
          Length = 523

 Score =  168 bits (425), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 145/249 (58%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN +KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 236 ELEQAKAISDEARHRAEAANVSKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGPHAVPV 295

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+  + +   L+   A ++
Sbjct: 296 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEPFSLVHAVADCHHLLKLRASNR 355

Query: 641 NIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
            I I +    ++     D+R  ++I+  +LSN+IKFT   G++ ++   T+  GQ +I+ 
Sbjct: 356 GITIHEAFEEDMPKLWGDERATRQIVLNLLSNAIKFTPQGGEIWLKAGWTASGGQYLIVK 415

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
             DTG GIP   +  +   F    N    +  G GLGL I+ +L ++HGG   + S+   
Sbjct: 416 --DTGSGIPDDEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLKSKLRI 473

Query: 757 GTIVTICMP 765
           GT V I  P
Sbjct: 474 GTEVIITFP 482


>gi|209549672|ref|YP_002281589.1| integral membrane sensor signal transduction histidine kinase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535428|gb|ACI55363.1| integral membrane sensor signal transduction histidine kinase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 511

 Score =  168 bits (425), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 299 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 359 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 473

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 474 KLREGTEVIAILP 486


>gi|154253689|ref|YP_001414513.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157639|gb|ABS64856.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 377

 Score =  168 bits (425), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/268 (36%), Positives = 162/268 (60%), Gaps = 18/268 (6%)

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           I +L TSR+ L +    L+ A        + AE AN+ KS FLA MSHELRTPLNAI+GF
Sbjct: 100 IRELKTSRRTLRKMTERLAWAF-------DNAERANEAKSNFLANMSHELRTPLNAIIGF 152

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNA-DLI 623
           S++I+ + FG +G+ +Y +YA+DI+ SG HLL++IN+IL+++KI+    +++++    + 
Sbjct: 153 SDIIRFQRFGSVGNSRYQDYAKDINESGIHLLSIINDILDLAKIDAGHGTMEQEAEFSVR 212

Query: 624 PIINEGIRLIGSSAQSKNIKIEKKIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKM 682
             I+   R++ S A+ + I +      +  +    +R+++++L  +LSN+IKFT   G +
Sbjct: 213 SAIDCAERMVRSLAERQEISLSTAAAETSAYLVGVERMVRQVLINVLSNAIKFTERGGSV 272

Query: 683 MIRTS-KIGQCVIITIADTGIGIP----KSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
            +    +    ++++I+DTGIG+     K AL   GQ    L  ++     G GLGL ++
Sbjct: 273 TVAAEHRPNGNLVVSISDTGIGMSPDEVKVALTPFGQSGSALSRKHP----GTGLGLPLA 328

Query: 738 DALTNLHGGRLKIISQEGKGTIVTICMP 765
            A+ ++HGGRL + S  GKGT VT+  P
Sbjct: 329 KAMMDMHGGRLMVRSMVGKGTTVTLVFP 356


>gi|116252525|ref|YP_768363.1| two-component sensor histidine kinase transcriptional regulatory
           protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257173|emb|CAK08268.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 511

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 299 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 359 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YISIKDNGPGIPEEEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 473

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 474 KLREGTEVIAILP 486


>gi|327189383|gb|EGE56551.1| putative two-component sensor histidine kinase protein [Rhizobium
           etli CNPAF512]
          Length = 511

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 299 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 359 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 473

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 474 KLREGTEVIAILP 486


>gi|86358053|ref|YP_469945.1| two-component sensor histidine kinase protein [Rhizobium etli CFN
           42]
 gi|86282155|gb|ABC91218.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CFN 42]
          Length = 513

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 241 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 300

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 301 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 360

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 361 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 416

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 417 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 475

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 476 KLREGTEVIAILP 488


>gi|190892130|ref|YP_001978672.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652]
 gi|190697409|gb|ACE91494.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 652]
          Length = 511

 Score =  167 bits (424), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 299 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 359 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YISIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 473

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 474 KLREGTEVIAILP 486


>gi|327192167|gb|EGE59140.1| putative two-component sensor histidine kinase protein [Rhizobium
            etli CNPAF512]
          Length = 1262

 Score =  167 bits (424), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 158/260 (60%), Gaps = 14/260 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 1004 RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1058

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1059 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1118

Query: 632  LIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            L+   A  + +     +   +P  +   AD R IK+I   ILSN+I+FT + G++++ TS
Sbjct: 1119 LVQPQANGQRVIIRTALSHAVPDVV---ADLRSIKQIALNILSNAIRFTPSGGQIVVSTS 1175

Query: 688  -KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHG 745
             +    V++ + DTG+G+ +S L++  +PF  + +   +  G G GLGL ++ A+ + + 
Sbjct: 1176 YEANGSVVLRVRDTGVGMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANR 1235

Query: 746  GRLKIISQEGKGTIVTICMP 765
                I S   +GT+V I  P
Sbjct: 1236 ATFSINSAPNEGTLVEITFP 1255


>gi|260459403|ref|ZP_05807658.1| histidine kinase [Mesorhizobium opportunistum WSM2075]
 gi|259034957|gb|EEW36213.1| histidine kinase [Mesorhizobium opportunistum WSM2075]
          Length = 506

 Score =  167 bits (424), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/253 (38%), Positives = 148/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL  A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G + + 
Sbjct: 238 AELETAKSMSDEARRRAEDANLAKSRFLASMSHELRTPLNAILGFSEVMANEVLGPMSNP 297

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +YA D+H SGQHLL++IN IL++S+IE  +  ++++   L+ I+ +   ++   A++
Sbjct: 298 TYRDYAHDVHDSGQHLLDLINEILDLSRIEAGRYQLNEEPVMLLNIVEDCCHMMELKARN 357

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           K+I++    E+ +P  LF  AD+R +++I   +LSN+IKFT   G++ +R   T+  GQ 
Sbjct: 358 KDIRVIQDFEQTLP-RLF--ADERALRQITLNLLSNAIKFTATGGEIRVRVGWTAGGGQ- 413

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I   L  +HGG  ++ S
Sbjct: 414 -YISIKDNGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQGLLAMHGGEFELHS 472

Query: 753 QEGKGTIVTICMP 765
           +  +GT      P
Sbjct: 473 KLREGTEAIAIFP 485


>gi|154245353|ref|YP_001416311.1| integral membrane sensor signal transduction histidine kinase
           [Xanthobacter autotrophicus Py2]
 gi|154159438|gb|ABS66654.1| integral membrane sensor signal transduction histidine kinase
           [Xanthobacter autotrophicus Py2]
          Length = 484

 Score =  167 bits (424), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 82/224 (36%), Positives = 130/224 (58%), Gaps = 2/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA MSHELRTPLNAILGFSE++  E    L   +  +YA+ IH SGQHLL ++N+I
Sbjct: 233 KSHFLAAMSHELRTPLNAILGFSELLATETGAPLDDARKADYARIIHESGQHLLGLVNDI 292

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRII 661
           L++S++E     ++++  D+  ++     ++   A    + ++      L   +AD+R  
Sbjct: 293 LDLSRVEAGAYELEREGVDVAALVAGCAEMVAIDAGRAGVAVKTVFAPRLPAIDADRRAF 352

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           K+I+  +LSN++KFT   G++ +     G+ V I + DTG G+    + ++G+PF     
Sbjct: 353 KQIVLNLLSNAVKFTPEGGRVQVSVRSEGEAVAIRVRDTGPGMRPEDVARLGEPFF-QAG 411

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              Q   G GLG+A+   L  LHGG  ++ S  G+GT VT+ +P
Sbjct: 412 DCTQRARGSGLGIAVVKGLVKLHGGDFRVESAPGRGTSVTVTLP 455


>gi|190890429|ref|YP_001976971.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652]
 gi|190695708|gb|ACE89793.1| probable two-component sensor histidine kinase protein [Rhizobium
            etli CIAT 652]
          Length = 1257

 Score =  167 bits (424), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 158/260 (60%), Gaps = 14/260 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 999  RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1053

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1054 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1113

Query: 632  LIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            L+   A  + +     +   +P  +   AD R IK+I   ILSN+I+FT + G++++ TS
Sbjct: 1114 LVQPQANGQRVIIRTALSHAVPDVV---ADLRSIKQIALNILSNAIRFTPSGGQIVVSTS 1170

Query: 688  -KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHG 745
             +    V++ + DTG+G+ +S L++  +PF  + +   +  G G GLGL ++ A+ + + 
Sbjct: 1171 YEANGSVVLRVRDTGVGMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANR 1230

Query: 746  GRLKIISQEGKGTIVTICMP 765
                I S   +GT+V I  P
Sbjct: 1231 ATFSINSAPNEGTLVEITFP 1250


>gi|13470769|ref|NP_102338.1| histidine kinase sensor protein [Mesorhizobium loti MAFF303099]
 gi|14021512|dbj|BAB48124.1| histidine kinase sensor protein [Mesorhizobium loti MAFF303099]
          Length = 506

 Score =  167 bits (423), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/253 (38%), Positives = 148/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL  A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G + + 
Sbjct: 238 AELETAKSMSDEARRRAEDANLAKSRFLASMSHELRTPLNAILGFSEVMANEVLGPMSNP 297

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +YA D+H SGQHLL++IN IL++S+IE  +  ++++   L+ I+ +   ++   A++
Sbjct: 298 TYRDYAHDVHDSGQHLLDLINEILDLSRIEAGRYQLNEEPVMLLNIVEDCCHMMELKARN 357

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           K+I++    E+ +P  LF  AD+R +++I   +LSN+IKFT   G++ +R   T+  GQ 
Sbjct: 358 KDIRVVQDFEQTLP-RLF--ADERAVRQITLNLLSNAIKFTATGGEIRVRVGWTAGGGQ- 413

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I++ D G GIP+  +  +   F         +  G GLGL I   L  +HGG  ++ S
Sbjct: 414 -YISVKDNGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQGLLAMHGGEFELHS 472

Query: 753 QEGKGTIVTICMP 765
           +  +GT      P
Sbjct: 473 KLREGTEAIAIFP 485


>gi|92117022|ref|YP_576751.1| periplasmic sensor signal transduction histidine kinase
           [Nitrobacter hamburgensis X14]
 gi|91799916|gb|ABE62291.1| signal transduction histidine kinase [Nitrobacter hamburgensis X14]
          Length = 536

 Score =  167 bits (423), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 100/252 (39%), Positives = 146/252 (57%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE+AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFGE     
Sbjct: 242 ELEQAKAISDEARHRAESANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGEHAVAV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 302 YKSYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVSLVHVVADCHHLLKLRASSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E  +P       D+R  ++I+  +LSNSIKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEHGMPR---IWGDERATRQIVLNLLSNSIKFTPQGGEIWLKVGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ D+G GI +  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 417 YLSVKDSGSGIAEDEIPIVLASFGQGTNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLRSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRVGTEVIVTFP 488


>gi|241203167|ref|YP_002974263.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
            leguminosarum bv. trifolii WSM1325]
 gi|240857057|gb|ACS54724.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
            leguminosarum bv. trifolii WSM1325]
          Length = 1276

 Score =  167 bits (423), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 159/260 (61%), Gaps = 14/260 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 1018 RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1072

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1073 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1132

Query: 632  LIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            L+   A  + +     + + +P  +   AD R IK+I   ILSN+I+FT + G++++ TS
Sbjct: 1133 LVQPQANGQRVIIRTALSQAVPEVV---ADLRSIKQIALNILSNAIRFTPSGGQIVVSTS 1189

Query: 688  -KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHG 745
             +    V++ + DTGIG+ +S L++  +PF  + +   +  G G GLGL ++ A+ + + 
Sbjct: 1190 YEANGSVVLRVRDTGIGMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANR 1249

Query: 746  GRLKIISQEGKGTIVTICMP 765
                I S   +GT+V I  P
Sbjct: 1250 ATFTINSAPNEGTLVEITFP 1269


>gi|218682383|ref|ZP_03529984.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli CIAT 894]
          Length = 468

 Score =  167 bits (423), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 99/253 (39%), Positives = 149/253 (58%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 196 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVMGPLANP 255

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EYA DIH SGQHLL++IN IL++S+IE  K  + ++   L+ I  + I ++   A++
Sbjct: 256 TYKEYAGDIHRSGQHLLDLINEILDLSRIEAGKYELSEEAISLLDITEDCIGMVQLRARA 315

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+++P+     AD++ +++++  +LSN++KFT   G++ ++   T+  GQ 
Sbjct: 316 KNIAISDQFERQLPA---IWADEKSMRQVVLNLLSNAVKFTPQGGEIHVKVGWTAGGGQ- 371

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 372 -YISIKDNGPGIPEEEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFLLKS 430

Query: 753 QEGKGTIVTICMP 765
           +  +GT V   +P
Sbjct: 431 KLREGTEVIAILP 443


>gi|13476354|ref|NP_107924.1| two component histidine sensor kinase [Mesorhizobium loti
           MAFF303099]
 gi|14027115|dbj|BAB54069.1| two component histidine sensor kinase [Mesorhizobium loti
           MAFF303099]
          Length = 541

 Score =  167 bits (423), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 136/224 (60%), Gaps = 1/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K  FLA +SHELRTPLNAI+GFS+++  E+FG     +  EY   +  SGQHLL ++ +I
Sbjct: 284 KGRFLAVVSHELRTPLNAIIGFSDMLLHEMFGAFKDPRQKEYVTLVRDSGQHLLAVVTSI 343

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRII 661
           L++S+IE+   + D +    +  ++    ++   AQ+KNI ++ +I P     NAD+R +
Sbjct: 344 LDVSRIESGAYTADPEPFRFMEAVDMCQSMMRLQAQAKNIDLQTQIAPDAGDINADRRAV 403

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           +++L  ++SN+IKFT + G +++   +IG  +   + DTGIGI +     +G+PF  + N
Sbjct: 404 QQMLINLVSNAIKFTPDGGDVVVGAKRIGSRLHFWVRDTGIGIAEEDFANLGKPFTQIQN 463

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGL++   L  LH G + I S  G+GT VTI +P
Sbjct: 464 DYTRRFEGTGLGLSLVKGLVALHEGTMSIESMPGEGTTVTISLP 507


>gi|90419109|ref|ZP_01227020.1| signal transduction histidine kinase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337189|gb|EAS50894.1| signal transduction histidine kinase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 653

 Score =  167 bits (423), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 151/242 (62%), Gaps = 4/242 (1%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           +A  Q   + A  ++  KS+FLA +SHELRTPLNAI+GFS+++ +E FG   S +  EY 
Sbjct: 374 SADLQTALDAANQSSAAKSQFLAAVSHELRTPLNAIIGFSDILDQEFFGGFESDRQKEYV 433

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
             I  SGQHLL+++N++L++SKIE  +  +  +   L   ++  + ++   A+ K+++++
Sbjct: 434 GLIRQSGQHLLSVVNSLLDVSKIEAGRYELVPEAFGLGEAMDLAVDVVREEARRKDLRLD 493

Query: 646 KKIPS--ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIG 703
            + P   +    AD+R   +IL  +LSN++KFT   G + + + ++G  V  +++DTGIG
Sbjct: 494 VR-PGCRDEEITADRRACHQILLNLLSNALKFT-EVGVVTLESRRVGAMVEFSVSDTGIG 551

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I +S +E++G+PF  + +   +   G GLGL++   L  LHGG + I SQ G GT+VT+ 
Sbjct: 552 IAESDIERLGRPFVQVSSGTTRRYQGTGLGLSLVKGLAELHGGDMTIRSQPGVGTMVTVR 611

Query: 764 MP 765
           +P
Sbjct: 612 LP 613


>gi|83309666|ref|YP_419930.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82944507|dbj|BAE49371.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 755

 Score =  167 bits (423), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 149/243 (61%), Gaps = 3/243 (1%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           A  + +  KE+AE+A++ KS+FLA MSHELRTPLNAI+GF+E +  ++ G +   +Y EY
Sbjct: 502 AEDELRAAKEQAESASRAKSDFLAGMSHELRTPLNAIIGFAETMYSQVLGPM-PERYREY 560

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
           A DI  SG+HLL +I +IL+++KIE  ++ +D +  ++ P+++  +RL+     +  + +
Sbjct: 561 AGDISASGRHLLGIITDILDLAKIEAGRMELDDRPMEIAPVVDVALRLLRDRGAAAGLNL 620

Query: 645 EKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-ITIADTGI 702
              +P  L    AD+R I++++  +L+N++KFT   G++ +  S      + + ++DTGI
Sbjct: 621 ISDLPPGLPQVMADERRIRQVVINLLANAVKFTPFGGRVTVSASLTPDGGLELHVSDTGI 680

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           G+ +    ++ +PF  +  +  +   G GLGL +  A+  +HGG + I SQ   GT VT+
Sbjct: 681 GMTEEEAAQVIEPFVQVDARIARRHEGTGLGLPMVAAIMEMHGGAIAIASQPDAGTRVTV 740

Query: 763 CMP 765
             P
Sbjct: 741 TFP 743


>gi|154251880|ref|YP_001412704.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154155830|gb|ABS63047.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 717

 Score =  167 bits (422), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 157/257 (61%), Gaps = 10/257 (3%)

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
           ++ +R++T   + +A+     + AE AN +KS+FLA MSHELRTPLNAI+GFSEV+  E+
Sbjct: 454 EVRKREQTANDLRDAR-----DVAELANASKSQFLANMSHELRTPLNAIIGFSEVMNGEL 508

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
           FG + + +Y +Y  DIH S  HLL++IN+IL++SKIE ++  + ++  D++ ++    R+
Sbjct: 509 FGPIENERYKDYVGDIHKSSSHLLSLINDILDLSKIEADRYELYEEELDVMDVVASCERM 568

Query: 633 IGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKI 689
           +   A    + ++  +  EL    ADKR +++I+  ++SN++KFT   G + +       
Sbjct: 569 MRHRADEAGVALKVTVEDELPLLMADKRALRQIVLNLVSNAVKFTPKGGLIQLGAFMEPD 628

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD-QSIGGFGLGLAISDALTNLHGGRL 748
           G+ +   +ADTG+G+ K  +    +PF  +    +  S  G GLGL ++ AL  LHG  L
Sbjct: 629 GR-MAFRVADTGVGMSKKDIPIALEPFRQIGKDSNVYSTEGTGLGLPLTRALARLHGASL 687

Query: 749 KIISQEGKGTIVTICMP 765
            I S+ G+GT +TI MP
Sbjct: 688 VIESEPGEGTTITIRMP 704


>gi|23016597|ref|ZP_00056351.1| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 734

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 153/254 (60%), Gaps = 7/254 (2%)

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           +ER+K     A  +    KE+AE+A++ KS+FLA MSHELRTPLNAI+GF+E +  ++ G
Sbjct: 476 IERRKQ----AEVQLLAAKEQAESASRAKSDFLAGMSHELRTPLNAIIGFAETMYSQVLG 531

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            +   +Y EYA DI  SG+HLL +I +IL+++KIE  ++ +D+   ++ P++   IRL+ 
Sbjct: 532 PI-PERYREYAGDIAASGRHLLGIITDILDLAKIEAGRMELDENPVEIAPVVEAAIRLLR 590

Query: 635 SSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQC 692
               +  + +   IP+ L    AD+R I++++  +L+N++KFT + G + +  +      
Sbjct: 591 DRGTAARLDLHSDIPASLPRILADERRIRQVVINLLANAVKFTPHGGSVSVSANLTTDGG 650

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           + + ++DTGIG+    + +  +PF  +  +  +   G GLGL +  A+  +H G + I S
Sbjct: 651 LALHVSDTGIGMTDEEMSQAVEPFVQVDARIARRHEGTGLGLPMVAAIMEMHRGTIAIAS 710

Query: 753 QEGKGTIVTICMPQ 766
           +  +GT VT+  P+
Sbjct: 711 RPNQGTTVTVTFPR 724


>gi|75675405|ref|YP_317826.1| Signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
 gi|74420275|gb|ABA04474.1| signal transduction histidine kinase [Nitrobacter winogradskyi
           Nb-255]
          Length = 536

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 146/252 (57%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE+AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFGE     
Sbjct: 242 ELEQAKAISDEARHRAESANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGEHAVAV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ E   L+   A ++
Sbjct: 302 YKTYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVSLVHVVTECHHLLKLRASNR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R  ++I+  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEIFEQGMPR---IWGDERATRQIVLNLLSNAIKFTPQGGEIWLKVGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ D G GI +  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 417 YLSVKDNGSGIAEDEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLRSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRVGTEVIVTFP 488


>gi|254796403|ref|YP_003081239.1| Sensor histidine kinase PleC [Neorickettsia risticii str. Illinois]
 gi|254589640|gb|ACT69002.1| Sensor histidine kinase PleC [Neorickettsia risticii str. Illinois]
          Length = 447

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 147/245 (60%), Gaps = 14/245 (5%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N K +  KE  E  +  KS+FLA +SHEL+TPLNAI+GFS++I+     E+   ++ EYA
Sbjct: 205 NTKLKKAKESIEEISSQKSQFLANVSHELKTPLNAIIGFSDLIRT---AEVLGTEHREYA 261

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
            DI+YSG HLLN+IN+IL+ SK E   + I     DL+ +    IR+  ++ + K IKI 
Sbjct: 262 NDIYYSGNHLLNLINDILDFSKSELNNLEIKPTLFDLVRLTETCIRM--TTTKRKKIKIV 319

Query: 646 KKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
           K   S ++   +D + +K+++  ILSNSIKFTN +G + I   ++   + I I+D G+GI
Sbjct: 320 KSFFSNKILIKSDHKRVKQVILNILSNSIKFTNEDGLIKISIIRLPSEIEIEISDNGVGI 379

Query: 705 PK----SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           P+     AL   GQ    L  +YD    G G+GL +S  L  L GG  +I S+EG GT+V
Sbjct: 380 PEKDIAKALSVFGQSNTELSRKYD----GAGIGLPLSKKLVELMGGAFEIESKEGSGTVV 435

Query: 761 TICMP 765
            I +P
Sbjct: 436 KIRLP 440


>gi|15889187|ref|NP_354868.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
 gi|15157006|gb|AAK87653.1| two component sensor kinase [Agrobacterium tumefaciens str. C58]
          Length = 511

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 151/250 (60%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +AN+     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVANSVSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSSEVLGPLNNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY+ DIH SGQHLL++IN IL++S+IE  +  +++++  ++ I  + I +I   A++
Sbjct: 299 LYKEYSGDIHRSGQHLLDLINEILDLSRIEAGRYDLNEESISMLEIAEDCIGMIQLRARA 358

Query: 640 KNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           KNI+I ++  + L    AD++ I++++  +LSN++KFT   G+++++   T+  GQ V  
Sbjct: 359 KNIRISQQFEASLPQVWADEKSIRQVILNLLSNAVKFTPQGGEILVKAGWTAGGGQYV-- 416

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S+  
Sbjct: 417 SIRDNGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFILKSKLR 476

Query: 756 KGTIVTICMP 765
           +GT     +P
Sbjct: 477 EGTEGIAILP 486


>gi|209547989|ref|YP_002279906.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
            leguminosarum bv. trifolii WSM2304]
 gi|209533745|gb|ACI53680.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium
            leguminosarum bv. trifolii WSM2304]
          Length = 1296

 Score =  167 bits (422), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 158/260 (60%), Gaps = 14/260 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 1038 RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1092

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1093 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1152

Query: 632  LIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            L+   A  + +     +   +P  +   AD R IK+I   ILSN+I+FT + G++++ TS
Sbjct: 1153 LVQPQANGQRVIIRTALSHAVPEVV---ADLRSIKQIALNILSNAIRFTPSGGQIVVSTS 1209

Query: 688  -KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHG 745
             +    V++ + DTGIG+ +S L++  +PF  + +   +  G G GLGL ++ A+ + + 
Sbjct: 1210 YEANGSVVLRVRDTGIGMTRSELDQAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANR 1269

Query: 746  GRLKIISQEGKGTIVTICMP 765
                I S   +GT+V I  P
Sbjct: 1270 AVFSINSAPNEGTLVEITFP 1289


>gi|82523852|emb|CAI78595.1| signal transduction histidine kinase [uncultured candidate division
           OP8 bacterium]
          Length = 350

 Score =  167 bits (422), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           L R+     +A    Q E++   +A++ KSE +A MSHELRTPLNAILGFS  IK E FG
Sbjct: 86  LNRRSRRHLMARLNAQAERDILLSASRAKSEVIANMSHELRTPLNAILGFSSAIKCETFG 145

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            +G  KY EY  DI +SG HLL++IN+IL++S IE  K+++ + + ++  I  E   ++ 
Sbjct: 146 PMGHTKYREYIDDISHSGSHLLDLINDILDVSAIEAGKMTLHEDSINVATIAKEAFHVVE 205

Query: 635 SSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMM--IRTSKIG 690
             A    + +   I   L   F  D+R  K+I+  + SN+IKFT   G +   +R    G
Sbjct: 206 CLAVENQVMLAYDIAENLPPLF-VDERRFKQIVLNLASNAIKFTPPGGSVTLGLRLDDQG 264

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
           +   +++ DTGIG+    L+    PF  L++   +   G GLGL ++  L  LH G L I
Sbjct: 265 RHT-LSVTDTGIGMSADELKNALTPFGQLNSHLARRHDGTGLGLPLTKGLVELHDGTLDI 323

Query: 751 ISQEGKGTIVTICMP 765
            S +G GTIVT+  P
Sbjct: 324 TSTKGTGTIVTVVFP 338


>gi|21228280|ref|NP_634202.1| two component system histidine kinase [Methanosarcina mazei Go1]
 gi|20906740|gb|AAM31874.1| Two component system histidine kinase [Methanosarcina mazei Go1]
          Length = 813

 Score =  167 bits (422), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 99/254 (38%), Positives = 150/254 (59%), Gaps = 7/254 (2%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I ER++ E  +  AK       AE AN+ K+ F+  MSHELRTPLNA++GFS+++  E  
Sbjct: 533 ITERKQAEERMLQAKMV-----AEAANRAKTTFIVNMSHELRTPLNAVIGFSDLLLSETV 587

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L   K   Y ++I  SG HLL++IN++L++SK+E   I +  +  D+  II E  R++
Sbjct: 588 GPLNE-KQKRYTENISKSGNHLLDVINDVLDISKLELGNIELYYETVDVAGIIEEVQRVL 646

Query: 634 GSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              +  KNI IE  I  +L    AD+  +K+IL+ IL+N+IKF++ NGK+ I        
Sbjct: 647 SPLSADKNIIIESYIEKDLKTVIADRVKLKQILYNILNNAIKFSSENGKVNIYAEPREDM 706

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           + I++ D GIGI +S  EK+ QPF  +     +  GG GLGLA+      LHGG++ + +
Sbjct: 707 IEISVEDEGIGIQESDYEKVFQPFVQIDESISRKHGGVGLGLALVKRFVELHGGKVWVKA 766

Query: 753 QEGKGTIVTICMPQ 766
             G G+I T  +P+
Sbjct: 767 SPGGGSIFTFRIPK 780


>gi|88608550|ref|YP_505906.1| sensor histidine kinase [Neorickettsia sennetsu str. Miyayama]
 gi|88600719|gb|ABD46187.1| sensor histidine kinase [Neorickettsia sennetsu str. Miyayama]
          Length = 447

 Score =  167 bits (422), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 147/245 (60%), Gaps = 14/245 (5%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N K +  KE  E  +  KS+FLA +SHEL+TPLNAI+GFS++I+     E+   ++ EYA
Sbjct: 205 NTKLKKAKESIEEISSQKSQFLANVSHELKTPLNAIIGFSDLIRT---AEVLGTEHREYA 261

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
            DI+YSG HLLN+IN+IL+ SK E   + I     DL+ +    IR+  ++ + K IKI 
Sbjct: 262 NDIYYSGNHLLNLINDILDFSKSELNNLEIKPTLFDLVRLTETCIRM--TTTKRKEIKIV 319

Query: 646 KKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
           K   S ++   +D + +K+++  ILSNSIKFTN +G + I   ++   + I I+D G+GI
Sbjct: 320 KSFFSNKILIKSDHKRVKQVILNILSNSIKFTNEDGLIRISIIRLPSEIEIEISDNGVGI 379

Query: 705 PK----SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           P+     AL   GQ    L  +YD    G G+GL +S  L  L GG  +I S+EG GT+V
Sbjct: 380 PEKDIAKALSVFGQSNTELSRKYD----GAGIGLPLSKKLVELMGGVFEIESKEGSGTVV 435

Query: 761 TICMP 765
            I +P
Sbjct: 436 KIRLP 440


>gi|163797319|ref|ZP_02191272.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159177410|gb|EDP61966.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 537

 Score =  166 bits (421), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 167/305 (54%), Gaps = 19/305 (6%)

Query: 479 SVGTDITLLK--HNQ--AQLRESKRRLKATINDLST--SRQILERQKTELSIANAKYQVE 532
           + GT+I  L+  +N   A L   +R +     DL T  + +  E Q+  + ++ A  +V+
Sbjct: 222 AAGTEIEHLRIAYNDLVAALSRGQREIATLNRDLETRVAARTSELQERTVELSAALARVD 281

Query: 533 KERAETA---------NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYE 583
           + R +TA          + KSEFLA +SHELRTPLN+ILGFSE+++ +        +  E
Sbjct: 282 QARRQTAAALDAAERAGRAKSEFLALVSHELRTPLNSILGFSELVRDQAVRGADPERMSE 341

Query: 584 YAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK 643
           YA DIH SG HLL +IN+IL++SKIE  ++ I  +  D   I    + L+   A  KN+ 
Sbjct: 342 YAADIHASGSHLLTLINDILDLSKIEAGQMEIHSEWVDPAAITRAVVELMREQATRKNLT 401

Query: 644 IEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI--RTSKIGQCVIITIADT 700
           IE ++ PS     AD R  +++L  +LSN++KFT+  G + I  R +  G  + I + DT
Sbjct: 402 IECRLDPSIGPLRADPRRFRQMLMNLLSNAVKFTDPPGTVTIEGRVTPEG-GLTIAVVDT 460

Query: 701 GIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIV 760
           GIG+    + +  +PF  + +   +S  G GLGL +   +  LHGGRL + S  G GT  
Sbjct: 461 GIGMRSQDVARALEPFGQIDSPITRSQQGTGLGLPLVSQMARLHGGRLSMDSSPGVGTRA 520

Query: 761 TICMP 765
           T+  P
Sbjct: 521 TLWFP 525


>gi|186473345|ref|YP_001860687.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
 gi|184195677|gb|ACC73641.1| multi-sensor hybrid histidine kinase [Burkholderia phymatum STM815]
          Length = 989

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 146/546 (26%), Positives = 255/546 (46%), Gaps = 54/546 (9%)

Query: 230 LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNF---DNKK-FHLSRSMY 285
           + I+F    Q ++ +E + IL E N  +E A+     G+W  +    D K+ F    ++Y
Sbjct: 247 IVIVFRDVTQKRRAQEAE-ILRETNARLEMAMYGSNVGVWEIDMPEGDYKRGFARYSNIY 305

Query: 286 EIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHM----RHASGAD 341
           E +G    +  L + A   ++H D++   + A       ++  D +F +    RH  G D
Sbjct: 306 EWLGFDTPHARLDYEAYMSVLHPDHRDSTDRA---VASFLESGDGVFELENRLRHRDGTD 362

Query: 342 IWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDK 400
            W+ VR    R  +G  +  +G  +D+T+    E+    +++R     E  +  +   D 
Sbjct: 363 RWVLVRGTARRDATGKPVRFVGSLVDITQLKVTEQALRASEERFRGTFENAAVGVAHCDL 422

Query: 401 NDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ-DAQTRPIIEYRTSDPERSQDMSKEIKL 459
           +   +  N    +  G P   L       +I  D     I  +R     + +  S+E+ L
Sbjct: 423 DGCFLRVNHRSGEIVGWPRGALQQRRLHELIHHDFIAASIDRFRLLTEGKLEHYSEEVPL 482

Query: 460 ADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
                 ++  W T     +SV      L+H+ +        +   I D+S +R+ LE   
Sbjct: 483 VRVDGSRV--WVT-----LSVA-----LQHDASG---QTSHVIVIIQDIS-ARKALE--- 523

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI---FGEL 576
                     +V KE AE AN+ K +FLA +SHELRTPLN ILG++++++++      +L
Sbjct: 524 -------DTVRVAKEAAEAANRAKDQFLANISHELRTPLNGILGYAQMLQRDARLDARQL 576

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
            SV        I  SGQHLL +IN+IL+ +++   K+ +      L   +     ++   
Sbjct: 577 ASVGV------IEQSGQHLLTLINDILDFARLGAGKLELQVGEVSLRGFLETIAEIVAVR 630

Query: 637 AQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-V 693
           AQ K + +      +L      D+R ++++L  +L+N++KFT + G++ +  S+     V
Sbjct: 631 AQQKRLVLNYVAAPDLPAVVRVDERRLRQVLLNLLANAVKFT-DRGEVTLSVSRGAAGRV 689

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
              + DTGIG+    LE I QPFE   +   +S GG GLGLAIS  L  + GG +++ S 
Sbjct: 690 RFEVRDTGIGVSADRLEAIFQPFEQAGDHTRRS-GGAGLGLAISRQLVRMMGGEIEVTSS 748

Query: 754 EGKGTI 759
            G+G++
Sbjct: 749 AGEGSV 754


>gi|217977833|ref|YP_002361980.1| PAS/PAC sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
 gi|217503209|gb|ACK50618.1| PAS/PAC sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
          Length = 494

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 141/238 (59%), Gaps = 2/238 (0%)

Query: 530 QVEKERAETA-NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
           Q E + A TA + +K  FLA +SHELRTPLNAI+GFSE++           K  EYA  I
Sbjct: 216 QDELDSAGTAADLSKDHFLANVSHELRTPLNAIIGFSEILGDADQAPRDPAKQREYAAII 275

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
           H SGQHLL+++N+IL++SKI +    +   +  + P++     ++   AQ ++I++++  
Sbjct: 276 HRSGQHLLSVVNSILDLSKIHSGSFDLSPSHFGVAPLVEVCCDMVKLEAQDRHIELKRVC 335

Query: 649 PSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
           P  L     DKR  K+I+  +LSN++KFT  +G++ I  S   + ++I +AD+G+GI + 
Sbjct: 336 PEGLPEIVGDKRACKQIVINLLSNAVKFTPAHGEVSISVSIEDETLLIAVADSGVGINEQ 395

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            L ++G PF       D+   G GLGL+I   L  LHGG + + S+  +GT V + +P
Sbjct: 396 DLARLGNPFFQARGALDRPFEGTGLGLSIVSGLVGLHGGSIAVASEPDQGTCVLVRLP 453


>gi|322421479|ref|YP_004200702.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M18]
 gi|320127866|gb|ADW15426.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M18]
          Length = 484

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 171/306 (55%), Gaps = 37/306 (12%)

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKY-----QVEKER---------AETANK 541
           ++ R L +   ++S   + LE    EL + N +      ++EK++         AE A++
Sbjct: 170 QNNRELASATEEMSALNEQLEESMMELDLKNQELLDMNAELEKQQIIAHEAKIQAEEASR 229

Query: 542 TKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN 601
            KS+FLA MSHELRTPLN++LGFSE++  E+FG L + K +EY ++I +SG+HLLN+IN+
Sbjct: 230 AKSDFLANMSHELRTPLNSVLGFSELLTDELFGHL-NAKQHEYVKNILFSGRHLLNLIND 288

Query: 602 ILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP--SELFFNADKR 659
           IL++SK+E  K  ++        +I   + L+   A   ++ +  ++P   ++   AD+R
Sbjct: 289 ILDLSKVEAGKSVLEPSMVKFREVIAGTLTLLQEKALKHDVHLGLELPVDCDIELMADER 348

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC--------------------VIITIAD 699
            +K+I+F +LSN++KFT   G + +   ++ +                     V IT+ D
Sbjct: 349 KLKQIMFNLLSNAVKFTPAGGTIRVTAQRMSRSDLLAAGKYQPGERQPEAEDFVEITVED 408

Query: 700 TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
           +GIGI +  + K+ + F  L + Y +   G GLGLA++  L  LHGG++ + S+ G+G+ 
Sbjct: 409 SGIGIKREDIPKLFKEFSQLDSPYTKEYEGTGLGLALTKRLVELHGGQVGVESEIGQGSR 468

Query: 760 VTICMP 765
               +P
Sbjct: 469 FYFAIP 474


>gi|73668585|ref|YP_304600.1| sensory transduction histidine kinase [Methanosarcina barkeri str.
           Fusaro]
 gi|72395747|gb|AAZ70020.1| sensory transduction histidine kinase [Methanosarcina barkeri str.
           Fusaro]
          Length = 1046

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 151/259 (58%), Gaps = 7/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T   I   +++E  +  AK +     AE AN +KSEFLA +SHELRTPLN+I+GFS++
Sbjct: 474 LKTGLDITAHRRSEEKLIQAKLE-----AEEANNSKSEFLANVSHELRTPLNSIIGFSDI 528

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           + +++FGEL   K + Y  +I  SG+HLL +IN+IL++SK+E  K+ +      + P+  
Sbjct: 529 LIEKVFGELNE-KQFRYVNNISTSGKHLLVLINDILDLSKVEAGKMELHYSEFSIDPVFE 587

Query: 628 EGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           E   ++    Q+K +++   + P      AD+  + +IL+ ++SN+IKFT N GK+ +  
Sbjct: 588 EVKAVLFPLIQAKPLEVTFNVEPDFTTLEADRGRLIQILYNLISNAIKFTPNGGKVSVYC 647

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            + G   +I++ DTGIGI      K+ QPF  L     +   G GLGLA+   + NLH G
Sbjct: 648 KESGNRALISVIDTGIGISAEDQVKLFQPFTQLDASTSRQYCGTGLGLALVKKIVNLHQG 707

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S  GKG+  T  +P
Sbjct: 708 DIWVESDPGKGSNFTFALP 726


>gi|291569600|dbj|BAI91872.1| two-component hybrid histidine kinase [Arthrospira platensis
           NIES-39]
          Length = 897

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 132/435 (30%), Positives = 225/435 (51%), Gaps = 51/435 (11%)

Query: 338 SGADIWIQV-RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK-AIECTSEAL 395
            G  IW+ V R  M+ +    + I+G+  D+TE+  ++++      RL++ +I+ + + +
Sbjct: 249 GGRRIWLDVSRIPMLDSQGNVLGILGVLEDITERKEIDEKL-----RLTQFSIDKSRDYV 303

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           +  D N R    N    K  G     L+      I  D    P       D  R Q    
Sbjct: 304 LFSDINGRFFYVNEAACKILGYSQEELLTMEVEDI--DPLASPGGWSIAWDDLRDQ---G 358

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
                 S +       T  G  I+V   ++ L++N  +               +  R I 
Sbjct: 359 SFTFESSHY-------TKTGQAIAVEITLSYLEYNHREY------------GCAVVRDIR 399

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF-- 573
           +R++TE+++  AK     E AETA++ KSEFLA+MSHELRTPLNAILGF++++++E++  
Sbjct: 400 DRKQTEIALQQAK-----EAAETASRAKSEFLARMSHELRTPLNAILGFTQLMERELYHS 454

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
             +    + E+ + I  SG+HLL +IN++LEMSKIE  ++S++  N +LI ++N    ++
Sbjct: 455 PNIPLSDHKEHLEIIGRSGEHLLELINDVLEMSKIEAGRVSLNPTNFNLISLLNSLREML 514

Query: 634 GSSAQSK----NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM-IRTSK 688
              A SK    +  I+  IP+ ++  AD++ +++ L  +L N+IKFT   G ++ ++  K
Sbjct: 515 ELPASSKKLTLDFAIDDNIPTYIY--ADEQKLRQCLTNLLGNAIKFTLQGGVILRVKLGK 572

Query: 689 ----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
               +GQ +   + DTG GI  S ++ + +PF       + S  G GLGL+I+     L 
Sbjct: 573 FNHDLGQ-LCFEVQDTGPGIDASEMDLLFEPFSQTETGRN-SQQGTGLGLSITQKFIGLM 630

Query: 745 GGRLKIISQEGKGTI 759
           GG +++ S+ GKGTI
Sbjct: 631 GGEIQVSSERGKGTI 645


>gi|146338894|ref|YP_001203942.1| hypothetical protein BRADO1833 [Bradyrhizobium sp. ORS278]
 gi|146191700|emb|CAL75705.1| conserved hypothetical protein; putative sensor histidine kinase
           with a response regulator receiver domain
           [Bradyrhizobium sp. ORS278]
          Length = 787

 Score =  166 bits (420), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 140/515 (27%), Positives = 247/515 (47%), Gaps = 35/515 (6%)

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGI-PYENKTLSFRAIARLIHYDNKKICEIARSVTG 322
           GR G W    +      S  ++EI G+ P    ++SF  +  +IH ++      AR  T 
Sbjct: 118 GRLGHW-MTAEGDAAVWSEELFEITGLEPL--SSVSFSKMIEIIHPEDVGTYIRARDRTL 174

Query: 323 KHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEAD 381
           K    L Q   +    G   WI++ A  +  + G      GI  D+TE+   E    +A 
Sbjct: 175 KTGCALKQDLRVIRPDGEIRWIRIVADPIDDVDGRFRERFGIVQDITERKQAEVAADQAQ 234

Query: 382 QRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPII 440
           Q L  AIE  ++  VL+DK+DR V+ N  +++ +     ++ PG +   +++ A    ++
Sbjct: 235 QLLLDAIEALTKGFVLFDKDDRFVLSNTRFREMFPGWATLMRPGISFTDLMRKAHDHGLV 294

Query: 441 EYRTSDPERSQDMSKEIKLADSR----------WLQINEWCTHDGGTISVGTDITLLKHN 490
             +    E   +  +   L  SR          W+Q  +    DGGT+ + TDIT  K  
Sbjct: 295 RPKGDGFEDWLERKRAWHLGGSRMIEHREINGRWIQSVDHRISDGGTVCLVTDITAFKTV 354

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKM 550
           QA+L +    ++A  +DL       E QK EL    A+ +  ++ AE AN+ KS+FLA M
Sbjct: 355 QAELEQKLAYVQAIRSDL-------EEQKRELEATGAELRAARDAAEAANRAKSDFLAIM 407

Query: 551 SHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           SHE+RTPL+ ++G  ++++     +    +Y   A++   S   LL +IN+IL+ SK+E 
Sbjct: 408 SHEIRTPLSGMVGMVDLLRGTSLND-EQKRYTSLAKE---SADLLLQVINDILDFSKLEA 463

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPI 668
            K+  +  + D+  ++   +  +G  A+ + + ++      L  +   D   I++++  +
Sbjct: 464 GKLKSECIDFDVPSLVESAVSFMGEKARRRGLDLKVSFAPGLPQYLEGDPTRIRQVMLNL 523

Query: 669 LSNSIKFTNNNGKMMIRTS--KIGQCVI---ITIADTGIGIPKSALEKIGQPFEPLHNQY 723
           + N+IKFT   G + +  S  ++    +   I + D+GIG+ +    +I  PF       
Sbjct: 524 VGNAIKFT-EQGAIEVHASHRELDDGAVDLRIEVIDSGIGMSQEIQAQIFDPFVQADTSI 582

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
            +  GG GLGLAI   L  + GG + + S+ G+G+
Sbjct: 583 SRKYGGSGLGLAICKQLCAIMGGSIGVESEPGRGS 617


>gi|90423567|ref|YP_531937.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris BisB18]
 gi|90105581|gb|ABD87618.1| periplasmic sensor signal transduction histidine kinase
           [Rhodopseudomonas palustris BisB18]
          Length = 533

 Score =  166 bits (420), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 146/252 (57%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFG      
Sbjct: 242 ELEQAKAISDEARHRAEAANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGAHAVAV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y +Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ +   L+   A S+
Sbjct: 302 YKDYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVSLVHVVADCHHLLKLRASSR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R  ++I+  +LSN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAARQIVLNLLSNAIKFTPQGGEIWLKVGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            +++ DTG GI +  +  +   F    N    +  G GLGL I+ +L ++HGG   + S+
Sbjct: 417 YLSVKDTGSGIAEDEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDMHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRIGTEVIVTFP 488


>gi|312116146|ref|YP_004013742.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
 gi|311221275|gb|ADP72643.1| histidine kinase [Rhodomicrobium vannielii ATCC 17100]
          Length = 635

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 154/264 (58%), Gaps = 12/264 (4%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           LS S + L  ++ +L   NA+    K RAE AN+ KS FLA MSHELRTPLNAILGFSE+
Sbjct: 353 LSISEE-LANERVKLRRTNAELVAAKSRAEQANEAKSAFLANMSHELRTPLNAILGFSEI 411

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I+ ++ G     +Y  YA D+H SG HLLN++N+IL++++IE  K+ + +   +L  +I+
Sbjct: 412 IRDKMIGN-DIDRYASYAADVHKSGTHLLNIVNDILDVTRIEAGKLELHEDEINLDTLIH 470

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSE---LFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
             +  + S A +  + +    P+    +    DK  +K+IL  +LSN+IKFT   G+++I
Sbjct: 471 RSLLDVQSQALAGGVLLAA--PARNLGVVLRGDKGKLKQILVNLLSNAIKFTAKGGRIVI 528

Query: 685 RTS---KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
             +     G CV   I DTGIG+    + +  + F  + N   +   G GLGL ++  LT
Sbjct: 529 SATPEWDGGLCV--KIRDTGIGMSGDEIRQALELFRQVENGLARRYEGAGLGLPLAVRLT 586

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG L + S  G+GT V++  P
Sbjct: 587 ELHGGTLTVDSIPGEGTEVSVRFP 610


>gi|163795672|ref|ZP_02189637.1| multi-sensor hybrid histidine kinase [alpha proteobacterium BAL199]
 gi|159178968|gb|EDP63503.1| multi-sensor hybrid histidine kinase [alpha proteobacterium BAL199]
          Length = 1188

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 133/413 (32%), Positives = 203/413 (49%), Gaps = 38/413 (9%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           ++T +   + R A+ + RLS A+E  SE   L+D ND L++CN  Y++ YG     + PG
Sbjct: 497 NVTTERRAQVRAAQFEHRLSNALELMSEGFALFDANDILILCNETYRRMYGKSTAYIRPG 556

Query: 426 NA-RSIIQDAQTR---PIIEYRTSD--PER------SQDMSKEIKLADSRWLQINEWCTH 473
                I++DA      P    R  +   ER        D      LAD R L + E  T 
Sbjct: 557 RRFVDIVRDAAATGQFPAAVGREEEWVAERLELHRNPPDQPTLQALADGRVLLVAENRTS 616

Query: 474 DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEK 533
           DGG++ + +DIT              R++ T NDL  +R  LE Q   L     +    +
Sbjct: 617 DGGSVGIRSDIT-------------ERVR-TENDLRAARDELEEQAQSLRDLAEQIDAAR 662

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
            RAE A   KS FLA MSHELRTP+  +LG  E+  +    EL S +   Y + +  S +
Sbjct: 663 LRAEEAGAAKSRFLAVMSHELRTPMTGLLGMIELASRT---EL-SKEQQGYVRIMRDSAE 718

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PS-E 651
            LL ++N+IL+ SK+E  K+ +++       II +   L  + A +K + +E  + PS  
Sbjct: 719 TLLALLNDILDFSKLEAGKVQLEEITFAPEQIIGDVFGLFQAQASAKGLVLEADLRPSVP 778

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVII----TIADTGIGIPK 706
            +   D   +K+IL  ++SN+IKFT   G++ +R     G   ++     + DTG GI  
Sbjct: 779 AWVRGDPLRVKQILSNLISNAIKFT-TKGRITVRLGATEGPSGLVRLQGEVIDTGQGIAA 837

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
             LE + Q FE   +   +  GG GLGLAIS  L    GG + + S+ G+G++
Sbjct: 838 GVLEHLFQAFEQGDSSTTRQFGGTGLGLAISRRLAEGMGGSITVESELGRGSV 890



 Score = 48.9 bits (115), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 113/275 (41%), Gaps = 23/275 (8%)

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           +E A      G W       +   S   Y I GI       S  A A L H D+++   +
Sbjct: 131 IELAEDMAWIGHWRIETPGDRHVWSAQTYRIHGIEPGTPMSSANASA-LYHPDDRE--RV 187

Query: 317 ARSVTGKHVKQLDQIFHMR--HASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHL 373
           A +V       +D  F  +     G    +  R    R   G    ++G+  DLT++   
Sbjct: 188 AAAVNQAIRFGVDIAFEAKIIWPDGTVRKVACRGTTERGRDGKATAVVGVLQDLTDQIAA 247

Query: 374 EKRYAEADQRLS---KAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV--LVPGNAR 428
            +  AE ++ L+   + +E    ++ ++D++DR V+ N  Y + Y   ++   L+     
Sbjct: 248 RETLAERNRALAILRETVEIVPYSISVYDEHDRFVLANRKYFELYPYLENETKLIGKTFE 307

Query: 429 SIIQDAQTRPIIEYRTS--DPE----------RSQDMSKEIKLADSRWLQINEWCTHDGG 476
            +++ +    +I  RT+  DPE          R      E +LA+  W  I E  T  G 
Sbjct: 308 DVLRISLQNKVIMDRTALEDPENYVAARMADRRGGLPMAERRLANGHWYLIRENRTTSGH 367

Query: 477 TISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
           TIS   DIT  K  Q +L  +   L+AT++ +  +
Sbjct: 368 TISTRIDITEQKQAQLELGRTMEVLQATLDTMPNA 402


>gi|325293290|ref|YP_004279154.1| two component sensor kinase [Agrobacterium sp. H13-3]
 gi|325061143|gb|ADY64834.1| two component sensor kinase [Agrobacterium sp. H13-3]
          Length = 511

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/250 (38%), Positives = 149/250 (59%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +AN+     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVANSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSAEVLGPLNNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY+ DIH SGQHLL++IN IL++S+IE  +  ++++   ++ I  + I +I   A++
Sbjct: 299 LYKEYSGDIHRSGQHLLDLINEILDLSRIEAGRYDLNEEAVSMLEIAEDCIGMIQLRARA 358

Query: 640 KNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           K I+I ++  S L    AD++ I++++  +LSN++KFT   G+++++   T+  GQ V  
Sbjct: 359 KTIRISQQFESSLPQVWADEKSIRQVILNLLSNAVKFTPQGGEILVKAGWTAGGGQYV-- 416

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S+  
Sbjct: 417 SIKDNGPGIPEEEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFILKSKLR 476

Query: 756 KGTIVTICMP 765
           +GT     +P
Sbjct: 477 EGTEGIAILP 486


>gi|307947441|ref|ZP_07662774.1| PAS/PAC sensor signal transduction histidine kinase [Roseibium sp.
            TrichSKD4]
 gi|307769259|gb|EFO28487.1| PAS/PAC sensor signal transduction histidine kinase [Roseibium sp.
            TrichSKD4]
          Length = 1749

 Score =  166 bits (419), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 11/257 (4%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + +  E  +  AK Q     AE AN  KS+FLAK+SHE+RTPLNAI+GFSEV+  E
Sbjct: 1494 RDITQWKTAEEELTQAKRQ-----AENANSQKSDFLAKISHEIRTPLNAIIGFSEVMMDE 1548

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FGE+G+ +Y EY +DI  SG H++++IN++L++SKIE  K+ +      +  I+NE + 
Sbjct: 1549 RFGEIGNERYKEYLKDIRTSGSHIMSLINDLLDLSKIEAGKLDLQFTAVSIKDIVNECVA 1608

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--K 688
            ++   A  + + I   +P  +    AD R +++I+  +LSN+IKF  + G+ ++ T+   
Sbjct: 1609 IMQPQANRERVIIRASLPDSVPNVVADPRSLRQIVLNLLSNAIKFNKSGGQAIVSTAFED 1668

Query: 689  IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
             G+ V++ + DTG G+    L    +PF  LH     S  G GLGL ++ AL   +    
Sbjct: 1669 TGE-VVLRVRDTGTGMSAKDLSAALEPFRQLHTARHGS--GTGLGLPLTKALVEANRASF 1725

Query: 749  KIISQEGKGTIVTICMP 765
            +I S   +GT+V I  P
Sbjct: 1726 RIDSTPDQGTLVEISFP 1742


>gi|325292003|ref|YP_004277867.1| two component sensor kinase [Agrobacterium sp. H13-3]
 gi|325059856|gb|ADY63547.1| two component sensor kinase [Agrobacterium sp. H13-3]
          Length = 1248

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 163/272 (59%), Gaps = 14/272 (5%)

Query: 500  RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
            RLK++       R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLN
Sbjct: 978  RLKSSHGYCVVIRDITQWKRTEEELRNAKRA-----AETANAHKTDFLARVSHEIRTPLN 1032

Query: 560  AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
            AI+GF++++  E FG +G  +Y EY+ DI  SG+H+L+++N++L++SKIE  ++ +D   
Sbjct: 1033 AIIGFADMMATERFGPIGHPRYVEYSNDIGRSGRHVLDIVNDLLDISKIEAGQMDVDFIA 1092

Query: 620  ADLIPIINEGIRLIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKF 675
              L   + E + L+   A ++ +     + + +P      AD R IK+I+  ILSN+I+F
Sbjct: 1093 VPLNETVAEAVSLVQPQANNQRVIIRTALSQSVPQ---IVADLRSIKQIVLNILSNAIRF 1149

Query: 676  TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLG 733
            T + G++++ T+ +    V + I DTGIG+ ++ LE+  +PF  + +   +  G G GLG
Sbjct: 1150 TPSGGQIVVSTAYEANGSVALRIRDTGIGMTRAELEQAMKPFRQVASSGKRVRGDGTGLG 1209

Query: 734  LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            L ++ A+ + +     I S   +GT+V I  P
Sbjct: 1210 LPLTKAMVDANRANFSITSTPNEGTLVEITFP 1241


>gi|218459898|ref|ZP_03499989.1| probable two-component sensor histidine kinase protein [Rhizobium
           etli Kim 5]
          Length = 374

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 162/272 (59%), Gaps = 14/272 (5%)

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           RL ++    +  R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLN
Sbjct: 104 RLTSSNGYCAVIRDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLN 158

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AI+GFS+++  E FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D   
Sbjct: 159 AIIGFSDMMAGERFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAA 218

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEK----KIPSELFFNADKRIIKKILFPILSNSIKF 675
             L   ++E + L+   A  + + I       +P  +   AD R IK+I   ILSN+I+F
Sbjct: 219 VGLNEAVSEAVALVQPQANGQRVIIRTALSHAVPDVV---ADLRSIKQIALNILSNAIRF 275

Query: 676 TNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLG 733
           T + G++++ TS +    V++ + DTGIG+ ++ L+   +PF  + +   +  G G GLG
Sbjct: 276 TPSGGQIVVSTSYEANGSVVLRVRDTGIGMTRAELDHAMKPFRQVSSTQARHRGDGTGLG 335

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           L ++ A+ + +     I S   +GT+V I  P
Sbjct: 336 LPLTKAMVDANRATFSINSAPNEGTLVEITFP 367


>gi|251778814|ref|ZP_04821734.1| Two component system histidine kinase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
 gi|243083129|gb|EES49019.1| Two component system histidine kinase [Clostridium botulinum E1
           str. 'BoNT E Beluga']
          Length = 681

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 140/228 (61%), Gaps = 2/228 (0%)

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           A+K KS FLA MSHELRTPL+AI+  SE++K+EIFGEL S K  ++  +I  SG HLL++
Sbjct: 440 ADKIKSLFLANMSHELRTPLSAIITCSEILKEEIFGELNS-KQLKHVTNILNSGNHLLHL 498

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNAD 657
           INN+L++SKIE  K+ +      +  I  E   ++ S A  KNI+I   I PS+     D
Sbjct: 499 INNVLDISKIEAGKMKLTIGEYSISDIAMESFSVLKSLAYRKNIEINLNIEPSDFIIKID 558

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
              +K+IL+ ++SNSIKFT   GK+ I  +K    + + I D GIGI K   ++I   FE
Sbjct: 559 ANKLKQILYNLISNSIKFTEEGGKIQINITKNLAYMKLIIEDNGIGIKKEDQKRIFNEFE 618

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + N Y++   G GLGL ++  L  +HGG + +IS  G GT + I +P
Sbjct: 619 QVDNSYERKYEGTGLGLPLTKKLVEMHGGEIFLISNIGTGTKIIITIP 666


>gi|241762807|ref|ZP_04760871.1| histidine kinase [Acidovorax delafieldii 2AN]
 gi|241368226|gb|EER62418.1| histidine kinase [Acidovorax delafieldii 2AN]
          Length = 844

 Score =  165 bits (418), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 166/311 (53%), Gaps = 37/311 (11%)

Query: 484 ITLLKHNQ---AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           I LL  N    A+L +S  R ++   DL       ++   +L   N     + ++ +  +
Sbjct: 267 IVLLLENGKLYARLADSHERERSKTKDL-------QQLTVQLESVNNLLAEKNQQLQEVS 319

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + KS+FLA MSHELRTPLNAI+GFSEV+K  + GE+ + K +E+  DI  SGQHLL++IN
Sbjct: 320 QLKSDFLANMSHELRTPLNAIIGFSEVLKDGLVGEI-TPKQHEFVSDIFASGQHLLSLIN 378

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN-ADKR 659
           +IL++SKIE  K+++D    D+  ++   + ++   A +  I ++  +   L     D R
Sbjct: 379 DILDLSKIEAGKMTLDLDTQDVDAMLRNSLSIVKEKASAHAILLQFDVAEPLGMALLDAR 438

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI------------------------- 694
             K+I+F +LSN++KF+ NNGK+ ++  K+ +  I                         
Sbjct: 439 KTKQIVFNLLSNAVKFSANNGKVTLQARKVQRAAIETWATQQPTSLRMPLPPSAFADFLE 498

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           I + DTG+GI  + + ++ Q F  L +   +   G GLGLA+   L  LHGG + + S  
Sbjct: 499 IAVVDTGLGISAADVPRLFQAFSQLDSSLSRVSEGTGLGLALVLKLVQLHGGTVALASTP 558

Query: 755 GKGTIVTICMP 765
           G G+  T+ +P
Sbjct: 559 GHGSTFTVWLP 569


>gi|86356371|ref|YP_468263.1| putative two-component sensor histidine kinase protein [Rhizobium
            etli CFN 42]
 gi|86280473|gb|ABC89536.1| putative two-component sensor histidine kinase protein [Rhizobium
            etli CFN 42]
          Length = 1266

 Score =  165 bits (418), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 94/257 (36%), Positives = 156/257 (60%), Gaps = 8/257 (3%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NAK       AETAN  K++FLA++SHE+RTPLNAI+GFS+++  E
Sbjct: 1008 RDITQWKRTEDELRNAKGA-----AETANAHKTDFLARVSHEIRTPLNAIIGFSDMMAGE 1062

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D     L   ++E + 
Sbjct: 1063 RFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDISKIEAGEMDLDFAAVGLNEAVSEAVA 1122

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I   +   +    AD R IK+I   ILSN+I+FT + G++++ TS + 
Sbjct: 1123 LVQPQANGQRVIIRTALSHSVPEVVADLRSIKQIALNILSNAIRFTPSGGQIVVSTSYEA 1182

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRL 748
               V++ + DTGIG+ ++ L+   +PF  + +   +  G G GLGL ++ A+ + +    
Sbjct: 1183 NGSVVLRVRDTGIGMTRAELDHAMKPFRQVSSTQSRHRGDGTGLGLPLTKAMVDANRAIF 1242

Query: 749  KIISQEGKGTIVTICMP 765
             I S   +GT+V I  P
Sbjct: 1243 SINSAPNEGTLVEITFP 1259


>gi|254473454|ref|ZP_05086851.1| histidine kinase sensor protein [Pseudovibrio sp. JE062]
 gi|211957570|gb|EEA92773.1| histidine kinase sensor protein [Pseudovibrio sp. JE062]
          Length = 463

 Score =  165 bits (418), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 152/250 (60%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +E+   NA  Q  + RAE AN  K+ FLA MSHELRTPLNAILGFSEV+K E+ G + + 
Sbjct: 187 SEMEQVNAISQEARRRAEEANLAKTRFLATMSHELRTPLNAILGFSEVMKDEVLGPMHNQ 246

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +Y++DI+ SGQHLLN+IN IL++S+IE  +  + ++   L  +      ++   A +
Sbjct: 247 TYLDYSKDINQSGQHLLNLINEILDLSRIEAGRYELQEEPVCLRDVAAACKHMMHMRAAA 306

Query: 640 KNIKIE---KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVII 695
           KNI+I    +K  S+++  AD++ +++++  +L+N++KFT   G++ I     G     I
Sbjct: 307 KNIEIHEVYEKGLSKVW--ADEKALRQMVLNLLTNAVKFTPPEGEISIHVGIDGAGGQYI 364

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTG GIP+  +  + Q F         +  G GLGL+I  AL ++H G  K+ S+  
Sbjct: 365 SVSDTGAGIPEEEIPVVLQAFGQGTQAIQDAEQGTGLGLSIVQALAHMHEGEFKLASKLR 424

Query: 756 KGTIVTICMP 765
           +GT  TI +P
Sbjct: 425 EGTQATISLP 434


>gi|298676132|ref|YP_003727881.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
 gi|298289120|gb|ADI75085.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
          Length = 995

 Score =  165 bits (417), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 205/412 (49%), Gaps = 43/412 (10%)

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           +G   D+TE+  +E    E++ R    IE  ++A++  D +  ++  N       G    
Sbjct: 611 LGFTTDITERKKVEDELKESEGRFRTVIEQAADAIIAHDFDGNILYVNDLTCDNLGYTKD 670

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPER------SQDMSKEIKLADSRWLQINEWCTHD 474
            L+  N       A   P I+  T +P +      S   S  I+  + R          D
Sbjct: 671 ELLSMNL------ADIDPNID--TYEPRKRYWDKLSYHSSYLIETVNRR---------KD 713

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           G    V   +TL+  +           K  I  L   R I  R++ E  + NAK +    
Sbjct: 714 GSEFPVEVKMTLMNLSG----------KPVI--LGFVRDITVRKQAEEKLINAKLE---- 757

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQH 594
            AE AN+ KSE LA +SHELRTPL +I+GFS+VI K   G+L   +   Y   IH SGQH
Sbjct: 758 -AEAANQAKSELLANVSHELRTPLTSIIGFSDVILKRKVGDLNDNQT-RYLDKIHKSGQH 815

Query: 595 LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELF 653
           LL++IN+IL+++KIE+ K+ + ++   +  ++N+    +   A  K + ++ +I P+  +
Sbjct: 816 LLDLINDILDLAKIESGKLELHREKISIPALLNDLESKLYPFASKKGLSLDSEIDPNIEY 875

Query: 654 FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIG 713
             AD+  +++IL+ ++ N+IKFTN  G + +   +       ++ DTGIGIP+   ++I 
Sbjct: 876 IYADEIKLRQILYNLIYNAIKFTNK-GSVTVTVRQKNDAYQFSVIDTGIGIPEDKQDEIF 934

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           + F  L     +   G GLGLA+   L  +HGG++ + S+E KGT  T  +P
Sbjct: 935 ESFRQLDTGASRRYAGTGLGLALVKRLVEIHGGQIWVESEESKGTTFTFTIP 986


>gi|17231589|ref|NP_488137.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17133232|dbj|BAB75796.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 965

 Score =  165 bits (417), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 155/546 (28%), Positives = 245/546 (44%), Gaps = 78/546 (14%)

Query: 260 ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
           A+S GR G+W F+   +K      MYE+ G+  E+   +F A    +H D++    +   
Sbjct: 295 AISSGRFGIWEFDCVQEKVIWDERMYELYGVHPEDFPGNFDAWLSFVHPDDQDYLLVT-- 352

Query: 320 VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTIS--GGMN---------IIGIAMDLT 368
                   + Q+ H      A+  I   +  +R I   G +N         ++GI +D+T
Sbjct: 353 --------IQQVLHQNQEYDAEFQIIQPSGEIRVIKAYGVLNCDEQGKPILMVGINIDIT 404

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVM-CNANYQKAYGLPDHVLVPG-N 426
           E+   E+               +++AL L D    L + CN    + +   +   + G  
Sbjct: 405 ERKQAEQELIHNRDLREVIFNESADALFLVDPVTLLTLDCNRRTVELFEATNKGELLGIE 464

Query: 427 ARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDG----GTISVGT 482
            R++    Q RP       D   +Q  +K        W Q  E+ T  G    G I+   
Sbjct: 465 GRTL----QRRPFTSNEI-DTIVTQMQTKGF------WSQEIEYVTLKGKLFWGNIA-AK 512

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
            IT+          + R L     +L     I ER++ E  +     Q+ K  AE A  T
Sbjct: 513 PITI----------AGRTL-----NLVRVTDINERKQAEEKLLRTNEQLAKANAELARAT 557

Query: 543 --KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             K EFLA MSHELRTPLNAILG SE   + +FG +   K  +    I  SG+HLL +IN
Sbjct: 558 RLKDEFLANMSHELRTPLNAILGMSEGFIEGVFGAINQ-KQAKAIATIKRSGKHLLELIN 616

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           +IL++SKIE+ K+ +   +  +  I +  +  I   A  KNI +   I S L     D R
Sbjct: 617 DILDLSKIESGKLELQISDVSVRSICDGSLTFIQQMALKKNICLSTHIGSNLDTIQVDDR 676

Query: 660 IIKKILFPILSNSIKFTNNNG--------------------KMMIRTSKIGQCVIITIAD 699
            ++++L  +LSN++KFT   G                    K++ ++S     +   + D
Sbjct: 677 RLRQVLINLLSNAVKFTPEGGNVKLTVWLEEVGTNETLGAEKLISQSSIPSPHICFRVTD 736

Query: 700 TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
           TGIGI    + K+ QPF  L +  +++  G GLGLA+   +T LHGG + + S+ G+G+ 
Sbjct: 737 TGIGIASEDISKLFQPFTQLDSSLNRNYTGTGLGLALVKRITTLHGGTILVNSEVGQGSC 796

Query: 760 VTICMP 765
            T+ +P
Sbjct: 797 FTVRIP 802


>gi|85715579|ref|ZP_01046559.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
 gi|85697518|gb|EAQ35395.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
          Length = 611

 Score =  165 bits (417), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 151/259 (58%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           ++  R++ +R++ E ++      + +  AE A+  K+ FLA MSHELRTPLNAI+GFSE+
Sbjct: 320 VAVMREVTDRKQQEHAL-----DLARTAAERADAAKTRFLATMSHELRTPLNAIIGFSEM 374

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I +E    L + +  EYAQ I+ SGQHLL+++N+IL+MSK+E+    I  +      ++ 
Sbjct: 375 IVQEATLPLDATRRKEYAQLINDSGQHLLSVVNSILDMSKMESGSFEILPEPFAPREVLL 434

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            G  L+   A+   I++  ++P  L     D R  ++I+  ++SN+IKFT   G++ I  
Sbjct: 435 NGCNLLALKARDNGIELVTRVPENLPQMIGDPRAFRQIVLNLVSNAIKFTERGGRVTISA 494

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G  +++ + D G+GI +  L++IG PF      Y +   G GLGL+I   L  LH G
Sbjct: 495 RVEGARMVLRVMDDGVGIAQEDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVKNLVELHRG 554

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S+  +GT VT+ +P
Sbjct: 555 EIDVQSKVEEGTTVTVMLP 573


>gi|296447467|ref|ZP_06889391.1| multi-sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
 gi|296255005|gb|EFH02108.1| multi-sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
          Length = 597

 Score =  165 bits (417), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 135/228 (59%), Gaps = 1/228 (0%)

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           A+  K+ FLA +SHELRTPLNAI+GFS+++  E        K  EYA+ IH SGQHLL +
Sbjct: 327 ASAGKTRFLANVSHELRTPLNAIIGFSDMLASEQLSPADPSKRREYAEIIHNSGQHLLAV 386

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNAD 657
           +N+IL+MSKIE+  + I  +      + ++ ++++   A+   I +       L     D
Sbjct: 387 VNSILDMSKIESGSMQIVPEPFSAQELADQCVKMMQLKAEQARIALACDYADGLPEIVGD 446

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
           KR  K+IL  +LSN++KFT  +G++ +R    G  + I ++D+GIGI  + L ++G PF 
Sbjct: 447 KRACKQILINLLSNAVKFTPADGRVAVRLYPDGNRLAIAVSDSGIGIAAADLGRLGDPFF 506

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                YD++  G GLGL++   L  LHGG + + S   +GT VT+ +P
Sbjct: 507 QASAAYDRAYEGTGLGLSVVRGLVGLHGGAIAVESAPQRGTCVTVRLP 554


>gi|85715389|ref|ZP_01046371.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
 gi|85697810|gb|EAQ35685.1| Signal transduction histidine kinase [Nitrobacter sp. Nb-311A]
          Length = 536

 Score =  164 bits (416), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 145/252 (57%), Gaps = 12/252 (4%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL  A A     + RAE+AN  KS FLA+MSHELRTPLNAILGFSEV+K EIFGE     
Sbjct: 242 ELEQAKAISDEARHRAESANVAKSRFLAQMSHELRTPLNAILGFSEVMKSEIFGEHAVAV 301

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y  Y+ DIH SG HLLN+IN IL++S+IE  +  ++++   L+ ++ E   L+   A ++
Sbjct: 302 YKTYSADIHNSGVHLLNLINEILDLSRIEAGRYELNEEAVSLVHVVTECHHLLKLRASNR 361

Query: 641 NIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCV 693
            I I    E+ +P       D+R  ++I+  ++SN+IKFT   G++ ++   T+  GQ  
Sbjct: 362 GITIHEVFEQGMPR---IWGDERAARQIVLNLVSNAIKFTPQGGEIWLKIGWTASGGQ-- 416

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            + + D G GI +  +  +   F    N    +  G GLGL I+ +L +LHGG   + S+
Sbjct: 417 YLGVKDNGSGIAEDEIPIVLASFGQGSNSIKSAEQGAGLGLPIAKSLIDLHGGTFTLKSK 476

Query: 754 EGKGTIVTICMP 765
              GT V +  P
Sbjct: 477 LRVGTEVIVTFP 488


>gi|182678613|ref|YP_001832759.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182634496|gb|ACB95270.1| multi-sensor signal transduction histidine kinase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 583

 Score =  164 bits (416), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 158/279 (56%), Gaps = 15/279 (5%)

Query: 497 SKRRLKATIND----LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +K+R +A  +D    +   R I   ++ E  +  A+       AETAN+ K  FLA MSH
Sbjct: 272 AKKREEAEADDQAMIIGVYRDISAMRRVEQELDAARVA-----AETANQAKDRFLANMSH 326

Query: 553 ELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEK 612
           ELRTPLNAI+GFSE++          +K  EYA  IH SG+HLL+++N+IL+MSKI +  
Sbjct: 327 ELRTPLNAIIGFSEMLADPQLCPQDPLKQREYAAIIHSSGEHLLHVVNSILDMSKIHSGT 386

Query: 613 ISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILS 670
             +  Q   L P+I     ++   A++K I++  +I ++ +    AD++  K+IL  +LS
Sbjct: 387 FPLQPQPIVLAPLIASCCAMLRPQAEAKEIEL-VQIHADPWDEIVADQQACKQILLNLLS 445

Query: 671 NSIKFTNNNGKMMIRTSKIGQC---VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSI 727
           N++KFT   G++ I    +  C   + I + DTGIGI    L ++G+PF     + ++  
Sbjct: 446 NAVKFTPRRGRVTIAVDCVVDCLDDIQIAVQDTGIGISADDLTRLGEPFFQAMVRQERPH 505

Query: 728 GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            G GLGL+I   L  LHGG L I S+  +GT + + +P+
Sbjct: 506 EGTGLGLSIVRGLVELHGGTLLIESEPDQGTSMIVRLPR 544


>gi|86750625|ref|YP_487121.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris HaA2]
 gi|86573653|gb|ABD08210.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris HaA2]
          Length = 627

 Score =  164 bits (416), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 146/255 (57%), Gaps = 6/255 (2%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R + +R++ E ++  A+ +  +     A+ TKS FLA MSHELRTPLNA++GFS++I  E
Sbjct: 347 RDVTDRKQQEQALEEARAEAGR-----ADATKSRFLATMSHELRTPLNAVIGFSDMILHE 401

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
               L   +  EYAQ I+ SGQHLL+++N IL+MSKIE+    I  +     P +     
Sbjct: 402 DELMLAPERRKEYAQLINDSGQHLLSVVNGILDMSKIESGHFEIAPEPFAPRPALLNCCN 461

Query: 632 LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           L+   A+   I +  + P  L     D R  K+IL  ++SN+IKFT   G + +     G
Sbjct: 462 LLALKARENGIDLVTRAPENLPEIVGDPRAFKQILLNLVSNAIKFTERGGTVSVDAMVEG 521

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             +++ ++DTG+GI    L++IG PF      Y +   G GLGL+I  +L  +HGG +++
Sbjct: 522 ARLVLRVSDTGVGIAAEDLKRIGDPFFQAGTTYQRRHEGTGLGLSIVKSLVGMHGGDIEV 581

Query: 751 ISQEGKGTIVTICMP 765
            S+  +GT VT+ +P
Sbjct: 582 KSEVDRGTTVTVSLP 596


>gi|298675432|ref|YP_003727182.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
 gi|298288420|gb|ADI74386.1| multi-sensor signal transduction histidine kinase [Methanohalobium
           evestigatum Z-7303]
          Length = 851

 Score =  164 bits (416), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 144/232 (62%), Gaps = 4/232 (1%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE+AN+TK+EFLA +SHELRTPLN+I+GFSE++  E  GEL   + + Y  ++  SG HL
Sbjct: 620 AESANRTKNEFLANVSHELRTPLNSIIGFSELMLTERRGELNEYQKH-YLNNVKNSGYHL 678

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN 655
           L++IN IL++SKIE  K+  + QN  +I ++N+    +   A +KNI++E  I  +   N
Sbjct: 679 LSLINKILDISKIEAGKMDYNPQNLPIIDLVNDVSNTMHPQALNKNIELET-ITDKYLGN 737

Query: 656 --ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIG 713
             AD+  +K+ L+ +++N+IKFT   GK+ ++ +K+   +   + DTGIGIP+     + 
Sbjct: 738 IYADENKLKEALYNLVTNAIKFTPERGKVTLQVNKLDGNIRFAVKDTGIGIPEDKQSDLF 797

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +PF  +     +  GG GLGLA+      +H GR+ I S+  KGT +   +P
Sbjct: 798 KPFTQIDTSASREYGGAGLGLALVKKFVEMHNGRIWIESEVNKGTAIYFTIP 849


>gi|260427268|ref|ZP_05781247.1| cytoplasmic sensor hybrid histidine kinase [Citreicella sp. SE45]
 gi|260421760|gb|EEX15011.1| cytoplasmic sensor hybrid histidine kinase [Citreicella sp. SE45]
          Length = 861

 Score =  164 bits (416), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/428 (27%), Positives = 205/428 (47%), Gaps = 75/428 (17%)

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
            ++ + +D+TE             R+  A+E   +  V++D  DR++MCN  Y+  Y   
Sbjct: 184 GVVSLCVDITELM-----------RMWSALEELPDGFVIYDAEDRMLMCNEPYRAIYKAS 232

Query: 419 DHVLVPGNA-----RSIIQDAQTRPII-------EYRTSDPERSQDMSKEIKLADSRWLQ 466
              +VPG +     R  ++  Q    +       E R S   R      E +L D RWL+
Sbjct: 233 APAIVPGASFEDILRYGLERGQYAAAVGREEDWLEERLSA-HRHASHEMEQQLGDGRWLR 291

Query: 467 INEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
           I E    DGG + +  DIT +K  Q +L E++ R                          
Sbjct: 292 IYERPLRDGGRVGLRIDITDVKDTQRELEEARIR-------------------------- 325

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
                    AETA++ KS FLA MSHE+RTP+N ++G +E++++    +    +   Y  
Sbjct: 326 ---------AETASRAKSSFLANMSHEIRTPMNGVVGMAELLRESPLTD----EQRLYVD 372

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            I  SG+ LL +IN+IL+ SKIE +K+ +  ++ DL   ++E + L+  +A+ K +++  
Sbjct: 373 TIRGSGEALLVIINDILDYSKIEADKLKLSAESFDLERAVHEVLLLLQPTAREKGLEMLA 432

Query: 647 KIPSELFFN----ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITI 697
           +   ++F       D   +++IL  ++ N++KFT N G +++R   +        V IT+
Sbjct: 433 EY--DMFLPQRVVGDPGRVRQILTNLVGNAVKFT-NEGHVLVRVLGLRHAHGALDVRITV 489

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
            DTG+G+P   +E I   F    +  ++   G GLGLAI+  L  +  G + + S+ G+G
Sbjct: 490 EDTGVGVPADKIEHIFGEFNQAEDDRNRPFEGTGLGLAITKRLVEMMEGEIWVKSEPGQG 549

Query: 758 TIVTICMP 765
           +   + +P
Sbjct: 550 SCFGLRIP 557


>gi|188588291|ref|YP_001921255.1| Two component system histidine kinase [Clostridium botulinum E3
           str. Alaska E43]
 gi|188498572|gb|ACD51708.1| Two component system histidine kinase [Clostridium botulinum E3
           str. Alaska E43]
          Length = 681

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/228 (42%), Positives = 140/228 (61%), Gaps = 2/228 (0%)

Query: 539 ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
           A+K KS FLA MSHELRTPL+AI+  SE++K+EIFGEL S K  ++  +I  SG HLL++
Sbjct: 440 ADKIKSLFLANMSHELRTPLSAIITCSEILKEEIFGELNS-KQLKHITNILNSGNHLLHL 498

Query: 599 INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNAD 657
           INN+L++SKIE  K+ +      +  I  E   ++ S A  KNI+I   I PS+     D
Sbjct: 499 INNVLDISKIEAGKMKLTIGEYSISDIAMESFSVLKSLAYRKNIEINLNIEPSDFIIKID 558

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
              +K+IL+ ++SNSIKFT   GK+ I  +K    + + I D GIGI K   ++I   FE
Sbjct: 559 ANKLKQILYNLISNSIKFTEEGGKIQINITKNLAYMKLIIEDNGIGIKKEDQKRIFNEFE 618

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + N Y++   G GLGL ++  L  +HGG + +IS  G GT + I +P
Sbjct: 619 QVDNSYERKYEGTGLGLPLTKKLVEMHGGEIFLISNIGTGTKIIITIP 666


>gi|316934984|ref|YP_004109966.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris DX-1]
 gi|315602698|gb|ADU45233.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris DX-1]
          Length = 607

 Score =  164 bits (415), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 148/259 (57%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           ++  R I ER+  E ++  A+ + ++     A+  KS FLA MSHELRTPLNAI+GFS++
Sbjct: 323 VAVMRDITERKLHEQALDEARAEADR-----ADDAKSRFLATMSHELRTPLNAIIGFSDM 377

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I +E    LG+ +  EYAQ I+ SGQHLL+++N IL+MSK+E+    I  +     P + 
Sbjct: 378 IVQEDELRLGAERRKEYAQLINDSGQHLLSVVNGILDMSKMESGNFEIVPEPFAPRPALL 437

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A+   I +  + P  L     D R  K+IL  ++SN++KFT   G + +  
Sbjct: 438 NCCNLLALKARDSGIDLVTRAPENLPDVVGDPRAFKQILLNLVSNAVKFTERGGTVTVSA 497

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
           +     +++ + DTG+GI +  L+++G PF      Y +   G GLGL+I  +L  +HGG
Sbjct: 498 AVESTRLVLCVTDTGVGIAEEDLKRLGDPFFQAGKTYQRRHEGTGLGLSIVKSLVRMHGG 557

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + SQ   GT VT+ +P
Sbjct: 558 EIDVRSQIDCGTTVTVSLP 576


>gi|15965635|ref|NP_385988.1| putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|307314039|ref|ZP_07593652.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium meliloti BL225C]
 gi|307321216|ref|ZP_07600618.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium meliloti AK83]
 gi|15074816|emb|CAC46461.1| Putative sensor histidine kinase transmembrane protein
           [Sinorhizobium meliloti 1021]
 gi|306893118|gb|EFN23902.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium meliloti AK83]
 gi|306899161|gb|EFN29800.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium meliloti BL225C]
          Length = 511

 Score =  164 bits (415), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 143/251 (56%), Gaps = 8/251 (3%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSTEVLGPLSNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY  DIH SG+HLLN+IN IL++S+IE  K  + +   +L  I+ + I ++   A+ 
Sbjct: 299 TYKEYTLDIHRSGEHLLNLINEILDLSRIEAGKYELSEDAVNLAEIVEDCIGMVQLRARG 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVI 694
           KNI I    E+ +PS     AD++ ++++   +LSN++KFT + G++ ++     G    
Sbjct: 359 KNITIGHQFEQAMPS---VWADEKAMRQVTLNLLSNAVKFTPSGGEVSVKVGWTAGGGQY 415

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           ++I D G GIP+  +  +   F         +  G GLGL I  A+   HGG+  + S+ 
Sbjct: 416 LSIRDNGPGIPEEEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHGGQFILRSKL 475

Query: 755 GKGTIVTICMP 765
            +GT     +P
Sbjct: 476 REGTEAIAILP 486


>gi|21228620|ref|NP_634542.1| sensory transduction histidine kinase [Methanosarcina mazei Go1]
 gi|20907118|gb|AAM32214.1| Sensory transduction histidine kinases [Methanosarcina mazei Go1]
          Length = 702

 Score =  164 bits (415), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 123/406 (30%), Positives = 208/406 (51%), Gaps = 40/406 (9%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           D+TE+   EK   E+++     +  T + +++ D   R++  NA   K  G+        
Sbjct: 310 DITERKKAEKALKESEENFRTLVNNTLDGILILDFEGRVLAANAAIGKMLGME------- 362

Query: 426 NARSIIQDAQTRPIIEYRTSD--PERSQDMSKEIKLADSR--WLQINEWCTHDGGTISV- 480
                ++      I++Y   +  P   +D   +I + + R  +L + +  + +G  + + 
Sbjct: 363 -----LEKVAGIDIMKYLAPESVPVAVED---QINVLNGRGGYLSVYKSTSCNGEPLWIE 414

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           G    ++   Q               ++   R I  R+K E ++ NAK       AE AN
Sbjct: 415 GLGTKIIYRGQPA-------------NIVVIRDITARKKAEEALINAKTA-----AEAAN 456

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           +TKSEFL  MSHEL+TPLN+I+GFS+++ + I G L   K   YA  I  +G++LLN+IN
Sbjct: 457 RTKSEFLTNMSHELKTPLNSIIGFSDLLIEGIAGPLNE-KQSRYAGFISSNGKNLLNIIN 515

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFNADKR 659
            ILE+SK+E+E   +  Q   +   IN+ I         KNIK+     S+ L   AD+ 
Sbjct: 516 GILELSKVESEGDELTLQEFSVNESINKSISTALPQILKKNIKLNYNSDSDPLCIFADEN 575

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
             ++I+  +L+N++KFT  +G + I + + G  V I + DTGIGIP+ +L+KI +PF  L
Sbjct: 576 KFRQIMESLLNNAVKFTPEDGLIDISSKQEGGIVTIKVKDTGIGIPEDSLDKIFKPFIQL 635

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            +   ++  G GLGL ++     +HGG + + S+ GKG+   + +P
Sbjct: 636 ESSLSRTFEGTGLGLTLAKKYVEMHGGNISVESKTGKGSSFKVELP 681


>gi|144897547|emb|CAM74411.1| Signal transduction histidine kinase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 530

 Score =  164 bits (414), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 99/307 (32%), Positives = 166/307 (54%), Gaps = 9/307 (2%)

Query: 464 WLQINEWCTHDGGTI----SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQK 519
           W  I +     GG +     +  D+T  K  +  LR S   L+  +++ +     L ++ 
Sbjct: 223 WYSITKVPIRLGGDVVGLAGIARDVTKRKQAEDLLRRSHDDLQRAVDERTA---WLRQEI 279

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +  + A  + +  ++ AE +++ KS FLA MSHELRTPLNAI+GF+E+ + ++ GE    
Sbjct: 280 SRRAQAEEQARAARDVAEASSRAKSTFLANMSHELRTPLNAIIGFAELAESQM-GEAEKQ 338

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
           +   +  DI  S  HLL +I++IL+++++E  KI++ +    +  +I   +RL   S  +
Sbjct: 339 RLGSFICDIGESAHHLLRVISDILDVARVEAGKINLHESLIFIPEVIQSAVRLTAPSVTA 398

Query: 640 KNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIA 698
           K   +    P +L     D+R+IK++L  +++N+ KFT NNG++ IR   +  CV ++IA
Sbjct: 399 KQQTVLTSCPDDLPRLKGDERLIKQVLLNLVANASKFTQNNGQITIRAELVDGCVRLSIA 458

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           D G GI    + K+ QPF  + N       G GLGL ++     LHGG L + SQ  +GT
Sbjct: 459 DNGCGIAPDDIAKVLQPFGQVENLLAPKQEGTGLGLPLAREFMELHGGSLDVQSQLNQGT 518

Query: 759 IVTICMP 765
            V +  P
Sbjct: 519 TVILTFP 525


>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040378|gb|ACT57174.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 495

 Score =  164 bits (414), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 146/249 (58%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL +A +     ++RAE  N  KS FLA MSHELRTPLNAILGFSEVI+ E  G L +  
Sbjct: 227 ELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNET 286

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY  DIH SGQHLLN+IN IL++S+IE  +  + +    LI I+ E I ++   AQ K
Sbjct: 287 YKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEK 346

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
           NI+I +KI PS     AD++ +++++  +LSN++KFT   G++ +    TS  GQ   I+
Sbjct: 347 NIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQY--IS 404

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I D G GI +  +  +   F         +  G GLGL I+ ++   HGG+  I S+  +
Sbjct: 405 IKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLRE 464

Query: 757 GTIVTICMP 765
           G  V   +P
Sbjct: 465 GVEVIAILP 473


>gi|260462410|ref|ZP_05810618.1| histidine kinase [Mesorhizobium opportunistum WSM2075]
 gi|259031904|gb|EEW33172.1| histidine kinase [Mesorhizobium opportunistum WSM2075]
          Length = 602

 Score =  164 bits (414), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 135/224 (60%), Gaps = 1/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K  FLA +SHELRTPLNAI+GFS+++  E+FG     +  EY   +  SGQHLL ++ +I
Sbjct: 345 KGRFLAVVSHELRTPLNAIIGFSDMLLHEMFGAFKDPRQKEYVGLVRDSGQHLLAVVTSI 404

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRII 661
           L++S+IE+   + + +    +  +     ++   AQ+KNI ++ +I P     NAD+R +
Sbjct: 405 LDVSRIESGAYATEPEPFRFMEAVEMCQSMMRLQAQAKNIDLQTQIAPDAGDINADRRAV 464

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  ++SN++KFT + G +++   +IG  +   + DTGIGI +     +G+PF  + N
Sbjct: 465 QQILINLVSNAVKFTPDGGDVVVGAKRIGSRLHFWVRDTGIGIAEEDFANLGKPFMQIQN 524

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGL++   L  LH G + I S  G+GT VTI +P
Sbjct: 525 DYTRRFEGTGLGLSLVKGLVALHEGTMSIESMPGEGTTVTISLP 568


>gi|256159351|ref|ZP_05457134.1| PAS domain S-box-containing protein [Brucella ceti M490/95/1]
 gi|265997788|ref|ZP_06110345.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M490/95/1]
 gi|262552256|gb|EEZ08246.1| multi-sensor signal transduction histidine kinase [Brucella ceti
           M490/95/1]
          Length = 407

 Score =  164 bits (414), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 129/211 (61%), Gaps = 2/211 (0%)

Query: 197 SILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANIC 256
           SI+ +     +   W+  V+L V  F+    ++  IL++Y+ QA + +E D +  +    
Sbjct: 199 SIIAVEPESTIFAEWKRAVSLNVTLFAGTIGVMFAILYAYFSQAARAREADDLSGQIQRR 258

Query: 257 VETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEI 316
           ++ AL+RGRCGLW+++    + + SRSMYE++G   ++  L F  +A +I+ ++  +  I
Sbjct: 259 IDMALARGRCGLWDWDMARGRIYWSRSMYEMLGYEAQDAVLPFGDVAAIINEEDGDLYSI 318

Query: 317 ARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKR 376
           A       +  +D++F MRHA G+ +W++VRA++     G ++++GIA D++E++   ++
Sbjct: 319 AEQAAAGDISHVDRVFRMRHADGSWVWMRVRAEIAS--EGDLHLVGIAFDVSEQHRFAQQ 376

Query: 377 YAEADQRLSKAIECTSEALVLWDKNDRLVMC 407
            AEAD R+ +AIE  SEA VLWD N+RLVM 
Sbjct: 377 TAEADMRIREAIENISEAFVLWDANNRLVMA 407


>gi|163850140|ref|YP_001638183.1| PAS sensor protein [Methylobacterium extorquens PA1]
 gi|163661745|gb|ABY29112.1| PAS sensor protein [Methylobacterium extorquens PA1]
          Length = 648

 Score =  163 bits (413), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           A   D+S  R    R   EL  A A+       AE A++ K+ FLA +SHELRTPLNAI+
Sbjct: 324 AVTRDVSEHR----RHAQELDRARAE-------AERADEVKTHFLATVSHELRTPLNAII 372

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+V+  E    L   +  EYA  I  SG+HLL+++N +L++S+I         +  D+
Sbjct: 373 GFSDVLGGEGAMSLSPERSREYAGIIAQSGRHLLDVVNTLLDISRIRGGHFDFQPEPVDV 432

Query: 623 IPIINEGIRLIGSSAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
             +I     L+   A +  I +    +P+     AD R  +++L  ++SN++KFT   G+
Sbjct: 433 EALIRGCCDLMRLKADASGIALTSAPVPASCALVADARACRQMLINLISNAVKFTPRGGR 492

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +   + G  + I ++D GIGI ++ L ++G PF  +   Y +S  G GLGL++   L 
Sbjct: 493 VEVMVRRGGAYLDIVVSDDGIGITEADLPRLGDPFFQVGGGYGRSHEGTGLGLSVVRGLA 552

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG + + S  GKGT VT+ +P
Sbjct: 553 GLHGGAVSVESAPGKGTAVTVTLP 576


>gi|87310159|ref|ZP_01092291.1| sensory box sensor histidine kinase/response regulator
           [Blastopirellula marina DSM 3645]
 gi|87287149|gb|EAQ79051.1| sensory box sensor histidine kinase/response regulator
           [Blastopirellula marina DSM 3645]
          Length = 845

 Score =  163 bits (413), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 142/525 (27%), Positives = 247/525 (47%), Gaps = 45/525 (8%)

Query: 250 LLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYD 309
           L  AN  ++ AL  G  G+W +  +N +F       ++ GI   +   +      L+H D
Sbjct: 190 LQTANERLDCALEAGGIGVWQWRDENDQFEADGRALQMHGIQATDNVSTLAEFLDLLHED 249

Query: 310 NKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLT 368
           +++    A +    H       + +  A+G   +IQ   +++ +  G    ++G+ +D T
Sbjct: 250 DREELRTATARCVSHGTNYSVNYRIPRANGTVRYIQSHGKVLSSDDGKTRKLVGVCIDQT 309

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNAR 428
           E       Y  A ++LS     T  ++V+ ++       N  + +  G      +     
Sbjct: 310 EL----TEYHAAVKKLSLVASSTRHSVVITNQAGETEWVNNAFTQLTGYSAEEAIGRKPG 365

Query: 429 SIIQDAQT-RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLL 487
           S++Q  +T +  IE      ++ + +S E+         +N     DG +  +  +I  +
Sbjct: 366 SLLQGPETNQETIEIVRRALQKQEQVSAEL---------LNY--AKDGHSYWIALEIEPV 414

Query: 488 KHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFL 547
              + +L           N ++T   I ++ +    +  A      E AE+AN  KS+FL
Sbjct: 415 FDQEGRLS----------NFIATQIDITDQVRRTEELIEAM-----ETAESANHAKSQFL 459

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A MSHE+RTPLN I+GF++++  +I  E       EY + +  SG+HLL +IN IL++SK
Sbjct: 460 ANMSHEIRTPLNGIMGFTDLLLYDI--ESTEADRREYLETVRSSGEHLLALINEILDLSK 517

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK----KIPSELFFNADKRIIKK 663
           IE+ ++ I+K       I+ + I ++    + K I+I +     IP+++  +A +  +K+
Sbjct: 518 IESGQLLIEKFPCSPQQILTDVISVLRPKFEEKKIQIRRHWDSDIPTQVLTDAPR--LKQ 575

Query: 664 ILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPKSALEKIGQPFEPL 719
           +L  I+ N+IKFT   G++ I      +     +I  + DTGIGIP+  LE I QPF   
Sbjct: 576 LLLNIVGNAIKFTQT-GEVRIVARLEAEATRSRLIFDVIDTGIGIPQGKLEMIFQPFSQA 634

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            +   +  GG GLGL IS  L  L GG L   S EG G+  TI +
Sbjct: 635 DSSVTRRFGGTGLGLTISRNLAELLGGSLHAESVEGLGSKFTITV 679


>gi|83591667|ref|YP_425419.1| periplasmic sensor Signal transduction histidine kinase
           [Rhodospirillum rubrum ATCC 11170]
 gi|83574581|gb|ABC21132.1| Periplasmic Sensor Signal Transduction Histidine Kinase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 620

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 154/262 (58%), Gaps = 5/262 (1%)

Query: 508 LSTSRQILERQKTELSIAN--AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
           L   RQI       ++++N  A     +  +E AN+ K+ FLA MSHELRTPLNAI+GFS
Sbjct: 344 LKVHRQIRHLNGLIVALSNREAALVAARRSSEEANRAKTLFLANMSHELRTPLNAIIGFS 403

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           +++   I G L   +  +YA+DI+ S  HLL++IN+IL+++KIE+    + ++  +L  I
Sbjct: 404 DMLANGIHGALAD-RQQDYARDINLSALHLLDLINDILDVAKIESGGYLLHERPCNLAAI 462

Query: 626 INEGIRLIGSSAQSKNIKIEKK-IPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
           I    R++G   + K + ++   +  E +  AD+R ++++L  +LSN++KFT   G++ +
Sbjct: 463 IRAAERMLGPRVREKGLVMDTVCVDGEAWVMADERAMQQVLLNLLSNAVKFTPEGGRITV 522

Query: 685 RTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
                 G  +++ + DTG GIP   L  + +PF  +     +S  G GLGL ++ AL   
Sbjct: 523 SLGLNEGGGMVLVVGDTGPGIPAEHLALVLEPFYQVGEVETRSHEGTGLGLPLAKALVEK 582

Query: 744 HGGRLKIISQEGKGTIVTICMP 765
           H G L++ SQ G+GT V++ +P
Sbjct: 583 HEGALRLDSQPGQGTRVSVTLP 604


>gi|91976421|ref|YP_569080.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB5]
 gi|91682877|gb|ABE39179.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB5]
          Length = 607

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/255 (36%), Positives = 146/255 (57%), Gaps = 6/255 (2%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R + +R+  E ++  A+ +  +     A+ +KS FLA MSHELRTPLNAI+GFS++I  E
Sbjct: 327 RDVTDRKLQEQALEQARAEASR-----ADASKSRFLATMSHELRTPLNAIIGFSDMILHE 381

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
               L   +  EYAQ I+ SGQHLL+++N IL+MSK+E+    I  +     P +     
Sbjct: 382 DELMLAPERRKEYAQLINDSGQHLLSVVNGILDMSKMESGNFEIVPEPFAPRPALLNCCN 441

Query: 632 LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           L+   A+   I++  + P +L     D R  K+IL  ++SN+IKFT   G + +  +   
Sbjct: 442 LLALKARENGIELVTRAPEDLPEIVGDARAFKQILLNLVSNAIKFTERGGTVSVEAAVEA 501

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             +++ + D G+GI    L++IG PF      Y +   G GLGL+I  +L  LHGG++ +
Sbjct: 502 ARLVLRVRDNGVGIAAEDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVKSLVGLHGGKIDV 561

Query: 751 ISQEGKGTIVTICMP 765
            S+  +GTIVTI +P
Sbjct: 562 TSEVDRGTIVTISLP 576


>gi|170746662|ref|YP_001752922.1| multi-sensor hybrid histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653184|gb|ACB22239.1| multi-sensor hybrid histidine kinase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 974

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 155/255 (60%), Gaps = 10/255 (3%)

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
           +++ER++ E S+  AK     E AE A++ KS FLA MSHELRTPLNAI+GF+ ++ +  
Sbjct: 453 RVIERKQAEESLRQAK-----EAAEEASRAKSSFLANMSHELRTPLNAIIGFTRLVMRRA 507

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
              L  VK +E  + I  S +HLL++IN+IL+++K+E  ++ +   +  L P+++  +R 
Sbjct: 508 KDVL-PVKQFENLEKILASSEHLLSLINSILDLAKVEAGRMEVKPSDFALEPVLDLCLRT 566

Query: 633 IGSSAQSKNIKIEKKI--PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           +    +++ +++ + +  P  +    D+  +++IL  +LSN+IKFT   G + +R   + 
Sbjct: 567 VEPLVKNEGVRLVRDVRDPPPML-RTDEEKLRQILINLLSNAIKFTEA-GSVTLRVRSVD 624

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
           + +   + DTGIGIP  AL  I + F  + N   +S  G GLGLAIS  L  L GGR+ +
Sbjct: 625 EGIEFAVMDTGIGIPAGALSAIFEEFHQVDNSATRSHSGTGLGLAISHRLARLLGGRIDV 684

Query: 751 ISQEGKGTIVTICMP 765
            S+EG+G+  T+ +P
Sbjct: 685 ESREGEGSTFTLTIP 699



 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 73/139 (52%), Gaps = 23/139 (16%)

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGN-----ARSIIQDA 434
           A Q+L +AIEC+SE   L+D +DRLV+CN ++Q  +     ++VPG      AR++ +  
Sbjct: 33  AKQKLIEAIECSSEGFALFDSDDRLVLCNGHFQDLHPGLSTIIVPGVAFEAIARAVAETC 92

Query: 435 QTRP------------IIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGT 482
             RP            I  YR       Q      +  D RW+Q+NE  T+DGG ++V T
Sbjct: 93  VVRPNGMTVEGWLAERIAHYRAPGGPLLQ------QRVDGRWVQVNERKTNDGGVVAVYT 146

Query: 483 DITLLKHNQAQLRESKRRL 501
           D+T +K  +  L+ ++ RL
Sbjct: 147 DVTEIKRAEQVLQATQGRL 165


>gi|323136816|ref|ZP_08071897.1| histidine kinase [Methylocystis sp. ATCC 49242]
 gi|322398133|gb|EFY00654.1| histidine kinase [Methylocystis sp. ATCC 49242]
          Length = 883

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 149/242 (61%), Gaps = 4/242 (1%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N + +  +  AE A+  KS+FLA++SHE+RTPLNAI+GF+EV+ +E FG +GS +Y EY 
Sbjct: 636 NDELEAARVAAEHASAAKSDFLARVSHEIRTPLNAIIGFAEVMMEERFGPIGSERYKEYL 695

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
           +D+H SG H+L+++N++L++SKIE  K+ +  +  D   II+E + ++ + A    + + 
Sbjct: 696 KDVHASGTHVLSLVNDLLDLSKIEAGKLELSFERVDANAIISECVSIMQTQANQGRVVVR 755

Query: 646 KKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVIITIADTGIG 703
             +   L    AD+R +K+IL  +LSN++KF    G++++ T+      V+I + DTG+G
Sbjct: 756 LALAQRLPPIRADERSLKQILLNLLSNAVKFNEPGGQVIVSTALTEAGYVVIRVKDTGVG 815

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           +    +E   +PF+ +     + + G GLGL ++ AL   +     I S++ +GT++ + 
Sbjct: 816 MSDDEVETALEPFKQIATS--RKVRGTGLGLPLTKALIEANHASFTIKSRKNEGTLIEVA 873

Query: 764 MP 765
            P
Sbjct: 874 FP 875


>gi|218528744|ref|YP_002419560.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
 gi|218521047|gb|ACK81632.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium chloromethanicum CM4]
          Length = 646

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           A   D+S  R    R   EL  A A+       AE A++ K+ FLA +SHELRTPLNAI+
Sbjct: 322 AVTRDVSEHR----RHAQELDRARAE-------AERADEVKTHFLATVSHELRTPLNAII 370

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+V+  E    L   +  EYA  I  SG+HLL+++N +L++S+I         +  D+
Sbjct: 371 GFSDVLGGEGAVSLSPERSREYAGIIAQSGRHLLDVVNTLLDISRIRGGHFDFQPEPVDV 430

Query: 623 IPIINEGIRLIGSSAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
             +I     L+   A +  I +    +P+     AD R  +++L  ++SN++KFT   G+
Sbjct: 431 EALIRGCCDLMRLKADASGITLTSAPVPAGCALVADARACRQMLINLISNAVKFTPRGGR 490

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +   + G  + I ++D GIGI ++ L ++G PF  +   Y +S  G GLGL++   L 
Sbjct: 491 VEVMVRRGGAYLDIVVSDDGIGITEADLPRLGDPFFQVGGGYGRSHEGTGLGLSVVRGLA 550

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG + + S  GKGT VT+ +P
Sbjct: 551 GLHGGAVSVESAPGKGTAVTVTLP 574


>gi|90418087|ref|ZP_01225999.1| putative sensor histidine kinase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337759|gb|EAS51410.1| putative sensor histidine kinase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 501

 Score =  163 bits (412), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 141/248 (56%), Gaps = 2/248 (0%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A       + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  EI G +G+ 
Sbjct: 239 AELEMAKIMSDEARSRAEEANLAKSRFLATMSHELRTPLNAILGFSEVMSNEILGPIGNE 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +Y  DIH SGQHLL +IN IL++S++E  + ++ ++  D++ I  + +  +   A++
Sbjct: 299 SYKDYIADIHASGQHLLGLINEILDLSRVEAGRYALSEEAVDIVAIARDCLGYVRVKAEA 358

Query: 640 KNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITI 697
           K++ I  +  ++L    AD+R +++I+  +LSN++KFT   G++ +R     G    + +
Sbjct: 359 KDLVIGAEFEADLPAMWADERSLRQIILNLLSNAVKFTPRGGEITLRVGWTAGGGQYLAV 418

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
            D G GIP+  +  +   F         +  G GLGL I  AL  +H G  ++ S+  +G
Sbjct: 419 KDNGPGIPEEEIPIVLSSFGQGSIAIKSAEQGTGLGLPIVQALMKMHDGSFELRSRLREG 478

Query: 758 TIVTICMP 765
           T      P
Sbjct: 479 TEAIAIFP 486


>gi|240137274|ref|YP_002961743.1| Two-component sensor histidine kinase with a PAS domain
           [Methylobacterium extorquens AM1]
 gi|240007240|gb|ACS38466.1| Two-component sensor histidine kinase with a PAS domain
           [Methylobacterium extorquens AM1]
          Length = 646

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           A   D+S  R    R   EL  A A+       AE A++ K+ FLA +SHELRTPLNAI+
Sbjct: 322 AVTRDVSEHR----RHAQELDRARAE-------AERADEVKTHFLATVSHELRTPLNAII 370

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+V+  E    L   +  EYA  I  SG+HLL+++N +L++S+I         +  D+
Sbjct: 371 GFSDVLGGEGAVSLSPERSREYAGIIAQSGRHLLDVVNTLLDISRIRGGHFDFQPEPVDV 430

Query: 623 IPIINEGIRLIGSSAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
             +I     L+   A +  I +    +P+     AD R  +++L  ++SN++KFT   G+
Sbjct: 431 EALIRGCCDLMRLKADASGITLTSAPVPAGCALVADARACRQMLINLISNAVKFTPRGGR 490

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +   + G  + I ++D GIGI ++ L ++G PF  +   Y +S  G GLGL++   L 
Sbjct: 491 VEVMVRRGGAYLDIVVSDDGIGITEADLPRLGDPFFQVGGGYGRSHEGTGLGLSVVRGLA 550

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG + + S  GKGT VT+ +P
Sbjct: 551 GLHGGAVSVESAPGKGTAVTVTLP 574


>gi|171056738|ref|YP_001789087.1| histidine kinase [Leptothrix cholodnii SP-6]
 gi|170774183|gb|ACB32322.1| histidine kinase [Leptothrix cholodnii SP-6]
          Length = 508

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 138/234 (58%), Gaps = 9/234 (3%)

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E AN+ KS FLA MSHELRTPLNAI+GFSEV+ +++FGE+ + K  EY +DIH SG HLL
Sbjct: 272 EAANRNKSAFLANMSHELRTPLNAIIGFSEVLIEQMFGEV-NAKQLEYLRDIHASGHHLL 330

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FN 655
            +IN++L++SKIE  ++ +      L  +++  + L+   A +  +++   +   L  + 
Sbjct: 331 TLINDVLDLSKIEAGRMELQPSRFHLPELLDNSLTLVRERAANHGLRLTLDVQDGLGDWV 390

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIGQ 714
           AD R IK+++  +LSN++KFT   G + +R  +I      I + DTG+GI   A E+  Q
Sbjct: 391 ADPRKIKQVVVNLLSNAVKFTPAGGHVTLRARRIDAGTAEIAVIDTGVGI---APEEQAQ 447

Query: 715 PFEPLHNQYDQSI---GGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            FE         +    G GLGLA++     LHGG L++ S  G+G+     +P
Sbjct: 448 VFEEFRQAGTDPLRKSEGTGLGLALARRFVELHGGTLRVDSAPGRGSTFAFTLP 501


>gi|188579941|ref|YP_001923386.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           populi BJ001]
 gi|179343439|gb|ACB78851.1| multi-sensor signal transduction histidine kinase [Methylobacterium
           populi BJ001]
          Length = 643

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 144/264 (54%), Gaps = 12/264 (4%)

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           A   D+S  R    R   EL  A A+       AE A++ K+ FLA +SHELRTPLNAI+
Sbjct: 322 AVTRDVSEHR----RHAQELDRARAE-------AERADEVKTHFLATVSHELRTPLNAII 370

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+V+  E    L   +  EYA  I  SG+HLL+++N +L++S+I         +  D+
Sbjct: 371 GFSDVLSGEGAVSLSPERSREYAGIIAQSGRHLLDVVNTLLDISRIRGGHFDFQPEPVDV 430

Query: 623 IPIINEGIRLIGSSAQSKNIK-IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
             +I     L+   A +  I  +   +P+     AD R  +++L  ++SN++KFT   G+
Sbjct: 431 EALIRSCCDLMRLKADASGIALVSAPVPAGCALVADARACRQMLINLISNAVKFTPRGGR 490

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +   + G  + + ++D GIGI ++ L ++G PF      Y +S  G GLGL++   L 
Sbjct: 491 VEVMVRRGGAYLDVVVSDNGIGITEADLPRLGDPFFQAGGGYGRSHEGTGLGLSVVRGLA 550

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG + + S  GKGT VT+ +P
Sbjct: 551 GLHGGAVSVESAPGKGTAVTVTLP 574


>gi|254559285|ref|YP_003066380.1| Two-component sensor histidine kinase with a PAS domain
           [Methylobacterium extorquens DM4]
 gi|254266563|emb|CAX22327.1| Two-component sensor histidine kinase with a PAS domain
           [Methylobacterium extorquens DM4]
          Length = 646

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 503 ATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAIL 562
           A   D+S  R    R   EL  A A+       AE A++ K+ FLA +SHELRTPLNAI+
Sbjct: 322 AVTRDVSEHR----RHAQELDRARAE-------AERADEVKTHFLATVSHELRTPLNAII 370

Query: 563 GFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADL 622
           GFS+V+  E    L   +  EYA  I  SG+HLL+++N +L++S+I         +  D+
Sbjct: 371 GFSDVLGGEGAVSLSPERSREYAGIIAQSGRHLLDVVNTLLDISRIRGGHFDFQPEPVDV 430

Query: 623 IPIINEGIRLIGSSAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGK 681
             +I     L+   A +  I +    +P+     AD R  +++L  ++SN++KFT   G+
Sbjct: 431 EALIRGCCDLMRLKADASGITLTSAPVPAGCALVADARACRQMLINLISNAVKFTPRGGR 490

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           + +   + G  + I ++D GIGI ++ L ++G PF  +   Y +S  G GLGL++   L 
Sbjct: 491 VEVMVRRGGAYLDIVVSDDGIGITEADLPRLGDPFFQVGGGYGRSHEGTGLGLSVVRGLA 550

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG + + S  GKGT VT+ +P
Sbjct: 551 GLHGGAVSVESAPGKGTAVTVTLP 574


>gi|182678896|ref|YP_001833042.1| integral membrane sensor signal transduction histidine kinase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634779|gb|ACB95553.1| integral membrane sensor signal transduction histidine kinase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 594

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 143/250 (57%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           TEL  A     + + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+FG     
Sbjct: 270 TELEQARVNSDLARRRAEEANLAKSRFLATMSHELRTPLNAILGFSEVMKGELFGAHVIS 329

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y +Y+ DIH SGQHLL +IN IL++S+IE   + +      L  ++++   L+   A+ 
Sbjct: 330 SYKDYSNDIHASGQHLLTLINEILDLSRIEAGHLELRDDCVALAHVVDDCRHLLALKAKK 389

Query: 640 KNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           + + IE+ +  +L    AD+R ++++   +L+N++KFT   G + I+   T+  GQ V  
Sbjct: 390 RGLTIEEHVEPDLPRLRADERALRQVALNLLTNAVKFTPPGGWIKIKIGWTANGGQYV-- 447

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +I D+G GIP+  +  +   F         ++ G GLGL I   L +LH G   + S+  
Sbjct: 448 SIHDSGPGIPEEEMPIVMSSFGRGTLAQKNALEGSGLGLPIVKGLVDLHNGTFSLKSRLH 507

Query: 756 KGTIVTICMP 765
           +GT   + +P
Sbjct: 508 EGTEAIVVLP 517


>gi|209885750|ref|YP_002289607.1| histidine protein kinase DivJ [Oligotropha carboxidovorans OM5]
 gi|209873946|gb|ACI93742.1| histidine protein kinase DivJ [Oligotropha carboxidovorans OM5]
          Length = 601

 Score =  162 bits (411), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 147/259 (56%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           +S  R + ER+  E ++     ++ +  AE A  +KS FLA MSHELRTPLNAI+GFSE+
Sbjct: 316 VSVMRDVTERKAQEEAL-----EIARREAEEAGASKSRFLATMSHELRTPLNAIIGFSEM 370

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +  E   ++ + + +EYA  I+ SG HLL+++N IL+MSK+E+ K  +  +       + 
Sbjct: 371 LTHEDEMKIDAARRHEYAGLINESGLHLLSVVNGILDMSKMESGKFELVAEPFAPRETLA 430

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A+ K +++  + PS+L     D R  K+IL  +LSN+IKFT   G + +  
Sbjct: 431 SSCNLMVLKARDKGVELVLRAPSDLPQMTGDARAFKQILLNLLSNAIKFTEEGGSVTVSA 490

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G+ + + + DTGIGI K  L  +G+ F      Y     G GLGL+I   L  LHGG
Sbjct: 491 EVAGRELALRVTDTGIGIGKDDLAHLGKAFFQAGASYHGRREGTGLGLSIVKNLVALHGG 550

Query: 747 RLKIISQEGKGTIVTICMP 765
            +++ S+   GT V++ +P
Sbjct: 551 EMRVDSEIDCGTTVSVRLP 569


>gi|315121866|ref|YP_004062355.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495268|gb|ADR51867.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 498

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 145/247 (58%), Gaps = 2/247 (0%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL +A +     ++RAE AN  KS FLA MSHELRTPLNAILGFSEVI  E  G L +  
Sbjct: 227 ELEVAKSLSDKTRQRAEEANLAKSRFLASMSHELRTPLNAILGFSEVIGLETMGPLNNET 286

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY  DIH SGQHLLN+IN IL++S+IE  +  + +    LI I++E + ++   AQ K
Sbjct: 287 YKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIMHECMIMLQLRAQEK 346

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIA 698
            I+I ++I P+     AD++ +++++  +LSN++KFT+  GK+ ++     G    I+I 
Sbjct: 347 YIEIFQQIDPTLSSVWADEKGMRQVILNLLSNAVKFTSIGGKVRVKVGWTAGGGQYISIK 406

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           D G GI +  +  +   F         +  G GLGL I  ++   HGG+ +I S+  +G 
Sbjct: 407 DNGPGISEGEMPTVLSSFGQGSIAIKSAEQGVGLGLPIVQSIMANHGGQFRIKSKLQEGV 466

Query: 759 IVTICMP 765
            V   +P
Sbjct: 467 EVIAILP 473


>gi|306844607|ref|ZP_07477194.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp.
            BO1]
 gi|306275051|gb|EFM56814.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp.
            BO1]
          Length = 1036

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 771  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 825

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 826  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 885

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 886  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 945

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 946  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1005

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1006 EANRAQFAIDSNPGQGTVVEIVFP 1029


>gi|154253913|ref|YP_001414737.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154157863|gb|ABS65080.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 704

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 152/268 (56%), Gaps = 24/268 (8%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L  +  +LE +  EL+ A          AE A+  KSEFLA MSHELRTPLNAI+GFSE 
Sbjct: 437 LRDANAVLEARADELTRALMA-------AEQASLAKSEFLATMSHELRTPLNAIIGFSET 489

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +K E+FG LG  KY EYA+DI+ SG HLL+++++IL++S++E+   +++++   +  +  
Sbjct: 490 MKLEVFGPLGHGKYAEYAKDINNSGTHLLDLVSDILDISRVESGTDALNEEEVCIESVAR 549

Query: 628 EGIRLIGSSAQSKNI----KIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
             +    + A    +      +  +P      AD+R I++IL  ++ N+IKF    G + 
Sbjct: 550 AVLAATAAQAGKAEVVCRLDADAGLPPVF---ADERKIRQILTNLVGNAIKFNVPGGTVA 606

Query: 684 IRTSKIGQCVIITIADTGIG-----IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
           +  ++      I +ADTGIG     IPK AL + GQ    L +Q+ +   G GLGL I  
Sbjct: 607 VTLARDESGYRIAVADTGIGIVAEDIPK-ALARFGQ----LEDQFRRKYEGLGLGLPIVQ 661

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            LT  HGG   I S  G+GT VTI +P+
Sbjct: 662 VLTEQHGGHFAIESTPGRGTTVTITLPR 689


>gi|75910897|ref|YP_325193.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
 gi|75704622|gb|ABA24298.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC 29413]
          Length = 1274

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 154/266 (57%), Gaps = 15/266 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKT--KSEFLAKMSHELRTPLNAILGFSEVIK 569
            +++ ERQ+ EL +  +  Q+     E A  T  K EFLA MSHELRTPLNAILG +E ++
Sbjct: 854  QELAERQQAELKLTQSNQQLAISNQELARATRLKDEFLANMSHELRTPLNAILGMTEGLQ 913

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            + +FG +   K ++  + I  S  HLL++IN+IL+++KIE  +I +D     +  +    
Sbjct: 914  EGVFGMIND-KQFKALETIERSSSHLLDLINDILDVAKIEAGQIKLDCTAISVAALCQSS 972

Query: 630  IRLIGSSAQSKNIKIEKKIP---SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            +  I   A  K I++E KIP    +LF   D+R I+++L  +L+N++KFT   G++ +  
Sbjct: 973  LVFIKQQALQKRIQVEIKIPLNLPDLF--VDERRIRQVLINLLNNAVKFTPETGRISLEV 1030

Query: 687  SKIGQCVI-------ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
            +++   +        I + DTGIGI +  + K+ QPF  + +  ++   G GLGLA+   
Sbjct: 1031 TQVSPDISTVQNFLQIAVIDTGIGIMQENINKLFQPFIQIDSALNRQYEGTGLGLALVKK 1090

Query: 740  LTNLHGGRLKIISQEGKGTIVTICMP 765
            +  LHGGR+ + S+ G G+  TI +P
Sbjct: 1091 IVELHGGRVGLTSELGVGSCFTIELP 1116


>gi|319784578|ref|YP_004144054.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170466|gb|ADV14004.1| ATP-binding region ATPase domain protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 577

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 135/224 (60%), Gaps = 1/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K  FLA +SHELRTPLNAI+GFS+++  E+FG     +  EY   +  SGQHLL ++ +I
Sbjct: 320 KGRFLAVVSHELRTPLNAIIGFSDMLLHEMFGAFKDPRQKEYVGLVRDSGQHLLAVVTSI 379

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRII 661
           L++S+IE+   + + +       ++    ++   AQ+KNI ++ +I P     NAD+R +
Sbjct: 380 LDVSRIESGVYATEPEPFRFAEAVDMCQSMMQLQAQAKNIDLQAQIAPDAGDINADQRAV 439

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           +++L  ++SN+IKFT + G +++   +IG  +   + DTGIGI +     +G+PF  + N
Sbjct: 440 QQMLINLVSNAIKFTPDGGDVVVGAKRIGSRLHFWVRDTGIGIAEEDFANLGKPFMQIQN 499

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGL++   L  LH G + I S  G+GT VTI +P
Sbjct: 500 DYTRRFEGTGLGLSLVKGLVALHEGTMSIESMPGEGTTVTISLP 543


>gi|256061652|ref|ZP_05451791.1| sensory box histidine kinase [Brucella neotomae 5K33]
 gi|261325661|ref|ZP_05964858.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            neotomae 5K33]
 gi|261301641|gb|EEY05138.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            neotomae 5K33]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|254694275|ref|ZP_05156103.1| sensory box histidine kinase [Brucella abortus bv. 3 str. Tulya]
 gi|261214583|ref|ZP_05928864.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 3 str. Tulya]
 gi|260916190|gb|EEX83051.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 3 str. Tulya]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|254689786|ref|ZP_05153040.1| sensory box histidine kinase [Brucella abortus bv. 6 str. 870]
 gi|256258039|ref|ZP_05463575.1| sensory box histidine kinase [Brucella abortus bv. 9 str. C68]
 gi|260755316|ref|ZP_05867664.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 6 str. 870]
 gi|260884335|ref|ZP_05895949.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 9 str. C68]
 gi|297248868|ref|ZP_06932586.1| cell-division control histidine kinase pdhS [Brucella abortus bv. 5
            str. B3196]
 gi|260675424|gb|EEX62245.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 6 str. 870]
 gi|260873863|gb|EEX80932.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 9 str. C68]
 gi|297176037|gb|EFH35384.1| cell-division control histidine kinase pdhS [Brucella abortus bv. 5
            str. B3196]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|225628039|ref|ZP_03786075.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
 gi|254702323|ref|ZP_05164151.1| sensory box histidine kinase [Brucella suis bv. 5 str. 513]
 gi|254710637|ref|ZP_05172448.1| sensory box histidine kinase [Brucella pinnipedialis B2/94]
 gi|256032130|ref|ZP_05445744.1| sensory box histidine kinase [Brucella pinnipedialis M292/94/1]
 gi|256160326|ref|ZP_05458020.1| sensory box histidine kinase [Brucella ceti M490/95/1]
 gi|256255531|ref|ZP_05461067.1| sensory box histidine kinase [Brucella ceti B1/94]
 gi|256370019|ref|YP_003107530.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260169265|ref|ZP_05756076.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|261222740|ref|ZP_05937021.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            B1/94]
 gi|261318208|ref|ZP_05957405.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis B2/94]
 gi|261752887|ref|ZP_05996596.1| PAS/PAC sensor signal transduction histidine kinase [Brucella suis
            bv. 5 str. 513]
 gi|261758777|ref|ZP_06002486.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|265989241|ref|ZP_06101798.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis M292/94/1]
 gi|265998702|ref|ZP_06111259.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M490/95/1]
 gi|225617202|gb|EEH14248.1| PAS domain S-box-containing protein [Brucella ceti str. Cudo]
 gi|256000182|gb|ACU48581.1| sensory box histidine kinase [Brucella microti CCM 4915]
 gi|260921324|gb|EEX87977.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            B1/94]
 gi|261297431|gb|EEY00928.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis B2/94]
 gi|261738761|gb|EEY26757.1| sensory box histidine kinase [Brucella sp. F5/99]
 gi|261742640|gb|EEY30566.1| PAS/PAC sensor signal transduction histidine kinase [Brucella suis
            bv. 5 str. 513]
 gi|262553326|gb|EEZ09160.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M490/95/1]
 gi|264661438|gb|EEZ31699.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis M292/94/1]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|254714821|ref|ZP_05176632.1| sensory box histidine kinase [Brucella ceti M644/93/1]
 gi|254717879|ref|ZP_05179690.1| sensory box histidine kinase [Brucella ceti M13/05/1]
 gi|261219725|ref|ZP_05934006.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M13/05/1]
 gi|261322615|ref|ZP_05961812.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M644/93/1]
 gi|260924814|gb|EEX91382.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M13/05/1]
 gi|261295305|gb|EEX98801.1| PAS/PAC sensor signal transduction histidine kinase [Brucella ceti
            M644/93/1]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|150396809|ref|YP_001327276.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium medicae WSM419]
 gi|150028324|gb|ABR60441.1| integral membrane sensor signal transduction histidine kinase
           [Sinorhizobium medicae WSM419]
          Length = 511

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/253 (38%), Positives = 145/253 (57%), Gaps = 12/253 (4%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSTEVLGPLSNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY  DIH SG+HLLN+IN IL++S+IE  K  + +   +L  I+ + I ++   A+S
Sbjct: 299 TYKEYTLDIHRSGEHLLNLINEILDLSRIEAGKYELSEDAVNLAEIVEDCIGMVQLRARS 358

Query: 640 KNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQC 692
           KNI I    E+ +PS     AD++ ++++   +LSN++KFT + G++ ++   T+  GQ 
Sbjct: 359 KNITIGQQFEQAMPS---VWADEKAMRQVTLNLLSNAVKFTPSGGEVSVKVGWTAGGGQ- 414

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
             ++I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S
Sbjct: 415 -YLSIRDNGPGIPEEEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHNGQFILRS 473

Query: 753 QEGKGTIVTICMP 765
           +   GT     +P
Sbjct: 474 KLRVGTEAIAILP 486


>gi|17986700|ref|NP_539334.1| non-motile and phage-resistance protein [Brucella melitensis bv. 1
           str. 16M]
 gi|17982322|gb|AAL51598.1| non-motile and phage-resistance protein [Brucella melitensis bv. 1
           str. 16M]
          Length = 813

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 548 RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 602

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 603 KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 662

Query: 632 LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
           L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 663 LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 722

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
              V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 723 NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 782

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
             +  +  I S  G+GT+V I  P
Sbjct: 783 EANRAQFAIDSNPGQGTVVEIVFP 806


>gi|225853078|ref|YP_002733311.1| PAS domain S-box-containing protein [Brucella melitensis ATCC 23457]
 gi|256045221|ref|ZP_05448119.1| PAS domain S-box-containing protein [Brucella melitensis bv. 1 str.
            Rev.1]
 gi|256114174|ref|ZP_05454928.1| PAS domain S-box-containing protein [Brucella melitensis bv. 3 str.
            Ether]
 gi|256263438|ref|ZP_05465970.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565182|ref|ZP_05835666.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|265991654|ref|ZP_06104211.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            melitensis bv. 1 str. Rev.1]
 gi|265995492|ref|ZP_06108049.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            melitensis bv. 3 str. Ether]
 gi|223635641|sp|Q8YIM6|PDHS_BRUME RecName: Full=Cell-division control histidine kinase pdhS
 gi|225641443|gb|ACO01357.1| PAS domain S-box-containing protein [Brucella melitensis ATCC 23457]
 gi|260151250|gb|EEW86344.1| sensory box histidine kinase [Brucella melitensis bv. 1 str. 16M]
 gi|262766605|gb|EEZ12394.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            melitensis bv. 3 str. Ether]
 gi|263002438|gb|EEZ15013.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            melitensis bv. 1 str. Rev.1]
 gi|263093447|gb|EEZ17497.1| sensory box histidine kinase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409621|gb|ADZ66686.1| PAS domain S-box-containing protein [Brucella melitensis M28]
 gi|326539324|gb|ADZ87539.1| PAS domain S-box-containing protein [Brucella melitensis M5-90]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|163843854|ref|YP_001628258.1| PAS domain-containing protein [Brucella suis ATCC 23445]
 gi|223635611|sp|B0CI82|PDHS_BRUSI RecName: Full=Cell-division control histidine kinase pdhS
 gi|163674577|gb|ABY38688.1| PAS domain S-box [Brucella suis ATCC 23445]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALEGRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|62290486|ref|YP_222279.1| sensory box histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82700409|ref|YP_414983.1| PAS/histidine kinase/ATPase domain-containing protein [Brucella
            melitensis biovar Abortus 2308]
 gi|189024711|ref|YP_001935479.1| sensory box histidine kinase [Brucella abortus S19]
 gi|237815994|ref|ZP_04594991.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
 gi|254697930|ref|ZP_05159758.1| sensory box histidine kinase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254730820|ref|ZP_05189398.1| sensory box histidine kinase [Brucella abortus bv. 4 str. 292]
 gi|260547015|ref|ZP_05822754.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
 gi|260758539|ref|ZP_05870887.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 4 str. 292]
 gi|260762362|ref|ZP_05874705.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 2 str. 86/8/59]
 gi|75496411|sp|Q57BR6|PDHS_BRUAB RecName: Full=Cell-division control histidine kinase pdhS; AltName:
            Full=PleC-divJ homolog sensor
 gi|123768481|sp|Q2YRB4|PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase pdhS
 gi|223635608|sp|B2S758|PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase pdhS
 gi|62196618|gb|AAX74918.1| sensory box histidine kinase [Brucella abortus bv. 1 str. 9-941]
 gi|82616510|emb|CAJ11577.1| PAS domain:ATP-binding region, ATPase-like:Histidine kinase A,
            N-terminal:Bacterial sensor protein, C-terminal:Histidine
            kinase [Brucella melitensis biovar Abortus 2308]
 gi|189020283|gb|ACD73005.1| sensory box histidine kinase [Brucella abortus S19]
 gi|237789292|gb|EEP63503.1| PAS domain S-box-containing protein [Brucella abortus str. 2308 A]
 gi|260096065|gb|EEW79942.1| sensory box histidine kinase [Brucella abortus NCTC 8038]
 gi|260668857|gb|EEX55797.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 4 str. 292]
 gi|260672794|gb|EEX59615.1| PAS/PAC sensor signal transduction histidine kinase [Brucella abortus
            bv. 2 str. 86/8/59]
          Length = 1035

 Score =  162 bits (410), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|23502469|ref|NP_698596.1| sensory box histidine kinase [Brucella suis 1330]
 gi|81752215|sp|Q8FZ86|PDHS_BRUSU RecName: Full=Cell-division control histidine kinase pdhS
 gi|23348461|gb|AAN30511.1| sensory box histidine kinase [Brucella suis 1330]
          Length = 1035

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALEGRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|309791480|ref|ZP_07685984.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides
           DG6]
 gi|308226477|gb|EFO80201.1| multi-sensor hybrid histidine kinase [Oscillochloris trichoides
           DG6]
          Length = 690

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 202/406 (49%), Gaps = 59/406 (14%)

Query: 378 AEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP---------DHVLVPGNAR 428
           AE ++ L   ++   +A+++ D ++ +++ NA  ++ +G P           ++   +A 
Sbjct: 187 AERERLLHLMLDAAPDAMLIADGDEHVLVWNAAAERMFGYPAAEALGLPITRLIAARDAH 246

Query: 429 ---SIIQDAQTRPIIEYRTSDPERSQDMSK---EIKLADSRWLQINEWCTHDGGTISVGT 482
              S+I D +  P ++       R +D S+   E  LA  R LQ  E+ T       V  
Sbjct: 247 TYFSLIADQRQGPTLDATIEVHARRRDGSEFPSEFGLAAWRSLQ-GEYFT------CVVR 299

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
           D+T  + NQA LR        TI              TEL              E   + 
Sbjct: 300 DVTERQQNQAALR--------TIE-----------ASTEL--------------ERVAQL 326

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K+EFLA MSHELRTPLN IL  +E + + ++G L   +  +    +  SGQHLL ++N+I
Sbjct: 327 KNEFLANMSHELRTPLNTILSLTEAVSEGVYGLLND-RQQQVLDVVTESGQHLLGIVNDI 385

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRII 661
           L+M KIE  KI +  +  ++  I    +R++   A +K I+I  +I  ++    AD R +
Sbjct: 386 LDMIKIEAGKIELLIEPVEIESICAASMRMVRQIAYAKRIQIASQIDHQVDLIEADPRRL 445

Query: 662 KKILFPILSNSIKFTNNNGK--MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           K+IL  +LSN++KFT   G+  +++R     Q V +++ DTGIGI  + L ++ +PF  L
Sbjct: 446 KQILVNLLSNAVKFTPEGGRVTLVVRGDAEAQLVYLSVEDTGIGIAHTDLPRLFRPFVQL 505

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             +  +   G GLGLA+   LT LH G ++I S  G G+  TI +P
Sbjct: 506 DARLSRRHEGTGLGLALVAHLTELHNGGVRIQSTPGTGSCFTIMLP 551


>gi|209523774|ref|ZP_03272327.1| PAS/PAC sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209495806|gb|EDZ96108.1| PAS/PAC sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 885

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 130/435 (29%), Positives = 225/435 (51%), Gaps = 51/435 (11%)

Query: 338 SGADIWIQV-RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK-AIECTSEAL 395
            G  IW+ V R  M+ +    + I+G+  D+TE   ++++      RL++ +I+ + + +
Sbjct: 237 GGRRIWLDVSRIPMLDSQGNVLGILGVLEDITESKEIDEKL-----RLTQFSIDKSRDYV 291

Query: 396 VLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           +  D N R    N    +  G     L+      I  D    P     + D  R Q    
Sbjct: 292 LFSDINGRFFYVNEAACQILGYSKEELLTMEVGDI--DPLASPGGWSISWDDLRDQ---G 346

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
                 + +       T  G  I+V   ++ L++N  +               +  R I 
Sbjct: 347 SFTFESTHY-------TKTGQAIAVEITLSHLEYNHREY------------GCAVVRDIR 387

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF-- 573
           +R++TE+++  AK     E AETA++ KSEFLA+MSHELRTPLNAILGF++++++E++  
Sbjct: 388 DRKQTEIALQQAK-----EAAETASRAKSEFLARMSHELRTPLNAILGFTQLMERELYHN 442

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
             +    + E+ + I  SG+HLL +IN++LEMSKIE  ++S++  N +LI ++N    ++
Sbjct: 443 PNIPLFDHKEHLEIIGRSGEHLLELINDVLEMSKIEAGRVSLNPTNFNLISLLNSLREML 502

Query: 634 GSSAQSK----NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM-IRTSK 688
              A SK    +  I+ +IP+ ++  AD++ +++ L  +L N+IKFT   G ++ ++  K
Sbjct: 503 ELPASSKKLTLDFAIDDQIPTYIY--ADEQKLRQCLINLLGNAIKFTVKGGVILRVKLGK 560

Query: 689 ----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
                GQ +   + DTG GI  S ++ + +PF       + S  G GLGL+I+     L 
Sbjct: 561 FNHDFGQ-LWFEVEDTGPGIDPSEMDLLFEPFSQTETGRN-SQQGTGLGLSITQKFIGLM 618

Query: 745 GGRLKIISQEGKGTI 759
           GG +++ S+ GKGTI
Sbjct: 619 GGEIQVSSERGKGTI 633


>gi|306843027|ref|ZP_07475653.1| PAS domain S-box-containing protein [Brucella sp. BO2]
 gi|306286784|gb|EFM58327.1| PAS domain S-box-containing protein [Brucella sp. BO2]
          Length = 1038

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 773  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 827

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 828  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 887

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 888  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 947

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 948  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1007

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1008 EANRAQFAIDSNPGQGTVVEIVFP 1031


>gi|163759717|ref|ZP_02166802.1| probable two-component sensor histidine kinase protein [Hoeflea
           phototrophica DFL-43]
 gi|162283314|gb|EDQ33600.1| probable two-component sensor histidine kinase protein [Hoeflea
           phototrophica DFL-43]
          Length = 510

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 144/251 (57%), Gaps = 6/251 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE +N  KS FLA MSHELRTPLNAILGFSEV+  E+ G +G+ 
Sbjct: 238 AELEVAKSVSDEARRRAEESNLAKSRFLASMSHELRTPLNAILGFSEVMSGEVLGPVGNE 297

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY  DIH SGQHLLN+IN IL++S+IE  +  +++    L  I  + I LI   A+S
Sbjct: 298 SYKEYVGDIHRSGQHLLNLINEILDLSRIEAGRYDLNESALALSDIAQDCIGLIQLKARS 357

Query: 640 KNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           K+I I +    +L    AD++ I++++  +LSN++KFT + G++ ++   T+  GQ   I
Sbjct: 358 KSITINEAFEEDLPMVWADEKSIRQVVLNLLSNAVKFTPSGGEIRVKLGWTAGGGQ--YI 415

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            I D G GI +  +  +   F         +  G GLGL I  A+   HGG   + S+  
Sbjct: 416 AIKDNGPGIAEEEIPVVLSAFGQGSVAIKSAEQGTGLGLPIVQAILAKHGGEFVLKSKLR 475

Query: 756 KGTIVTICMPQ 766
           +GT     +P+
Sbjct: 476 EGTEGIAILPR 486


>gi|153010009|ref|YP_001371224.1| integral membrane sensor signal transduction histidine kinase
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561897|gb|ABS15395.1| integral membrane sensor signal transduction histidine kinase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 614

 Score =  162 bits (409), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 151/261 (57%), Gaps = 10/261 (3%)

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
             R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++ 
Sbjct: 301 VGRSLEGEQKLLDEIATLKAELESERI-----GKGRLLAAVSHELRTPLNSIIGFSDMLS 355

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            E+ G+L + K  EYA  IH SG +LL ++N +L+ S++ET   SID QN          
Sbjct: 356 HEMGGKLANEKQREYAGLIHQSGHYLLELVNAVLDNSRLETGNYSIDPQNFAFRDAAEMC 415

Query: 630 IRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
             ++   A+ K +    ++ + +    AD+R I++IL  + SN++KFT + G + I  ++
Sbjct: 416 TSVMLPQAEKKGVAFCHRVGAGIGELVADRRAIQQILLNLASNAVKFTQSGGCVTIDATR 475

Query: 689 I---GQCVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           +   G+ ++ I+++DTGIGI    +++IG PF    N Y ++  G GLGL++   L  LH
Sbjct: 476 VMASGRAMLEISVSDTGIGIEPEDMQRIGTPFVRADNNYTRAQEGSGLGLSVVKGLVELH 535

Query: 745 GGRLKIISQEGKGTIVTICMP 765
            G +++ S  G+GTIVTI +P
Sbjct: 536 QGSMQLKSCPGEGTIVTIRLP 556


>gi|163793169|ref|ZP_02187145.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
 gi|159181815|gb|EDP66327.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
          Length = 430

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 141/242 (58%), Gaps = 4/242 (1%)

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
           A     +E AE A + K E  A + HELRTPLNAI+GF++ +  E++G LG+ +Y +YA+
Sbjct: 177 ADLSAVREGAEMAERLKRESFANLGHELRTPLNAIIGFAQSLDAELWGPLGNPRYRDYAK 236

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            I  SGQHL  +I +IL++S+ +   + +D+   D+   +    +++G SA S  + +  
Sbjct: 237 AIADSGQHLYVLIQDILDLSRHDAGILELDETTVDVAAAVRTCRKMLGGSAASNGVSLAT 296

Query: 647 KIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI--GQCVIITIADTGIG 703
            +P E L+   D   +++I+  + +N+I+FT   G++ I   ++  G+   + + DTGIG
Sbjct: 297 TVPDEGLWVTGDSTKLRQIVINLAANAIRFTPAGGRVTIAACRLESGETE-LRVEDTGIG 355

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           +    + +  +PF  +     +  GG GLGL +S  LT LHGG L+I S+ G GT+V I 
Sbjct: 356 LDPEDIPRALEPFVQVSRDRARESGGAGLGLPLSKRLTELHGGVLEIHSRRGTGTVVRIV 415

Query: 764 MP 765
           +P
Sbjct: 416 LP 417


>gi|75909154|ref|YP_323450.1| multi-sensor signal transduction histidine kinase [Anabaena
           variabilis ATCC 29413]
 gi|75702879|gb|ABA22555.1| multi-sensor signal transduction histidine kinase [Anabaena
           variabilis ATCC 29413]
          Length = 573

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 155/253 (61%), Gaps = 8/253 (3%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I +R++TE+     K +  +  AE  ++ KSEFLA MSHELRTPLNAI+G S+++++EI 
Sbjct: 324 ITDRKQTEM-----KLRASQAAAEAGSRAKSEFLATMSHELRTPLNAIMGLSQLLQQEIV 378

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L   K  EY   I+ SG+HLL +IN+IL++SK+E  K  +      +I + N+ +  +
Sbjct: 379 GSLNE-KQQEYISCIYSSGEHLLALINDILDLSKVEAGKEELFLIPLLVIDVCNDVLLTV 437

Query: 634 GSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              A SK +K+ ++I P      AD R IK++L  +L+N+IKFT + G++ +   ++ + 
Sbjct: 438 RDRAISKGLKLTQEIDPEASICIADDRRIKQMLLNLLTNAIKFT-SVGEVSLTVKRVPEG 496

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           +   I+DTGIGI  +    + +PF+ L ++ ++   G GLGLA++  L  LHGG + + S
Sbjct: 497 INFIISDTGIGIDSNQFPLLFEPFKQLDSRLNRQYEGTGLGLALTRKLARLHGGDVTVTS 556

Query: 753 QEGKGTIVTICMP 765
             G G+  T+ +P
Sbjct: 557 TVGVGSQFTLFLP 569


>gi|83312147|ref|YP_422411.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82946988|dbj|BAE51852.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 454

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 139/256 (54%), Gaps = 6/256 (2%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R I +R++ E ++  AK +     AE AN+ KS+FLA +SHELRTPLNA++GFSE I  
Sbjct: 198 GRDITQRKRAEAALVAAKQE-----AEAANRAKSQFLATVSHELRTPLNAVIGFSEAILA 252

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
              G     +  EY   IH +GQHL  +I +IL++S+IE  +  +D++ AD   ++    
Sbjct: 253 GATGPASLERCVEYMDLIHSAGQHLRALIEDILDVSRIEAGRTELDEEEADPAELVRAAA 312

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           RL+   A    +     I  +L     D R I+++L  +  N++KFT   G++ I    +
Sbjct: 313 RLLEHKAVVTGVDFTVVIAPDLPRMRLDPRRIRQVLLNLAGNALKFTPAGGRVGISAEHV 372

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
            + + +T+ DTGIGI      K+ Q F    +   +   G GLGLAI       HGG + 
Sbjct: 373 PEGLALTVEDTGIGIAPEHHAKVWQAFYQADSSLSRRHQGSGLGLAIVRHFVEAHGGTVS 432

Query: 750 IISQEGKGTIVTICMP 765
           + S+ GKGT +T+ +P
Sbjct: 433 LASEAGKGTRITVLLP 448


>gi|17228038|ref|NP_484586.1| two-component sensor histidine kinase [Nostoc sp. PCC 7120]
 gi|17129887|dbj|BAB72500.1| two-component sensor histidine kinase [Nostoc sp. PCC 7120]
          Length = 573

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/253 (37%), Positives = 155/253 (61%), Gaps = 8/253 (3%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I ER++TE+     K +  +  AE  ++ KSEFLA MSHELRTPLNAI+G S+++++EI 
Sbjct: 324 ITERKQTEM-----KLRASQAAAEAGSRAKSEFLATMSHELRTPLNAIMGLSQLLQQEIV 378

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L   K  EY   I+ SG+HLL +IN+IL++SK+E  K  +      +I + N+ +  +
Sbjct: 379 GSLNE-KQQEYINCIYSSGEHLLALINDILDLSKVEAGKEELFLIPLLVIDVCNDVLLTV 437

Query: 634 GSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC 692
              A SK +K+ ++I P      AD R IK++L  +L+N+IKFT + G++ +   ++ + 
Sbjct: 438 RDRAISKGLKLTQEIDPEANICIADDRRIKQMLLNLLTNAIKFT-SVGEVSLIVKRVPEG 496

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           +   I+DTGIGI  +    + +PF+ L ++ ++   G GLGLA++  L  LHGG + + S
Sbjct: 497 INFIISDTGIGIDSNQFPLLFEPFKQLDSRLNRQYEGTGLGLALTRKLARLHGGDVTVTS 556

Query: 753 QEGKGTIVTICMP 765
             G G+  T+ +P
Sbjct: 557 TVGVGSQFTLFLP 569


>gi|149174355|ref|ZP_01852982.1| multi-sensor hybrid histidine kinase [Planctomyces maris DSM 8797]
 gi|148846900|gb|EDL61236.1| multi-sensor hybrid histidine kinase [Planctomyces maris DSM 8797]
          Length = 1102

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 154/579 (26%), Positives = 255/579 (44%), Gaps = 91/579 (15%)

Query: 223 SIISALLLFILFSYYRQAKKNKENDTILLEANICVET---ALSRGRCGLWNFNFDNKKFH 279
           +I+S + +F L  +  +A K      +  E     E    AL  G+ G+W +N       
Sbjct: 153 AIVSWITVFALIRFVPEALKLPSTALLAQELQRSKERLDFALDAGQIGVWEWNLKTDTLL 212

Query: 280 LSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMR---- 335
             R   +I  I  E + L      + +H +++        VT     QL+Q    R    
Sbjct: 213 WDRRTRQIFNIDPEVRDLYLTDFTQCLHPEDRN------EVT----NQLEQCIQTRTPYN 262

Query: 336 ------HASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
                 H+ G+  ++  + +      G     IG+  D T+K   E   AE++       
Sbjct: 263 SKFRVVHSDGSIRYVHAQGRAFLGNDGEPEQYIGVCHDFTDKQLQEDALAESELNFRSTF 322

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ------DAQTRPIIEY 442
           E                      Q A G+  HV + G    + Q      D Q   ++E 
Sbjct: 323 E----------------------QVAMGIA-HVALDGRWLRVNQRLCEIFDYQAEELLEL 359

Query: 443 RTSDPERSQDMSKEIKLADSRWLQINE---------WCTHDGGTISVGTDITLLKHNQAQ 493
           R  D     ++  EI L + + +Q  E         +   DG +I     ++L++H   Q
Sbjct: 360 RIHDLSHPDEL--EIVLKNMQRMQAGEIKSYSIEKRYLRKDGSSIWTNLMVSLVRH---Q 414

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
             E K  +    N       I  R++TE  +  AK       AE A++TKSEFLA MSHE
Sbjct: 415 SGEPKHFIFGIKN-------IQRRKETEQKLKAAKLT-----AEEASQTKSEFLANMSHE 462

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLN ++G +E+++    G   +    E+      SG+ LLN+IN+IL+ SKIE  K+
Sbjct: 463 LRTPLNGVIGMTELLQ----GTHLNQHQQEFVDACRSSGESLLNLINDILDFSKIEAGKL 518

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE--LFFNADKRIIKKILFPILSN 671
            +D    DL  ++ + +  +      KN+++   +  E  L    D   +++IL  ++ N
Sbjct: 519 DLDLHEFDLENVLMDTVSTLVWRTNEKNLELPCFVDPESRLTLKGDSYRLRQILVNLIGN 578

Query: 672 SIKFTNNNGKMMIRTSKIGQ-----CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
           +IKFT++ G++++RT  + +      +  ++ DTGIGI +S + ++ Q F  +     ++
Sbjct: 579 AIKFTDS-GEVVVRTRTVSRENGNIRIHFSVTDTGIGISESKINRLFQSFSQVDASTTRN 637

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GG GLGL IS  L  L GGR+ I SQ+G G+     +P
Sbjct: 638 YGGTGLGLVISQNLVELMGGRIGIESQDGVGSTFWFEIP 676


>gi|298290623|ref|YP_003692562.1| PAS/PAC sensor signal transduction histidine kinase [Starkeya
           novella DSM 506]
 gi|296927134|gb|ADH87943.1| PAS/PAC sensor signal transduction histidine kinase [Starkeya
           novella DSM 506]
          Length = 874

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/256 (36%), Positives = 153/256 (59%), Gaps = 7/256 (2%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R I + +K E  +  AK+  E+     AN  KS+FLAK+SHE+RTPLNAI+GFSEV+ +E
Sbjct: 617 RDITQWKKAEEELTEAKHLAER-----ANLAKSDFLAKISHEIRTPLNAIIGFSEVMMEE 671

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG + + +Y +Y +DIH SG+HL+++IN++L++SKIE  K+ +   +  L  I+ + + 
Sbjct: 672 RFGAIENQRYRDYLRDIHSSGEHLISLINDLLDLSKIEAGKLDLAFTSVALNEIVQQCMA 731

Query: 632 LIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           ++   A  + I +   + ++L    AD R I++I+  ++SNS+KFT   G++++ T+   
Sbjct: 732 IMQPQANRERIVVRSSLATDLPPVVADARSIRQIVLNLVSNSVKFTQPGGQVILSTTLTE 791

Query: 691 QC-VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
           Q  V++ + DTGIG+ ++ +    +PF  +        GG GLGL ++ AL   +     
Sbjct: 792 QGEVVLRVRDTGIGMSEADIAIAMEPFRQIATSGRAGSGGTGLGLPLTKALAEANRASFN 851

Query: 750 IISQEGKGTIVTICMP 765
           I S    GTIV I  P
Sbjct: 852 IRSAVDVGTIVEITFP 867


>gi|254719631|ref|ZP_05181442.1| sensory box histidine kinase [Brucella sp. 83/13]
 gi|265984641|ref|ZP_06097376.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp.
            83/13]
 gi|306837734|ref|ZP_07470602.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp. NF
            2653]
 gi|264663233|gb|EEZ33494.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp.
            83/13]
 gi|306407190|gb|EFM63401.1| PAS/PAC sensor signal transduction histidine kinase [Brucella sp. NF
            2653]
          Length = 1036

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 158/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ + E+    T+N+ K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 771  RDITQWKRTEEELTNARKEAER----TSNQ-KTEFLARISHEIRTPLNAIIGFSELMADE 825

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 826  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 885

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 886  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 945

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 946  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1005

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1006 EANRAQFAIDSNPGQGTVVEIVFP 1029


>gi|20092217|ref|NP_618292.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19917449|gb|AAM06772.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 761

 Score =  161 bits (408), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 156/257 (60%), Gaps = 11/257 (4%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R I  R+K E ++ NAK       AE AN+TKSEFL  MSHEL+TPLN+I+GFS+++K+E
Sbjct: 498 RDITVRKKAEEALINAKTA-----AEVANRTKSEFLTNMSHELKTPLNSIIGFSDLLKEE 552

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET--EKISIDKQNADLIPIINEG 629
           I G L   K   Y Q I  SG++LL +IN+IL++SK E+  E ++++K + D    IN+ 
Sbjct: 553 IAGPLNE-KQSRYVQFISSSGKNLLEIINDILDLSKAESGEEDLNVEKFSVD--ESINKV 609

Query: 630 IRLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
           I ++   AQ KNI +  +  +  L+  AD+   ++I+  +LSN+IKFT   G + +   +
Sbjct: 610 ISVVLPQAQEKNIILNYQSENRTLWITADEGKFRQIMENLLSNAIKFTPAGGSIDVTLKQ 669

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
            G  V I + DTGIGIP+ + EKI +PF  + +   ++  G GLGL +      +HGG +
Sbjct: 670 EGLLVTIEVKDTGIGIPEDSFEKIFKPFIQIDSSLSRNFEGTGLGLTLVKKYVEMHGGNI 729

Query: 749 KIISQEGKGTIVTICMP 765
            + S+ G+G+     +P
Sbjct: 730 YVESKIGEGSSFRFELP 746


>gi|20090015|ref|NP_616090.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19914982|gb|AAM04570.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 849

 Score =  161 bits (408), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 166/299 (55%), Gaps = 16/299 (5%)

Query: 483 DITLLKHNQAQLRESKRRL-KATINDLSTSRQILERQKTELSI-------------ANAK 528
           DI LLKH + ++ E+  +    +I+ +  ++ +      E S+             A  K
Sbjct: 517 DIELLKHKKTRVYETSIKFADGSIHQIMFNKLVFSGVTEEDSMLLGIMIDITEHKQAEEK 576

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
               K  AE AN+ K  F+  MSHELRTPLNA++GFS+++  E  G L   K   Y ++I
Sbjct: 577 MLQAKMAAEAANRAKINFIVNMSHELRTPLNAVIGFSDLLLSETAGPLNE-KQKRYTENI 635

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
             SG HLL++IN++L++S++E   I +  +  D+  +I E  R++ S +  KNI+IE K+
Sbjct: 636 SKSGSHLLDVINDVLDISRLELGNIELYYETVDIPGVIEEVRRVLSSLSAEKNIRIEYKV 695

Query: 649 PSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
              L   + D+   K+IL+ +L+N+IKF++ +GK+ I+    G  V I++ D GIGI ++
Sbjct: 696 EQGLKTIDVDRVKFKQILYNLLNNAIKFSSEDGKVNIKARSEGDMVEISVKDEGIGINEA 755

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
              ++  PF  +     +  GG GLGLA+      LHGG++ + +  GKG+  T  +P+
Sbjct: 756 DYARVFLPFVQIDESISRKHGGVGLGLALVKRFVELHGGQVWVEASPGKGSTFTFRIPK 814


>gi|46202643|ref|ZP_00052865.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 848

 Score =  161 bits (408), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 154/265 (58%), Gaps = 20/265 (7%)

Query: 476 GTISV-GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ---KTELS---IANAK 528
           G ++V G+DIT         R +  RL   +N+ S  R++ +R    K E++    A  +
Sbjct: 528 GVVNVYGSDITG--------RIAAERLLHMVNE-SLERRVHQRTEALKAEIAEHIRAERE 578

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
               KE+A+ AN+ K+EFLA +SHELRTPLNA++GFSEV+  E+FG LGS +Y  Y  DI
Sbjct: 579 LVAAKEQADLANRAKTEFLANVSHELRTPLNAVIGFSEVMASEMFGPLGSARYAGYVNDI 638

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI 648
             SG+HLL +IN+IL+++KIE  ++  D +  +   ++   IR++ S A S  + +   I
Sbjct: 639 LTSGRHLLAVINDILDIAKIEAGQMEFDMEPVEPAEVVAAAIRIVESRADSGGLFLGTHI 698

Query: 649 PSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
             ++    AD+R + +IL  +LSNS+KFT   G++ +   KIG  V  T+ADTGIG+ + 
Sbjct: 699 AEDVPILRADRRRLLQILVNLLSNSVKFTPEGGRVEVTVEKIGVDVGFTVADTGIGMSED 758

Query: 708 ALEKIGQP---FEPLHNQYDQSIGG 729
            +    QP         +YD+ + G
Sbjct: 759 EVVVAMQPSVRLRAAGKRYDRPVWG 783


>gi|121535347|ref|ZP_01667159.1| PAS/PAC sensor signal transduction histidine kinase [Thermosinus
           carboxydivorans Nor1]
 gi|121306039|gb|EAX46969.1| PAS/PAC sensor signal transduction histidine kinase [Thermosinus
           carboxydivorans Nor1]
          Length = 664

 Score =  161 bits (408), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 191/377 (50%), Gaps = 44/377 (11%)

Query: 399 DKNDRLVMCNANYQKAYGL-PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEI 457
           D + R ++ N  +  A GL PD V+     R+I           Y   +P R+Q  + E 
Sbjct: 307 DVDGRYLLVNQQFAAALGLRPDEVI----GRTI-----------YELHEPARAQRYAAED 351

Query: 458 K-LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATIN---DLSTSRQ 513
           K L D    +++ W   +   I+ G    ++   +  +R+   R+   I    D++  +Q
Sbjct: 352 KQLIDG---ELSVWADEE--LIASGGRKLIVYMQKVPVRDEAGRVTGIIGLAVDITEHKQ 406

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
            LE + TE   A       K+          +FLA MSHELRTPLNAI+GFSEV+  + F
Sbjct: 407 -LEVKLTEALAAAEAANQAKD----------QFLAAMSHELRTPLNAIMGFSEVLLDQHF 455

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L   K   Y  DI  S +HLL +IN++L+++K+   K +   +  D+  ++ + + +I
Sbjct: 456 GPLND-KQQVYVNDILDSARHLLEIINDVLDLAKLNAGKTNFYPETVDIAKLLRQTLGII 514

Query: 634 GSSAQSKNIKIE----KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
              A +KNI +E      +P ++    D R  K+I++ +LSN++KFT + G + +     
Sbjct: 515 KDRAAAKNIAVELAVDAGVPPQV--QVDVRRFKQIMYNLLSNAVKFTPDGGAIKVECRDA 572

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
           G+ + I++ DTGIGI  +  E I +PF  +         G GLGLAI+  L  LHGGR+ 
Sbjct: 573 GEWLEISVEDTGIGIAATHAEHIFEPFYQVSGNLTAKTPGTGLGLAITRQLVELHGGRIW 632

Query: 750 I-ISQEGKGTIVTICMP 765
           +  S+ G+G+  T  +P
Sbjct: 633 LERSEPGQGSRFTFVLP 649


>gi|222147633|ref|YP_002548590.1| two component sensor kinase [Agrobacterium vitis S4]
 gi|221734621|gb|ACM35584.1| two component sensor kinase [Agrobacterium vitis S4]
          Length = 1410

 Score =  161 bits (408), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 164/273 (60%), Gaps = 17/273 (6%)

Query: 504  TINDLSTS-------RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            TI  LS+S       R I + ++TE  + +AK       AETAN  K++FLA++SHE+RT
Sbjct: 1137 TIGRLSSSNGFCAVIRDITQWKRTEEELRSAKRA-----AETANAHKTDFLARVSHEIRT 1191

Query: 557  PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
            PLNAI+GF++++  E FG +G  +Y EYA DI  SG+H+L+++N++L++SKIE  ++ +D
Sbjct: 1192 PLNAIIGFADIMADERFGPIGHGRYAEYAADIGRSGRHVLDIVNDLLDISKIEAGEMDLD 1251

Query: 617  KQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIK 674
                 L   ++E + ++   A  + + I   + S+   N  AD R IK+I+  ILSN+I+
Sbjct: 1252 FIAVGLNETVSEAVAIVQPQANGQRVIIRTAL-SQSVPNVVADMRSIKQIVLNILSNAIR 1310

Query: 675  FTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGL 732
            FT + G++++ T+ +    V + I DTGIG+ ++ LE+  +PF  +     +  G G GL
Sbjct: 1311 FTPSGGQIIVSTNYEPNGSVTLRIRDTGIGMTRAELEQAMKPFRQVSPGGARLRGDGTGL 1370

Query: 733  GLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GL ++ A+ + +     I S   +GT+V I  P
Sbjct: 1371 GLPLTKAMVDANRASFAIQSTPNEGTLVEITFP 1403


>gi|88603925|ref|YP_504103.1| multi-sensor signal transduction histidine kinase [Methanospirillum
           hungatei JF-1]
 gi|88189387|gb|ABD42384.1| Cache sensor signal transduction histidine kinase [Methanospirillum
           hungatei JF-1]
          Length = 646

 Score =  161 bits (408), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 166/279 (59%), Gaps = 7/279 (2%)

Query: 492 AQLRESKRRLKATINDLSTSRQILE---RQKTE-LSIANAKYQVEKERAETANKTKSEFL 547
            +++E + +     N+LS+ R  LE   R++T+ L  AN     E+ RAE A++ KS FL
Sbjct: 364 GKIKEEEEQKNKAFNELSSYRDHLEDLVRERTQQLEAANTDLITERNRAEEADQLKSAFL 423

Query: 548 AKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSK 607
           A MSHELRTPLN+I+GF+ +I + + G L   +  +    +  S +HLL +IN++L++SK
Sbjct: 424 ATMSHELRTPLNSIIGFTGIILQGLAGPLNKEQEKQLGM-VQDSARHLLALINDVLDISK 482

Query: 608 IETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILF 666
           IE  +++I ++  ++   I      +  SA+ K + +   I P   F   D+R I++IL 
Sbjct: 483 IEAGELNISREPVNIQKSIESVCTTLRKSAEDKGLSLHVDISPDTGFIIGDQRRIEQILI 542

Query: 667 PILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            +++N+IKFT   G + +++S   + V I+++DTGIGI +  ++K+ +PF+ +     + 
Sbjct: 543 NLINNAIKFTER-GYVCVKSSLREKNVCISVSDTGIGISEEEMKKLFRPFQQIDTGTTRK 601

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             G GLGL+I   L  LHGG + + S+ GKG+  T+ +P
Sbjct: 602 HEGTGLGLSICKKLVELHGGTIMVTSEPGKGSEFTVILP 640


>gi|302187737|ref|ZP_07264410.1| response regulator receiver [Pseudomonas syringae pv. syringae 642]
          Length = 1172

 Score =  161 bits (407), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 167/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+  +P + EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSS-VPRLVEGLRTLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  +   + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGSVSMVVSRQPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|296121939|ref|YP_003629717.1| PAS sensor protein [Planctomyces limnophilus DSM 3776]
 gi|296014279|gb|ADG67518.1| PAS sensor protein [Planctomyces limnophilus DSM 3776]
          Length = 823

 Score =  161 bits (407), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 143/526 (27%), Positives = 240/526 (45%), Gaps = 72/526 (13%)

Query: 271 FNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQ 330
           F F + +  L  ++  +M  PY+ +  ++  + R +    +++  I R V GK  ++   
Sbjct: 173 FGFSSDEV-LGLNVNMLMPSPYQQEHDNY--LKRYLETKERRVIGIGREVIGK--RKDGT 227

Query: 331 IFHMRHASGADIWIQVRAQMMRTISGGMN--IIGIAMDLTEKYHLEKRYAEADQRLSKAI 388
           +F M  +             +  ++ G     +G   D+T     E+   +++ R+   +
Sbjct: 228 VFPMNLS-------------ISEVTDGEERLFVGTVRDITHSKRTEEALRDSEARVRAIL 274

Query: 389 ECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQD--------------- 433
               +A++  D++  +   N+  QK +G   H ++  N R ++ D               
Sbjct: 275 GTAVDAIITIDESGLIKSLNSAAQKMFGYSHHEMIGENVRMLMPDPYRGEHDGYLQKYQQ 334

Query: 434 AQTRPIIEYRTSDPERSQDMS--------KEIKLADSRWLQINEWCTHDGGTISVGTDIT 485
             TR +I        R +D S         E++    R+               +  DIT
Sbjct: 335 TGTRRVIGIGREAVGRRRDGSTFPMELSVSEVRQGSRRYF------------TGIVRDIT 382

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
             K  +A+LRES       I + S S+  L+ Q  EL+         ++ AE AN+ KS+
Sbjct: 383 ERKRYEARLRES-------IEESSRSQARLKIQAEELAQQATSLSEARKSAEAANRAKSD 435

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHE+RTP+ AILGF+E    ++   L   +  E    I  +G+HLL +IN+IL++
Sbjct: 436 FLANMSHEIRTPMTAILGFAE----QVSASLNRPEDCEALSIIRRNGEHLLKLINDILDI 491

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE--LFFNADKRIIKK 663
           SKIE+    I+K   DL  +I++ ++ IG  A  K I +     +   +    D   +K+
Sbjct: 492 SKIESGLFEIEKTTCDLRVLIHDLMQSIGPKAAQKKIGLTVNFATNVPVCIETDVLRLKQ 551

Query: 664 ILFPILSNSIKFTNNNG-KMMIRTSK---IGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            L  +LSN++KFT   G  + +R ++       + + I DTGIGI    L+K+  PF   
Sbjct: 552 SLMNLLSNAVKFTEQGGVDLSVRMTEEFTTAPRIQMQICDTGIGIAAEHLDKLFIPFSQA 611

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                +  GG GLGLAIS  L  L GG L++ S  G G+  TI +P
Sbjct: 612 DTSVSRRFGGTGLGLAISKRLIELMGGDLQVKSILGSGSSFTITLP 657


>gi|289646781|ref|ZP_06478124.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. aesculi str. 2250]
          Length = 1172

 Score =  161 bits (407), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|257487872|ref|ZP_05641913.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|331008579|gb|EGH88635.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|254708265|ref|ZP_05170093.1| sensory box histidine kinase [Brucella pinnipedialis M163/99/10]
 gi|261315765|ref|ZP_05954962.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis M163/99/10]
 gi|261304791|gb|EEY08288.1| PAS/PAC sensor signal transduction histidine kinase [Brucella
            pinnipedialis M163/99/10]
          Length = 1035

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTALGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|71735952|ref|YP_274795.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71556505|gb|AAZ35716.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFKPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|320324583|gb|EFW80660.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. glycinea str. B076]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|298487166|ref|ZP_07005215.1| Signal transduction histidine kinase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158190|gb|EFH99261.1| Signal transduction histidine kinase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 1172

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|20091132|ref|NP_617207.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19916235|gb|AAM05687.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 572

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 130/438 (29%), Positives = 219/438 (50%), Gaps = 36/438 (8%)

Query: 332 FHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIEC 390
           + M    G  + + V +  ++  +G  +  I I  D+TE+   EK   E + R     + 
Sbjct: 144 YRMVRKDGKTVDVNVNSSGLKDENGFHVQTIYIVEDITERKKAEKLVKENESRYRSLFQN 203

Query: 391 TSEALVLWDKN-DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRP-IIEYRTSDPE 448
               ++L D +   ++  N+     YG P   ++  N    I D    P        + E
Sbjct: 204 NRAVMLLLDPDTGNILDANSAACAFYGYPREKMLGLN----IADINILPKEQILEELEQE 259

Query: 449 RSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDL 508
           +S+D++             + + TH    +S G    + +++   L   K+ L A ++D+
Sbjct: 260 KSRDIN-------------HFYFTH---RLSNGVLRDVERYSYPILMGGKKLLYAIVSDI 303

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
           + +R++    ++EL  A       K  AE A+K KSEFLA MSHELRTPLN+I+GFS+++
Sbjct: 304 TDNRKM----QSELVRA-------KMEAEIASKAKSEFLASMSHELRTPLNSIIGFSDML 352

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
             + FG L   K   Y  +I  SG HLL +IN IL++SK+E  K+ +  +   ++  I+E
Sbjct: 353 LTQNFGPLNK-KQLRYVNNISVSGNHLLKLINGILDLSKVEAGKMELKVEEFSVLDSISE 411

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
              L+   A  K+I+I   +  EL    AD+   K+IL+ ++ N+IKFT+ +G +++   
Sbjct: 412 VKVLLTPLASKKDIQILSVVDKELTTIRADRTKFKQILYNLVDNAIKFTHEDGFVIVDAR 471

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
             G    I + DTGIGI K+ ++KI QPF  L N       G GLGL++      +H G+
Sbjct: 472 VEGDQAKIMVKDTGIGISKAGVKKIFQPFTQLENSEYGKQKGTGLGLSLVKKFVEMHTGK 531

Query: 748 LKIISQEGKGTIVTICMP 765
           + + S+ G+G+     +P
Sbjct: 532 IWVESEFGEGSKFIFTIP 549


>gi|330985282|gb|EGH83385.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|320328955|gb|EFW84954.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 1170

 Score =  161 bits (407), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|46200809|ref|ZP_00056331.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 549

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/381 (31%), Positives = 186/381 (48%), Gaps = 34/381 (8%)

Query: 399 DKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
           D +D  ++ + +       PDHV      R + +    +P  E   + PE S ++   + 
Sbjct: 183 DSSDSALLVSPDGTILARSPDHV------RYVGKSLAGQPAFETARTAPEGSGEILSPLD 236

Query: 459 LADSRWLQINEWCTHDGGTISVGTDITLLKHNQ-AQLRE----------SKRRLKATIND 507
               R    ++  +H          I +  H+Q AQLRE          S   +   I  
Sbjct: 237 -GRKRLYAFHKASSH--------PVIAVASHDQEAQLREWRLHSMTLVASALLVGLIIGA 287

Query: 508 LST--SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
           L+   +RQ LER    LS    +    +  A+ AN+ KS FLA MSHELRTPLNAI+GFS
Sbjct: 288 LALFLARQ-LERMDRTLS----ELARSRREADAANRAKSAFLANMSHELRTPLNAIIGFS 342

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           + +   I G     +  +Y   +  S +HLL++IN+IL++SKIE     I      L  +
Sbjct: 343 DALLVGIPGHTCQSRCQDYLGHVQTSSRHLLSLINDILDLSKIEAGSTEIALAPTPLALL 402

Query: 626 INEGIRLIGSSAQSKNIKIEKKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
           I E + ++ + A+SKNI +    P  +L    D R +++I+  +LSN++KFT   G++++
Sbjct: 403 ITECLEIVRAKAESKNISVALAGPDQDLMVTTDSRRLRQIVLNLLSNAVKFTPEGGRIIL 462

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
                   + +T+ DTGIG+ +  +     PF    +   +   G GLGL +S  LT L 
Sbjct: 463 EAECDSGQLALTVNDTGIGMTQEEIAVALTPFGQNDSDLARREAGTGLGLPLSKRLTELL 522

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG L + S  G+GT VTI +P
Sbjct: 523 GGTLSVTSIPGRGTTVTISLP 543


>gi|330982197|gb|EGH80300.1| response regulator receiver [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 1031

 Score =  160 bits (406), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 167/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 297 LETQQAELEQTNEQLADQSQALAEQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 356

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 357 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 415

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+  +P + EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 416 KVEAGKLEVRPENSS-VPRLVEGLRTLFQPLAAEKKLAFTVDIQTGAPTMLF--TDRQRL 472

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  +   + D+GIGI +   + I + F     
Sbjct: 473 EQILKNLLSNAIKFTEAGSVSMVVSRQPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 532

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 533 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 577


>gi|288941217|ref|YP_003443457.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
 gi|288896589|gb|ADC62425.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM
           180]
          Length = 977

 Score =  160 bits (406), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/421 (28%), Positives = 208/421 (49%), Gaps = 57/421 (13%)

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV 423
           A D TE+   E    E+++RL   +    + + L D + R + CNA ++  +G P+  ++
Sbjct: 407 ATDTTERRRAEAALRESEERLRMLLRRIPDLVWLKDPDGRYLTCNARFETLFGRPEAEII 466

Query: 424 PGNARSIIQDAQTRPIIEYRTSDPERSQDMS-----------KEIKLADS---RWLQINE 469
                  +  AQ         +D  R+ D++           +EI  A       +Q+ +
Sbjct: 467 GKTDYDFVDRAQ---------ADFFRANDLAAIAAGGPRVNEEEIVFAGDGHRERIQVVK 517

Query: 470 WCTHDG-----GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSI 524
              HD      G + +  DIT ++  + +L + +  L+          +++  +  EL+ 
Sbjct: 518 TPVHDADGTVIGVLGIARDITEMRRVEQELEQHRHHLE----------ELVAERTEELTQ 567

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           A  +       AE   ++K EFLA MSHE+RTP+NA+LG + +++++   +    + +E 
Sbjct: 568 ARLE-------AERLAQSKGEFLANMSHEIRTPMNAVLGLAYLLERQPLPD----EAHEL 616

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
           A+ IH SGQ LL++IN+IL+ SKIE+ +I I++    L  +++  + ++G+SA  K I +
Sbjct: 617 ARQIHRSGQSLLHIINDILDFSKIESGRIEIERIPFQLGEVLDNLVTIVGTSAADKAIDL 676

Query: 645 EKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-----CVIITI 697
             + P +L      D   + +IL  + SN++KFT ++G++ +R   I +      +  T+
Sbjct: 677 VIRPPEDLESSLVGDPLRLGQILINLTSNAVKFT-SDGQVEVRVESIARSHTEVTLRFTV 735

Query: 698 ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
            DTGIGI       + QPF        +  GG GLGL I   L  L GGRL + S  G+G
Sbjct: 736 RDTGIGIDPETQAHLFQPFTQADASTTRRFGGSGLGLVICRRLAELMGGRLGLDSVPGEG 795

Query: 758 T 758
           +
Sbjct: 796 S 796


>gi|239834297|ref|ZP_04682625.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
            3301]
 gi|239822360|gb|EEQ93929.1| PAS domain S-box-containing protein [Ochrobactrum intermedium LMG
            3301]
          Length = 1047

 Score =  160 bits (405), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 155/264 (58%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ + E+     A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 782  RDITQWKRTEEELTNARKEAER-----ASSQKTEFLARISHEIRTPLNAIIGFSELMADE 836

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 837  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIAEAIA 896

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 897  LMQPQANRERVIIRSSFQSNLPDIVADTRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 956

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 957  NGDVVMRVRDTGIGMTKSEVEQALKPFRQVNALERRKAESAKDWRNEGTGLGLPLTKAMV 1016

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G GT+V I  P
Sbjct: 1017 EANRAQFAIDSTPGHGTVVEIAFP 1040


>gi|330953354|gb|EGH53614.1| response regulator receiver [Pseudomonas syringae Cit 7]
          Length = 1172

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 166/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALAEQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+  +P + EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSS-VPRLVEGLRTLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ +   G  +   + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGSVSMVVSRHPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|153011243|ref|YP_001372457.1| PAS/PAC sensor signal transduction histidine kinase [Ochrobactrum
            anthropi ATCC 49188]
 gi|223635612|sp|A6X5X4|PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase pdhS
 gi|151563131|gb|ABS16628.1| PAS/PAC sensor signal transduction histidine kinase [Ochrobactrum
            anthropi ATCC 49188]
          Length = 1055

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 154/264 (58%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 790  RDITQWKRTEEELTNARKE-----AERASSQKTEFLARISHEIRTPLNAIIGFSELMADE 844

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 845  KFGSIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIAEAIA 904

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 905  LMQPQANRERVIIRSSFQSNLPDIVADTRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEM 964

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++           D    G GLGL ++ A+ 
Sbjct: 965  NGDVVMRVRDTGIGMTKSEVEQALKPFRQVNALERRKAETAKDWRSEGTGLGLPLTKAMV 1024

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G GT+V I  P
Sbjct: 1025 EANRAQFAIDSTPGHGTVVEIAFP 1048


>gi|330960926|gb|EGH61186.1| response regulator receiver [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 1167

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 166/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R+  EL++A A+ Q   +  + ++K KSEF
Sbjct: 438 LETQQAELEQTNEQLAEQSKALAEQRDALDRKNEELNMAQAELQARADELQRSSKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLAENPKENL-TAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-LIGSSAQSK----NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+  +P + EG+R L    A  K     + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSS-VPRLVEGLRTLFQPLATEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      MI + + G  ++ ++ D+GIGI     + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMIVSRQPGAGIVFSVRDSGIGIAPEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I T+ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFTLVLPE 718


>gi|217977515|ref|YP_002361662.1| integral membrane sensor signal transduction histidine kinase
           [Methylocella silvestris BL2]
 gi|217502891|gb|ACK50300.1| integral membrane sensor signal transduction histidine kinase
           [Methylocella silvestris BL2]
          Length = 518

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 140/250 (56%), Gaps = 6/250 (2%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL  + A   + + RAE AN  KS FLA MSHELRTPLNAILGFSEV+K E+FG     
Sbjct: 239 AELEQSKANSDLARRRAEEANLAKSHFLATMSHELRTPLNAILGFSEVMKGELFGAHIVA 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY+ DIH SG HLL +IN IL++S+IE  ++ + ++   L  I+ +   L+   A+ 
Sbjct: 299 SYKEYSNDIHASGHHLLMLINEILDLSRIEAGRLELKEEAVALDHIVEDCHHLLALRAKK 358

Query: 640 KNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVII 695
           + + I + I ++L    AD+R ++++   +LSN++KFT   G++ IR   T+  GQ   +
Sbjct: 359 RGVTITEAIEADLPRIRADERAVRQMTLNLLSNAVKFTPPGGRVRIRIGWTAAGGQ--YL 416

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            + D+G GIP+  +  +   F         +  G GLGL I   L  LH G   + S  G
Sbjct: 417 AVRDSGPGIPEEEIPIVMSSFGRGALARKNAEEGSGLGLPIVKGLVELHEGTFILKSNVG 476

Query: 756 KGTIVTICMP 765
           +G    +  P
Sbjct: 477 EGAEAIVIFP 486


>gi|294494969|ref|YP_003541462.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292665968|gb|ADE35817.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 625

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 147/234 (62%), Gaps = 2/234 (0%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K+ AE AN+TKSEFLA MSHELRTPLN+++GFS+++ KE+ G+L   +  +Y  +I  SG
Sbjct: 387 KKAAEQANQTKSEFLANMSHELRTPLNSVIGFSDILSKEVRGKLNDSQK-KYVSNITKSG 445

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE- 651
            HLL++IN+IL++SKIE  +  ++  + DL   ++E   LI      KNI ++  +P E 
Sbjct: 446 SHLLSLINDILDLSKIEAGQKQLEYSSFDLHEALDEISILIKPLISKKNIDLQMDLPPED 505

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEK 711
               AD++  K+I++ +LSN+ KFT + G + I  ++    + + + DTG+GIP++    
Sbjct: 506 SRVYADRKKFKQIMYNLLSNASKFTPDKGTITIVANQEKDKLKVAVQDTGMGIPEADQAT 565

Query: 712 IGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           I +PF+ + +       G GLGL+++  L  +HGG++ + S+ G G+  T  +P
Sbjct: 566 IFEPFQQVKSAKSSEYKGTGLGLSLARELVEMHGGQVGLKSEVGMGSTFTFTIP 619


>gi|209965184|ref|YP_002298099.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
 gi|209958650|gb|ACI99286.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
          Length = 420

 Score =  160 bits (405), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 155/282 (54%), Gaps = 14/282 (4%)

Query: 491 QAQLRESKRRLKATIND----LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           Q QLR     L++ + +    LS + ++L   + +L+      Q+E  R E  N+ KSEF
Sbjct: 132 QRQLRHQNVMLESMVKESTQRLSEAMEVLRHAERQLA-----EQLEHSREE--NRRKSEF 184

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA  +HELRTPLNAILGF++++  E +G LG+  Y EYA DIH + +HLL ++   ++++
Sbjct: 185 LANATHELRTPLNAILGFADLLVAEAYGPLGNPHYAEYAHDIHTAAEHLLALVEGTMDLA 244

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIP-SELFFNADKRIIKKIL 665
           K E+ +  I+ +  D+   + + IRL+   A+   + +   +P + L   +D   I++I+
Sbjct: 245 KAESGQDEIELREIDIGRTVQDSIRLLRQLAEIGGVSLTVSVPETPLRLRSDPEKIRQIV 304

Query: 666 FPILSNSIKFTNNNGKMMIRTS--KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQY 723
             + SN+IKFT   G + +  S    G   I+ I DTGIGI    L    +PF  + +  
Sbjct: 305 LNLASNAIKFTPKGGCVTVDVSADSDGGACILVIRDTGIGIAPQDLATALRPFGQVRSPD 364

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                G GLGL ++     + GG + I S+ G GT+VT+ +P
Sbjct: 365 RPHPKGTGLGLPLTRRFVEMLGGSMAIDSRPGHGTVVTVRLP 406


>gi|27378182|ref|NP_769711.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
 gi|27351329|dbj|BAC48336.1| two-component sensor histidine kinase [Bradyrhizobium japonicum
           USDA 110]
          Length = 634

 Score =  160 bits (404), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 91/228 (39%), Positives = 135/228 (59%), Gaps = 9/228 (3%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K+ FLA MSHELRTPLNAI+GFS++I +E    LG+ +  EYAQ I+ SGQHLL+++N I
Sbjct: 361 KTRFLATMSHELRTPLNAIIGFSDMIAQEQALMLGAAQRKEYAQVINDSGQHLLSVVNGI 420

Query: 603 LEMSKIETEKISIDKQ----NADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNAD 657
           L+MSK+E+    I  +     A L+   N    L+   A+   I +    P +L     D
Sbjct: 421 LDMSKMESGNFEIASEPFAPRASLMHCCN----LLALKARENGIDLITDAPQDLPVMTGD 476

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
            R  K+I+  +++N+IKFT   G++ +  +  G  + + I+DTG+GI    L++IG PF 
Sbjct: 477 PRAFKQIVLNLVANAIKFTERGGQVSVSAAVSGSHLTLRISDTGVGIAPDDLKRIGAPFF 536

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                Y +   G GLGL+I  +L  LH G L + S+ G+GT VT+ +P
Sbjct: 537 QAGKTYQRRHEGTGLGLSIVKSLVALHLGDLTVQSRLGEGTAVTVKLP 584


>gi|330878817|gb|EGH12966.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 383

 Score =  160 bits (404), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 165/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   ELSIA A+ Q   +  + A+K KSEF
Sbjct: 80  LETQQAELEQTNEQLADQSQALADQRDALDRNNEELSIAQAELQARADELQRASKYKSEF 139

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 140 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 198

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 199 KVEAGKLEMRPENSSVSRLV-EGLRSMFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 255

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++  + D+GIGI +   + I + F     
Sbjct: 256 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFIVRDSGIGIAEEHQQGIFEAFRQADG 315

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 316 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 360


>gi|163797314|ref|ZP_02191267.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159177405|gb|EDP61961.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 485

 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 135/228 (59%), Gaps = 4/228 (1%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           N  KS FLA MSHELRTPLNAI+GFSE   K++ G + S +Y +YA DIH S  HLL ++
Sbjct: 236 NLAKSTFLATMSHELRTPLNAIMGFSEAQAKQLLGPVPS-RYRDYANDIHTSASHLLAVL 294

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI--KIEKKIPSELFFNAD 657
           N+IL+M++++  ++++ ++  +    ++  +R+I    +   I   IE +        AD
Sbjct: 295 NDILDMARMDARRLTLYEEEFNPSKAVDMAVRMIDPDRKRAGIVLSIENRAMGSTL-RAD 353

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
           +R++++I+  +LSN++KFT+  G + +   +    + +++ DTG GI    L+++ +PF 
Sbjct: 354 ERLLRQIVLNLLSNAVKFTSPGGTVTVALDQSASGLTLSVRDTGTGISPDLLKRVAEPFF 413

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                Y +   G GLGL++      LHGG + I S  G+GT+V +  P
Sbjct: 414 QADQSYARRHQGTGLGLSLVKGFAELHGGSIAIESTLGEGTMVAVRFP 461


>gi|330900706|gb|EGH32125.1| response regulator receiver [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 934

 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 167/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 200 LETQQAELEQTNEQLADQSQALAEQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 259

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 260 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 318

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+  +P + EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 319 KVEAGKLEVRPENSS-VPRLIEGLRTLFQPLAAEKKLAFTVDIQTGAPTMLF--TDRQRL 375

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  +   + D+GIGI +   + I + F     
Sbjct: 376 EQILKNLLSNAIKFTEAGSVSMVVSRQPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 435

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 436 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 480


>gi|158338213|ref|YP_001519390.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
 gi|158308454|gb|ABW30071.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
          Length = 3309

 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 128/469 (27%), Positives = 231/469 (49%), Gaps = 53/469 (11%)

Query: 324  HVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQ 382
            H K++++ F    A G   W++      +   G M   +GIA D+TE+   E+   E+ Q
Sbjct: 2623 HRKRVEEPF--SQADGTLGWLETTKTPFQDEQGRMAGTVGIAADITERKAAEQELYESKQ 2680

Query: 383  RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEY 442
             L   ++   + +   D+N   + CN  + +  G      + G         QT   + +
Sbjct: 2681 LLKLVLDTIPQKVCWKDRNSVYLGCNQAFTEMAGFTSSDEIVG---------QTDYELPW 2731

Query: 443  RTSDPE-------RSQDMSK-------EIKLADSR--WLQINEWCTHD-----GGTISVG 481
            +T + E       R    +K        I  AD +  WL  N+    D      G +++ 
Sbjct: 2732 KTEEAEFFIECDQRIMSTAKAELGIVEPILTADGKNAWLSTNKAPLRDVQGNVMGILAMI 2791

Query: 482  TDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANK 541
             DIT LK  +  L+     L+A +++ + + +     +T  ++A AK     E A++AN+
Sbjct: 2792 EDITPLKQAEETLKNINEELEARVSERTAALE-----QTNHALAEAK-----EIADSANQ 2841

Query: 542  TKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINN 601
             KSEFLA MSHELRTPLN ILG+++++ +    +  S +     + IH  G HLL +IN+
Sbjct: 2842 AKSEFLANMSHELRTPLNGILGYAQILNR---SDQISPRDKRGLEVIHQCGSHLLTLIND 2898

Query: 602  ILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKR 659
            IL++SKIE  K+ ++    DL+ +++  + +    A  K I++  ++ ++L      D++
Sbjct: 2899 ILDLSKIEARKLELNPHPTDLLTLLSSVVDMFHLKATQKGIELLFQLDNDLPKGVEIDEK 2958

Query: 660  IIKKILFPILSNSIKFTNNNG---KMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIGQP 715
              +++L  ++ N++KFT       +++   +  GQ  +   I DTG+GI    L ++ + 
Sbjct: 2959 RFRQVLINLMGNALKFTEKGSVTFQILQLEANAGQATLRFAIIDTGVGIATEQLSRLFKA 3018

Query: 716  FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            FE + +  + +  G GLGLAIS  +  L GG +++ SQ G G+  + C+
Sbjct: 3019 FEQVGDPRNHT-EGTGLGLAISQRIVQLMGGDIQVSSQLGAGSEFSFCV 3066


>gi|227822277|ref|YP_002826248.1| two component sensor kinase [Sinorhizobium fredii NGR234]
 gi|227341277|gb|ACP25495.1| two component sensor kinase [Sinorhizobium fredii NGR234]
          Length = 511

 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 142/251 (56%), Gaps = 8/251 (3%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            EL +A +     + RAE AN  KS FLA MSHELRTPLNAILGFSEV+  E+ G L + 
Sbjct: 239 AELEVAKSMSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSTEVLGPLNNP 298

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
            Y EY  DIH SG+HLLN+IN IL++S+IE  +  ++++  +L+ I  + I ++   A+ 
Sbjct: 299 TYKEYTVDIHRSGEHLLNLINEILDLSRIEAGRYELNEEAVNLVEIAEDCIGMVQLRARG 358

Query: 640 KNIKIEKK----IPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVI 694
           KNI IE +    +PS      D++ ++++   +LSN++KFT   G++ ++     G    
Sbjct: 359 KNITIEPQFEQAMPSVWI---DEKAMRQVALNLLSNAVKFTPAGGEITVKVGWTAGGGQY 415

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           I+I D G GIP+  +  +   F         +  G GLGL I  A+   H G+  + S+ 
Sbjct: 416 ISIKDNGPGIPEEEIPIVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHNGQFILRSKL 475

Query: 755 GKGTIVTICMP 765
            +GT     +P
Sbjct: 476 REGTEAIAILP 486


>gi|115523889|ref|YP_780800.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
 gi|115517836|gb|ABJ05820.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisA53]
          Length = 615

 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R + +R++ EL++  A+ +  +     A+ ++S FLA +SHELRTPLNAI+GFSE+I +E
Sbjct: 328 RDVTDRKQQELALEQARAEAAR-----ADASRSRFLATVSHELRTPLNAIIGFSEMIVQE 382

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
               + + +  EYAQ I+ SGQHLL+++N IL+MSK+++    I  +     P +     
Sbjct: 383 QALMISAERRREYAQLINDSGQHLLSVVNGILDMSKMDSGNFEILPEPFAPRPALLNCCN 442

Query: 632 LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           L+   A+   I +  + P +L   N D R  K+I+  ++SN+IKFT   G + +  +  G
Sbjct: 443 LLALKARDSGIDLVTRAPDDLPEVNGDPRAFKQIVLNLVSNAIKFTERGGTVTVSAAVEG 502

Query: 691 QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
             + + + DTG+GI    LE+IG PF      Y +   G GLGL+I   L  LHGG L +
Sbjct: 503 AHLALRVVDTGVGIAADDLERIGDPFFQAGKTYQRRHEGTGLGLSIVKTLVALHGGELTV 562

Query: 751 ISQEGKGTIVTICMP 765
            SQ  KGT VT  +P
Sbjct: 563 ASQLDKGTTVTAMLP 577


>gi|91203275|emb|CAJ72914.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 818

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 162/271 (59%), Gaps = 9/271 (3%)

Query: 500 RLKATINDLS----TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
           +L    ND+S    +S  +LE++ TE        Q      + AN+ KSEFLA MSHELR
Sbjct: 260 QLGEAFNDMSDKLRSSYAMLEQRITE---KTEHLQKAVSALKRANRMKSEFLANMSHELR 316

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TPLNAI+GF+EV+K ++ GEL + +  ++ +DIH SG+HLL MIN+IL++SKIE  K+ +
Sbjct: 317 TPLNAIIGFAEVLKDKLCGELNA-EQEDFVKDIHSSGRHLLQMINDILDLSKIEAGKMEL 375

Query: 616 DKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIK 674
             ++  +   I +   ++   A+ K ++++  I  ++    AD+   K+IL+ +LSNSIK
Sbjct: 376 QYESFLVSDAIEDVYTILKGLAKKKQLQLKTVIQEDVKDIEADRVKFKQILYNLLSNSIK 435

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT  NG +    + +   + ++++D+GIGI     EK+ + F    + + +   G GLGL
Sbjct: 436 FTPQNGTITTNAAIVDGKMQVSVSDSGIGIKPEDREKVFKEFWQADSSFSRKYEGTGLGL 495

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           A++  +  +HGG++ + S+ GKG+     +P
Sbjct: 496 ALTRRIVEMHGGKIWLKSEYGKGSTFYFTIP 526


>gi|220908294|ref|YP_002483605.1| GAF sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864905|gb|ACL45244.1| GAF sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 733

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 137/231 (59%), Gaps = 4/231 (1%)

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
           +A++ KS+FLA ++HELRTPL  ++G S  + +   G L   K   Y + IH SG+HLL 
Sbjct: 355 SAHRAKSDFLATINHELRTPLTCVIGMSATLLRWSLGPLND-KQRSYLKTIHDSGEHLLE 413

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI--KIEKKIPSEL-FF 654
           +IN+IL++S++E  K  +      L  +  + +R+    AQ   +  K+E  IPSE   F
Sbjct: 414 LINDILDLSQVEAGKAVLSLSEFSLNQLCRQALRVFREKAQEAEVELKLESLIPSEFERF 473

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD+R +++ILF +LSN+IKFT   G++ +R+       +  + DTGIGI  S    + Q
Sbjct: 474 CADQRRVRQILFNLLSNAIKFTPAGGRVTLRSWVENGKALFQVEDTGIGISLSQQPLLFQ 533

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            F+ L   Y +S  G GLGLA++  L  LH GR+++ S EG G+I T+ +P
Sbjct: 534 KFQQLDTSYTRSYEGVGLGLALTKQLVELHRGRIEVESTEGIGSIFTVELP 584


>gi|307153867|ref|YP_003889251.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306984095|gb|ADN15976.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1486

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 141/231 (61%), Gaps = 3/231 (1%)

Query: 537  ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
            + A + K EFLA MSHELRTPLNAILG +E ++ EIFG++   +  +  + I  +G HLL
Sbjct: 1107 DRATRLKDEFLANMSHELRTPLNAILGMTEGLQDEIFGQINE-RQRKSLKIIEQAGNHLL 1165

Query: 597  NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFN 655
             +IN+IL++SKIE+ ++ +   + ++IP+    +  +   A  K I+++  I S  L   
Sbjct: 1166 ELINDILDVSKIESGQLELHCTSTEIIPLCQSSLAFVKQQAVKKRIQLDFNISSNILMLT 1225

Query: 656  ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQ 714
             D+R I++++  +L+N++KFT   GK+ +   +IG+  V   + DTGIGI    + K+ Q
Sbjct: 1226 LDERRIRQVIINLLNNAVKFTPEGGKVGLEVVQIGENTVRFAVKDTGIGIAAENIPKLFQ 1285

Query: 715  PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            PF  + +  ++   G GLGLA+   L +LHGG + + S+ G G+  ++ +P
Sbjct: 1286 PFMQIDSALNRQYTGTGLGLALVKRLVDLHGGEVSVTSELGVGSCFSVDLP 1336


>gi|161619546|ref|YP_001593433.1| PAS domain-containing protein [Brucella canis ATCC 23365]
 gi|254704851|ref|ZP_05166679.1| PAS domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|260565909|ref|ZP_05836379.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|261755546|ref|ZP_05999255.1| PAS/PAC sensor signal transduction histidine kinase [Brucella suis
            bv. 3 str. 686]
 gi|223635609|sp|A9M715|PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase pdhS
 gi|161336357|gb|ABX62662.1| PAS domain S-box [Brucella canis ATCC 23365]
 gi|260155427|gb|EEW90507.1| sensory box histidine kinase [Brucella suis bv. 4 str. 40]
 gi|261745299|gb|EEY33225.1| PAS/PAC sensor signal transduction histidine kinase [Brucella suis
            bv. 3 str. 686]
          Length = 1035

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 156/264 (59%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG ++L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNYVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALEGRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|323137204|ref|ZP_08072283.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
 gi|322397562|gb|EFY00085.1| multi-sensor signal transduction histidine kinase [Methylocystis
           sp. ATCC 49242]
          Length = 623

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/229 (39%), Positives = 136/229 (59%), Gaps = 3/229 (1%)

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
           TA+KT+  FLA +SHELRTPLNAI+GFSE++           K  EYA+ I  SG HLL 
Sbjct: 356 TASKTR--FLANVSHELRTPLNAIIGFSEMLANPELAPTDPGKQREYAEIISNSGHHLLE 413

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNA 656
           ++N IL+MSKIE+  + I  +   L  +I++   ++   A    + + +    ++    A
Sbjct: 414 VVNTILDMSKIESGSMQIFPEPFSLPALIDQCCDMVQLKADQSAVTLLRDYRRDIDDLVA 473

Query: 657 DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPF 716
           DKR  K+IL  +LSN++KFT  NGK+ IR +  G  + I++ D+GIGI  + L ++G PF
Sbjct: 474 DKRACKQILLNLLSNAVKFTPANGKVKIRLAPEGNHLGISVIDSGIGIAPADLARLGDPF 533

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                 +D++  G GLGL++   L  LHGG + + S   KGT VT+ +P
Sbjct: 534 FQASASHDRTHEGTGLGLSVVRGLVGLHGGSITVESAPRKGTSVTVRLP 582


>gi|17229180|ref|NP_485728.1| two-component sensor histidine kinase [Nostoc sp. PCC 7120]
 gi|17135508|dbj|BAB78054.1| two-component sensor histidine kinase [Nostoc sp. PCC 7120]
          Length = 676

 Score =  159 bits (403), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 162/291 (55%), Gaps = 11/291 (3%)

Query: 478 ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
           IS+   + +  H      E  R L+ +   L+  +Q LE++  E ++A     +    AE
Sbjct: 388 ISIAEQLAIAIHQS----ELMRSLQDSAQRLTQEKQTLEQRVIERTMALRDALLA---AE 440

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            A++ +SEFLA +SHEL TPL  ++G S  + +   GEL S +  +Y Q IH SG+HLL+
Sbjct: 441 AASRLRSEFLATISHELLTPLTYVIGMSSTLLRWPLGEL-SQRQRDYLQTIHDSGEHLLD 499

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK--NIKIEKKI-PSELFF 654
           MIN+IL++S+IE  K  ++     L+ I    I  +   A S+  N+K++ +I P    F
Sbjct: 500 MINDILDLSQIEAGKTVLNIAEFSLVKIAENTIESLLEKALSEQVNLKLDLQIDPRRDRF 559

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
            AD   I++IL+ +L+N+IKFT   G + +R        I  + DTGIGIP+  L  + +
Sbjct: 560 TADAARIEQILWNLLTNAIKFTPEGGNVTLRIWVEEDTSIFQVEDTGIGIPEEQLPLLFE 619

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            F+ L   Y +   G GLGLA++  L  LH GR+++ S  G G+I T+ +P
Sbjct: 620 KFQQLDTPYRRRYEGTGLGLALTKQLVELHRGRIEVESTVGIGSIFTVWIP 670


>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040090|gb|ACT56886.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 820

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 158/267 (59%), Gaps = 19/267 (7%)

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
           T++D+S  +Q    +K +LS A       K+ AE  +  KS+FLA++SHE+RTPL AI+G
Sbjct: 557 TMHDISEWKQ----EKNKLSHA-------KKIAEKESSHKSDFLARVSHEIRTPLTAIIG 605

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
           FSEVIK + FG LG+ +Y EYA  I  SG  +L+++N++L++SKIE+ K+++  +   L 
Sbjct: 606 FSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLD 665

Query: 624 PIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679
             ++E I L+   A  K I I       IP  L   AD R +K+I   ILSN+I FT + 
Sbjct: 666 EAVSEAISLVQLYANEKRILIRTSFANNIPRIL---ADLRSVKQIALNILSNAIHFTPSG 722

Query: 680 GKMMIRTSKIG-QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
           G+++I T+    + VI+ + DTG+G+    LEK  +PF  + N       G GLGL ++ 
Sbjct: 723 GQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAK 782

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
           A+ + + G+  I S   KGT++ I  P
Sbjct: 783 AMVDANMGKFYIFSTPAKGTLIEIIFP 809


>gi|15604100|ref|NP_220615.1| histidine kinase sensor protein (barA) [Rickettsia prowazekii str.
           Madrid E]
 gi|3860792|emb|CAA14692.1| HISTIDINE KINASE SENSOR PROTEIN (barA) [Rickettsia prowazekii]
 gi|292571826|gb|ADE29741.1| Histidine kinase sensor protein [Rickettsia prowazekii Rp22]
          Length = 497

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 151/257 (58%), Gaps = 11/257 (4%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +RQI+E Q    +  N K Q+EK    +++ TK  F A +SHELRTPLNAI+GFSE++  
Sbjct: 241 ARQIIEEQLE--TNRNLKAQIEKVEKTSSSNTK--FFANISHELRTPLNAIIGFSEIL-- 294

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
               E  + K   Y +DIH +G+HLL+MIN+IL++SK   +K+ +D  + DL  +I+  +
Sbjct: 295 --MSERDTEKSKNYIKDIHDAGKHLLSMINDILDLSKASADKLKVDNIDLDLNKLISSSL 352

Query: 631 RLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK- 688
            LI   A    +++  ++P E +  NAD + +K++L  +LSN++KFTN+ G + I   K 
Sbjct: 353 ILIKPRAYQAEVELISRLPKEHVVINADPKRLKQVLLNLLSNAVKFTNSGGSVTISLEKD 412

Query: 689 -IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
            + + V I + DTGIGI +  + K    F  + ++  +   G GLGL ++  L  L  G+
Sbjct: 413 ELAKLVYIKVIDTGIGIEEKDIPKTLSAFGQIDSELSRKYEGTGLGLPLTKKLVELMNGK 472

Query: 748 LKIISQEGKGTIVTICM 764
             + S+  KGT VTI  
Sbjct: 473 FDLQSKINKGTTVTITF 489


>gi|260574258|ref|ZP_05842263.1| histidine kinase [Rhodobacter sp. SW2]
 gi|259023724|gb|EEW27015.1| histidine kinase [Rhodobacter sp. SW2]
          Length = 854

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 120/426 (28%), Positives = 199/426 (46%), Gaps = 85/426 (19%)

Query: 359 NIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP 418
           +++ +A+++TE+            R+  AIE   +  VL+D+ DRL+ CN  Y+  Y   
Sbjct: 190 DMVCLALNITEQM-----------RIWAAIEAIPDGFVLFDREDRLMTCNQRYRDLYPES 238

Query: 419 DHVLVPG-----------------NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLAD 461
              +VPG                 +A  + +D     +   R    +  Q M      AD
Sbjct: 239 AEAMVPGASYESILRYGLEQGAYADALGVEEDWLKERLARRRLKSDQFEQQM------AD 292

Query: 462 SRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTE 521
            RWL++ E  T DGG + +  D+T  +  Q  L               T+R         
Sbjct: 293 GRWLRVIEQETPDGGHVGLRVDVTAAREQQTLL--------------ETARMA------- 331

Query: 522 LSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKY 581
                         AE AN+ KS FLA MSHE+RTP+N ++G +E++      E    + 
Sbjct: 332 --------------AEAANRAKSAFLANMSHEIRTPMNGVVGMAELLCDTNLTE----EQ 373

Query: 582 YEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKN 641
             +A  I  SG+ LL +IN+IL+ SKIE E++++  +  DL   I+E   L+   A++K 
Sbjct: 374 RLFADTIRSSGEALLVIINDILDYSKIEAERLTLHPEPFDLERTIHEVTMLLQPRARAKG 433

Query: 642 ----IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-----GQC 692
               I  +  +P+    +A +  ++++L  ++ N++KFT   G +++R   I      Q 
Sbjct: 434 LDLMIDFDMFLPTRYIGDAGR--LRQVLTNLMGNAVKFTET-GHVLVRVVGIEAEPGSQQ 490

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS 752
           + IT+ DTGIGI    L+ I   F  + ++ ++   G GLGLAI+  L    GG + + S
Sbjct: 491 LHITVEDTGIGIAPEHLDHIFGEFNQVESETNRKFEGTGLGLAITQRLVERMGGAVWVDS 550

Query: 753 QEGKGT 758
           + GKG+
Sbjct: 551 EPGKGS 556


>gi|294852917|ref|ZP_06793590.1| cell-division control histidine kinase pdhS [Brucella sp. NVSL
            07-0026]
 gi|294821506|gb|EFG38505.1| cell-division control histidine kinase pdhS [Brucella sp. NVSL
            07-0026]
          Length = 1035

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 155/263 (58%), Gaps = 15/263 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT   G++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICM 764
              +  +  I S  G+GT+V I  
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVF 1027


>gi|294495111|ref|YP_003541604.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292666110|gb|ADE35959.1| multi-sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 793

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 154/258 (59%), Gaps = 14/258 (5%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R I ER + E ++   K       AE  ++ KSEF+  MSHELRTPLN+++GFS+V+ KE
Sbjct: 531 RDITERNRAEQALLKGKLI-----AEENDRMKSEFITNMSHELRTPLNSVIGFSDVLLKE 585

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
           I GEL   +  +Y  +I  SG+HLL +IN+IL++SKIE  K+ +  ++ DL  I++E   
Sbjct: 586 IKGELNDSQ-KKYISNISKSGRHLLELINDILDLSKIEEGKMELQCEDFDLNSILSEVES 644

Query: 632 LIGSSAQSKNIKIE----KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
           +    A  K+I ++    +KIP       DK  IK+++F +L+N+IKFT  NG + +   
Sbjct: 645 IFSPQAAKKDINLQFVLSEKIPR---IKGDKIKIKQVIFNLLTNAIKFTPKNGAISVIAK 701

Query: 688 KIGQCVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
           +    +I ++++DTGIGIP++ LE +  PF  +     ++ GG G+GL+++     +H G
Sbjct: 702 ENDDNIIEVSVSDTGIGIPEAKLEDVFDPFIQVDASTSRNYGGTGVGLSLAKKFVQMHDG 761

Query: 747 RLKIISQEGKGTIVTICM 764
           +  + S+  KG+  T  +
Sbjct: 762 KFCVESEVYKGSTFTFTI 779


>gi|126658520|ref|ZP_01729668.1| sensory transduction histidine kinase [Cyanothece sp. CCY0110]
 gi|126620262|gb|EAZ90983.1| sensory transduction histidine kinase [Cyanothece sp. CCY0110]
          Length = 400

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 143/239 (59%), Gaps = 3/239 (1%)

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           K Q + ++ ++ +  KS++L+ +SHELRTPL  ILGFS+++++EI+G L   K  +Y   
Sbjct: 158 KIQSDNQKLQSYSDHKSDYLSHVSHELRTPLAGILGFSKMLREEIYGTLND-KQKQYVNG 216

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           I  SG+HLL ++N+ L++SKIE  K  +  +   +  I    I ++   A  +N+ +  K
Sbjct: 217 IRISGEHLLALVNDFLDLSKIEANKEELFLETVAVEDICLAAISMVQPKADEQNLNLLLK 276

Query: 648 IPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPK 706
           +  ++ F   D+R IK+IL  +LSN+IKFT   G + +   KI   +   + DTGIGI +
Sbjct: 277 LSDQVDFCKVDQRKIKQILINLLSNAIKFTEK-GSVTLEVDKIDCLLTFCVVDTGIGIKE 335

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +K+ QPF+ +H+   +   G GLGLA+S  L  LH G L + S+ GKG+  T+ +P
Sbjct: 336 EDQQKLFQPFQQIHSNLSRKHKGTGLGLALSKKLAQLHQGDLTLQSEYGKGSCFTLELP 394


>gi|51473428|ref|YP_067185.1| histidine kinase sensor protein [Rickettsia typhi str. Wilmington]
 gi|51459740|gb|AAU03703.1| histidine kinase sensor protein [Rickettsia typhi str. Wilmington]
          Length = 498

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 149/257 (57%), Gaps = 11/257 (4%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +RQI+E Q    +  N K Q+ K    +++ TK  F A +SHELRTPLNAI+GFSE++  
Sbjct: 241 ARQIIEEQLA--TNRNLKAQIVKVEKTSSSNTK--FFANISHELRTPLNAIIGFSEIL-- 294

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
               E  + K   Y +DIH +G+HLL+MIN+IL++SK   +K+ +D  + DL  +I+  +
Sbjct: 295 --MSERDTEKSKNYIKDIHDAGKHLLSMINDILDLSKASADKLKVDNIDLDLNKLISSSL 352

Query: 631 RLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK- 688
            LI   A    +++  ++P E +  NAD + +K++L  +LSN++KFTN  G + I   K 
Sbjct: 353 ILIKPRADQAEVELISRLPKEHIVINADPKRLKQVLLNLLSNAVKFTNTGGSVTIALEKD 412

Query: 689 -IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
            + + V I + DTGIGI +  + K    F  + ++  +   G GLGL ++  L  L  G+
Sbjct: 413 ELAKLVYIKVIDTGIGIEEKDIPKTLSEFGQIDSELSRKYEGTGLGLPLTKKLVELMNGK 472

Query: 748 LKIISQEGKGTIVTICM 764
             + SQ  KGT VTI  
Sbjct: 473 FDLQSQINKGTTVTITF 489


>gi|144899289|emb|CAM76153.1| Bacteriophytochrome (light-regulated signal transduction histidine
           kinase) [Magnetospirillum gryphiswaldense MSR-1]
          Length = 753

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 151/271 (55%), Gaps = 15/271 (5%)

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
           E  R L+  +ND      ++ RQ   + + N +   E +RA      KS FLA MSHELR
Sbjct: 491 EIARSLRTALND------VILRQLRTIRLLNLQL-AESDRA------KSRFLAHMSHELR 537

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TPLNA+LGFSE++   I+G++   +  E    +  + +HLLNMIN++L++SKIE     I
Sbjct: 538 TPLNAVLGFSEMLGMGIYGQVVQ-RQSEAIGHVRDAARHLLNMINDVLDLSKIEAGGFDI 596

Query: 616 DKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIK 674
           + +  ++  +     +L+ S  +   + I  ++PS L    AD+R++ +IL  +LSN+IK
Sbjct: 597 EDEELEISALATYAQQLLSSLTREAEVTIRVEVPSALPRLRADRRMLLQILINLLSNAIK 656

Query: 675 FTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGL 734
           FT   G + +   +    + +T+ DTGIGI    L ++ +PF    +  + +  G GLGL
Sbjct: 657 FTPPQGSVHVGCREDASGLCLTVHDTGIGIAADQLARVLEPFRQTEDNMEIARKGTGLGL 716

Query: 735 AISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            I  +L  LHGG + + S  G+GT VT+  P
Sbjct: 717 PIVKSLVELHGGTIHLSSTLGQGTCVTLTFP 747


>gi|150019623|ref|YP_001311877.1| multi-sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
 gi|149906088|gb|ABR36921.1| multi-sensor hybrid histidine kinase [Clostridium beijerinckii
           NCIMB 8052]
          Length = 979

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 154/258 (59%), Gaps = 11/258 (4%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R I E++K   SI  AK     E AE A+K KSEFL+ MSHELRTPLNAILGFS++++ 
Sbjct: 575 TRDITEQKKMARSIITAK-----EEAEKASKAKSEFLSSMSHELRTPLNAILGFSQILEL 629

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           +    L   +  +  ++I  +G HLL +IN IL+++KIE+ K+SI  ++  +  +I E I
Sbjct: 630 DPESPLNPSQ-SQSVKEISKAGSHLLELINEILDLAKIESGKLSISIESVPIKHVIEEAI 688

Query: 631 RLIGSSAQSKNIKIEKKIP---SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS 687
            +I   A    IKI    P   S+ F +AD   +K+IL  +LSN+IK+   +G+++    
Sbjct: 689 SIIKPFADKHKIKI-INYPIDNSDEFVSADHTRLKQILLNLLSNAIKYNKKDGQVIFYHD 747

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
           K+       + DTGIG+  S LE I +PF  L N+ + SI G G+GLA++  LT L  G 
Sbjct: 748 KVNDKYRFHVIDTGIGLSNSDLELIFKPFYRL-NRINNSIEGTGIGLAVAKQLTELMNGE 806

Query: 748 LKIISQEGKGTIVTICMP 765
           + + S++G G+   I +P
Sbjct: 807 IFVTSEKGAGSHFWIELP 824


>gi|209527419|ref|ZP_03275925.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209492154|gb|EDZ92503.1| multi-sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 954

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 142/258 (55%), Gaps = 13/258 (5%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +E  +   K Q      + A + K EFLA MSHELRTPLN ILG SE +K+ I G L   
Sbjct: 548 SERKLMEIKLQKTVAELDRATRLKDEFLANMSHELRTPLNGILGMSEALKQGILGTLNPN 607

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
           +++  A  I  SG+HLL +I++IL++SKIE  K+ +      +  + N  + L+   A +
Sbjct: 608 QHHAIAM-IEKSGKHLLELISDILDLSKIEAGKLELYLTEVSVQELCNSSLTLVNHLAFT 666

Query: 640 KNIKIEKKIPSEL---FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--------- 687
           K I IE  IP +L   F   D R ++++L  +LSN++KFT+  GK+ +            
Sbjct: 667 KQINIESNIPQQLQKTFIKVDNRRLRQVLINLLSNAVKFTHKAGKINLNVGIKPSTNLAI 726

Query: 688 KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGR 747
              Q +  ++ D GIGI    L+K+  PF  + +  ++   G GLGLA+   +  LHGG 
Sbjct: 727 STPQSIYFSVVDNGIGIATDDLDKLFLPFTQIDSSLNRQYSGTGLGLALVKQIIELHGGC 786

Query: 748 LKIISQEGKGTIVTICMP 765
           +++ SQ GKG+  T+ +P
Sbjct: 787 VEVSSQLGKGSCFTVYLP 804


>gi|110633234|ref|YP_673442.1| multi-sensor signal transduction histidine kinase [Mesorhizobium
           sp. BNC1]
 gi|110284218|gb|ABG62277.1| multi-sensor signal transduction histidine kinase [Chelativorans
           sp. BNC1]
          Length = 548

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 140/231 (60%), Gaps = 2/231 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE A +++ E LA +SHELRTPLNAI+GF++++  E+FG+  + K  EY + I  +G HL
Sbjct: 284 AEAACRSRDEMLASVSHELRTPLNAIVGFADLLANEMFGKFANDKQREYVEVIREAGTHL 343

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FF 654
           L+++N IL++SK+++    ++ +       +   + +    AQ+K+++++  I  ++   
Sbjct: 344 LSVVNAILDVSKVQSGAYGVEAKPFHFEDAVRLCMAMTTHQAQAKSVELKADIAGDIGTV 403

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
             DK  ++++L  +LSN++KFT  +G++ +   + G  +  T++DTGIGI    LE +G 
Sbjct: 404 RCDKNAVQQVLINLLSNAVKFT-PSGEVKVTAHRSGDRLEFTVSDTGIGISAEDLELVGT 462

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           PF  + N Y +   G GLGLA+   L  L GG L I S  G+GT V + +P
Sbjct: 463 PFMQVRNDYTRKCEGTGLGLALVKGLVRLQGGGLSIESAPGRGTRVHVSLP 513


>gi|213967062|ref|ZP_03395212.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato T1]
 gi|301385247|ref|ZP_07233665.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato Max13]
 gi|302063302|ref|ZP_07254843.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato K40]
 gi|302130188|ref|ZP_07256178.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|213928384|gb|EEB61929.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato T1]
          Length = 1170

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 164/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA  + Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLAEQSQALADQRDALDRNNEELNIAQGELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLAENPSENL-TAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSSVSRLV-EGLRGLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++ ++ D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFSVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I T+ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFTLVLPE 718


>gi|20092182|ref|NP_618257.1| sensory transduction histidine kinase [Methanosarcina acetivorans
            C2A]
 gi|19917410|gb|AAM06737.1| sensory transduction histidine kinase [Methanosarcina acetivorans
            C2A]
          Length = 1447

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 142/235 (60%), Gaps = 2/235 (0%)

Query: 532  EKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYS 591
            EK+ AE AN+TK++FLA MSHELRTPLN+I+GFS+++ ++ +GEL   K      +I  S
Sbjct: 1202 EKQMAEIANRTKNDFLANMSHELRTPLNSIIGFSDMLYEQAYGELNR-KQLRAIGNISSS 1260

Query: 592  GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
            G+HLLN+IN IL++SKIE  K+ ++ +  DL   +     ++   A  KNI IE  + +E
Sbjct: 1261 GKHLLNLINGILDLSKIEANKMELNYREFDLATKLELIRNVLYPVADKKNIDIEIDMDTE 1320

Query: 652  LF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
            L    AD+    +I++ ++ N+IKF+  N  + I   K G  V IT+ D GIGI      
Sbjct: 1321 LTKICADEEKFTRIMYNLVDNAIKFSYENSLVKIGARKNGNLVEITVTDAGIGIKAEDQH 1380

Query: 711  KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            K+ +PF  +++   +   G GLGL++   + NLHGG +   S++G+G+     +P
Sbjct: 1381 KLFKPFSQVNSFPSKKFQGTGLGLSLVKQIVNLHGGYVWFRSEQGEGSTFAFAIP 1435


>gi|330967661|gb|EGH67921.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 1170

 Score =  159 bits (402), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 164/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA  + Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLAEQSQALADQRDALDRNNEELNIAQGELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLAENPSENL-TAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSSVSRLV-EGLRGLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++ ++ D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFSVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I T+ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFTLVLPE 718


>gi|28869899|ref|NP_792518.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|28853144|gb|AAO56213.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. tomato str. DC3000]
          Length = 1170

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 164/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA  + Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLAEQSQALADQRDALDRNNEELNIAQGELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLAENPSENL-TAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSSVSRLV-EGLRGLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++ ++ D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFSVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I T+ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFTLVLPE 718


>gi|330875153|gb|EGH09302.1| sensor histidine kinase/response regulator [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 1170

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 164/285 (57%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA  + Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLAEQSQALADQRDALDRNNEELNIAQGELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLAENPSENL-TAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R     L      +  + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEVRPENSSVSRLV-EGLRGLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  ++ ++ D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGAVSMVVSRQPGAGIVFSVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I T+ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFTLVLPE 718


>gi|21229201|ref|NP_635123.1| two component system histidine kinase [Methanosarcina mazei Go1]
 gi|20907770|gb|AAM32795.1| Two component system histidine kinase [Methanosarcina mazei Go1]
          Length = 707

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 151/259 (58%), Gaps = 7/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T  +I ER+K E+ +  AK     + AE AN  KSEFLA MSHELRTPLN+I+GFS++
Sbjct: 452 LETGVEITERKKYEIELFRAK-----QDAEVANYAKSEFLANMSHELRTPLNSIIGFSDL 506

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +  +++GEL + +  +   +I  SG+HLLN+IN IL++SK+E     +      L  +  
Sbjct: 507 LHDKVYGELNA-RQLKAVGNISGSGKHLLNLINEILDLSKVEAGGFELHYSTFWLADVFA 565

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           E   ++   A SK IK+E +I  +L     D+  I ++L  +++N++KF+N N  + ++ 
Sbjct: 566 EVRDMLFPFAASKGIKLELEIEKDLPGIYGDRERITQVLSNLMTNAVKFSNENSCVRVKA 625

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
           S+    + ++++D GIGI     +K+ +PF  + +   +   G GLGLA+   +  LHGG
Sbjct: 626 SQNNNFIEVSVSDEGIGIAAEDHDKLFKPFSQIDSSSSRKYQGTGLGLALVKEIVQLHGG 685

Query: 747 RLKIISQEGKGTIVTICMP 765
            +   S+ GKG+     +P
Sbjct: 686 AVWFKSEVGKGSTFGFSIP 704


>gi|119487927|ref|ZP_01621424.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
 gi|119455503|gb|EAW36641.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
          Length = 1524

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 157/290 (54%), Gaps = 9/290 (3%)

Query: 479  SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAET 538
            S G  + + K     L E    L  +   +   R I ER++ E+ +     Q+E+     
Sbjct: 1077 SRGEALAIRKDGSTFLEEFSLTLTNSGEFVCVCRDITERKRAEVELRRTNAQLER----- 1131

Query: 539  ANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNM 598
            A + K EF+A MSHELRTPL +ILG SEV+++E++G L + +    +  I  SGQHLL +
Sbjct: 1132 ATRLKDEFMANMSHELRTPLYSILGLSEVLQQEVYGVLNAEQLRSLS-TIEQSGQHLLEL 1190

Query: 599  INNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE-KKIPSELFFNAD 657
            IN IL++SKIE+ K+ +     +L  +    +  +   A  KNI+++    P  +  N D
Sbjct: 1191 INEILDLSKIESGKMELQLSAVNLTQLCQSSLNFVKPQADQKNIQLQFIATPVPVIINID 1250

Query: 658  KRIIKKILFPILSNSIKFT--NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQP 715
            +  I+++L  +LSN++KFT   N+  + I T     CV +++ DTGIGI      ++ +P
Sbjct: 1251 ELRIRQVLINLLSNAVKFTPEGNHILLKIETEPQNNCVHLSVTDTGIGIAPEDQVRLFEP 1310

Query: 716  FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            F  + +   +   G GLGLA+   +T +H G + + S+ G+G+   + +P
Sbjct: 1311 FVQIDSSLSRRYSGTGLGLALVRQITQMHAGTVSLDSEVGRGSTFIVTLP 1360


>gi|170739808|ref|YP_001768463.1| multi-sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
 gi|168194082|gb|ACA16029.1| multi-sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
          Length = 975

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 149/254 (58%), Gaps = 8/254 (3%)

Query: 513 QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
           +++ER++ E S+  AK     E AE A++ KS FLA MSHELRTPLNAI+GF+ ++ +  
Sbjct: 452 RVIERKRAEESLRQAK-----EAAEDASRAKSSFLANMSHELRTPLNAIIGFTRLVMRRA 506

Query: 573 FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
              L   K +E  + I  S +HLL++IN+IL+++K+E  ++ +      L P+++  +R 
Sbjct: 507 KEAL-PTKQFENLEKILASSEHLLSLINSILDLAKVEAGRMEVKASEFALEPVLDLCLRT 565

Query: 633 IGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
           +    +S+ +++ + +         D+  +++IL  +LSN+IKFT   G + +R    G+
Sbjct: 566 VEPLIKSEGVRLVRDVEDPPTMLRTDEEKLRQILINLLSNAIKFTEA-GSVTLRVRSAGE 624

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            V   + DTGIGIP+ AL  I   F  + N   +S  G GLGLAIS  L  L GG + + 
Sbjct: 625 HVEFAVTDTGIGIPQEALSAIFDEFHQVDNSATRSHSGTGLGLAISHRLARLLGGHIDVE 684

Query: 752 SQEGKGTIVTICMP 765
           S+ G+G+  T+ +P
Sbjct: 685 SRVGQGSTFTLSIP 698



 Score = 65.5 bits (158), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 74/133 (55%), Gaps = 11/133 (8%)

Query: 380 ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPI 439
           A Q+L +AIE +SE   L+D +DRLV+CN +++  +     V+VPG +   I  A     
Sbjct: 32  AKQKLIEAIESSSEGFALFDPDDRLVLCNDHFRDFHPGLAEVIVPGASFQTIARAAAESC 91

Query: 440 I---EYRTSDPERSQDMS--KEIKLA------DSRWLQINEWCTHDGGTISVGTDITLLK 488
           I   E  T +   ++ M+  +E + +      D RW+Q++E  T+DGG ++V TD+T +K
Sbjct: 92  IVHKEGTTVEAWLAERMAHYREPRGSILQQRVDGRWVQVSERKTNDGGVVAVYTDVTEIK 151

Query: 489 HNQAQLRESKRRL 501
             +  +  ++ RL
Sbjct: 152 RAEQVVLTTQGRL 164


>gi|148559609|ref|YP_001259471.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
 gi|223635610|sp|A5VRX4|PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase pdhS
 gi|148370866|gb|ABQ60845.1| sensory box histidine kinase [Brucella ovis ATCC 25840]
          Length = 1035

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 155/264 (58%), Gaps = 15/264 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
            R I + ++TE  + NA+ +     AE A+  K+EFLA++SHE+RTPLNAI+GFSE++  E
Sbjct: 770  RDITQWKRTEEELTNARKE-----AERASNQKTEFLARISHEIRTPLNAIIGFSELMADE 824

Query: 572  IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
             FG +G+ +Y +Y +DI+ SG H+L ++N++L++SKIE   + +  +   L   I E I 
Sbjct: 825  KFGPIGNDRYRDYLRDINRSGNHVLALVNDLLDISKIEAGALDMQFEAVSLNDAIGEAIA 884

Query: 632  LIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS-KI 689
            L+   A  + + I     S L    AD R IK++   +LSN+++FT    ++++ TS ++
Sbjct: 885  LMQPQANRERVIIRSSFQSNLPDIVADSRSIKQVALNLLSNAVRFTAPGRQVIVSTSYEL 944

Query: 690  GQCVIITIADTGIGIPKSALEKIGQPFEPLH--------NQYDQSIGGFGLGLAISDALT 741
               V++ + DTGIG+ KS +E+  +PF  ++        +  D    G GLGL ++ A+ 
Sbjct: 945  NGDVVMRVRDTGIGMSKSEVEQALKPFRQINALERRKAESAKDWRNEGTGLGLPLTKAMV 1004

Query: 742  NLHGGRLKIISQEGKGTIVTICMP 765
              +  +  I S  G+GT+V I  P
Sbjct: 1005 EANRAQFAIDSNPGQGTVVEIVFP 1028


>gi|186684847|ref|YP_001868043.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186467299|gb|ACC83100.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 738

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 157/259 (60%), Gaps = 8/259 (3%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L+    I ER++TEL     K +  +E AE A++ K+EFLA MSHELRTPLNAI+G S++
Sbjct: 332 LAMIEDITERKETEL-----KLRASQEAAEAASRAKTEFLATMSHELRTPLNAIMGLSQL 386

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +++EI G L   K  EY   I+ SG+HLL +IN+IL++SK+E  K  +      +  + N
Sbjct: 387 LQQEIVGSLNE-KQNEYVSCIYSSGEHLLALINDILDLSKVEEGKEELLLSPLPVSDLCN 445

Query: 628 EGIRLIGSSAQSKNIKIEKKIP-SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
             I  +   A  K +K+  KI   E    AD+R IK++L  +L+N+IKFT   G + +  
Sbjct: 446 YAIWTVRDRASEKGLKLTYKIDLQEDICIADERRIKQMLLNLLTNAIKFT-PVGNVSLVV 504

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            K+ Q +  T++DTGIGI  +  + + +PF+ L ++ ++   G GLGLA++  L  LHGG
Sbjct: 505 KKVPQGITFTVSDTGIGIDPNQFQFLFEPFKQLDSRLNRQYEGTGLGLALTRKLARLHGG 564

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S  G+G+  T+ +P
Sbjct: 565 DVTVTSTLGEGSQFTLFLP 583


>gi|291279597|ref|YP_003496432.1| hypothetical protein DEFDS_1208 [Deferribacter desulfuricans SSM1]
 gi|290754299|dbj|BAI80676.1| hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 816

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 163/277 (58%), Gaps = 10/277 (3%)

Query: 493 QLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSH 552
           +L E  R L+A   +L    + LE Q  EL +   + +   +R     + K+EF+A MSH
Sbjct: 237 ELDEKNRILEAQNRELQAQSEELEAQTEELKVQKIELEEYSKRLNKLQQYKNEFIANMSH 296

Query: 553 ELRTPLNAILGFSEVIKK--EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIET 610
           ELRTPLN+I+G +E+I K  ++  EL      E  + I+ SG+ LLN+IN+IL++SKIE+
Sbjct: 297 ELRTPLNSIVGLTELILKNNQLDNELK-----EKLKIINLSGKQLLNIINDILDLSKIES 351

Query: 611 EKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF-NADKRIIKKILFPIL 669
            KI ++ +  DL   I+    +I      KNI  +    ++ +  N DK  + +IL  +L
Sbjct: 352 GKIDLEIEEIDLTETIDYVSNIIKPQCNEKNISFKVIFKAKNYLINTDKYKLTQILLNLL 411

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGG 729
           SNS+K+T  NG + +   +  + +II + DTGIGIP+  ++ + +PF  +  ++  ++ G
Sbjct: 412 SNSVKYTEENGLIELIIEEDTKYIIIHVKDTGIGIPEDLMQNLFEPFVTMGRKF--NVQG 469

Query: 730 FGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            GLGL ++  L NL GG++ + S+ G+GTI T+ +P+
Sbjct: 470 TGLGLPLTKKLVNLLGGKIAVKSKVGEGTIFTVYIPK 506


>gi|46202248|ref|ZP_00053520.2| COG0642: Signal transduction histidine kinase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 454

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 139/256 (54%), Gaps = 6/256 (2%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R I +R++ E ++ +AK +     AE AN+ KS+FLA MSHELRTPLNA++GFSE I  
Sbjct: 198 GRDITQRKRAEAALVSAKQE-----AEAANRAKSQFLATMSHELRTPLNAVIGFSEAILA 252

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
              G     +  EY + IH +GQHL  +I +IL++S+IE  +  +D+++ D   ++    
Sbjct: 253 GAAGPASLERCVEYMELIHSAGQHLRALIEDILDVSRIEAGRTELDEEDCDPTELVRAAA 312

Query: 631 RLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
           RL+   +    +     I P       D R I++IL  +  N++KFT   GK+ I  + +
Sbjct: 313 RLLEHKSVVSGVDFTVVIAPGLPRMRLDPRRIRQILLNLAGNALKFTPTGGKVGICATLV 372

Query: 690 GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
              + + ++DTGIGI      KI Q F    +   +   G GLGLAI       HGG + 
Sbjct: 373 PDGLALVVSDTGIGIAPEHHAKIWQAFYQADSSLSRRHQGSGLGLAIVRHFVEAHGGTVS 432

Query: 750 IISQEGKGTIVTICMP 765
           + S  G+GT +T+ +P
Sbjct: 433 LDSAPGQGTRITVLLP 448


>gi|17230612|ref|NP_487160.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
 gi|17132215|dbj|BAB74819.1| two-component hybrid sensor and regulator [Nostoc sp. PCC 7120]
          Length = 1286

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 154/266 (57%), Gaps = 15/266 (5%)

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKT--KSEFLAKMSHELRTPLNAILGFSEVIK 569
            +++ ER + EL +  +  Q+     E A  T  K EFLA MSHELRTPLNAILG +E ++
Sbjct: 866  QELAERHQAELKLTQSNQQLAISNQELARATRLKDEFLANMSHELRTPLNAILGMTEGLQ 925

Query: 570  KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            + +FG + + K ++  + I  S  HLL++IN+IL+++KIE  +I +D     +  +    
Sbjct: 926  EGVFGMINN-KQFKALETIERSSSHLLDLINDILDVAKIEAGQIKLDCTTISVANLCESS 984

Query: 630  IRLIGSSAQSKNIKIEKKIP---SELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            +  I   A  K I++E KIP    +LF   D+R I+++L  +L+N++KFT   G++ +  
Sbjct: 985  LVFIKQQALQKRIQVEIKIPFNLPDLF--VDERRIRQVLINLLNNAVKFTPEAGRISLEV 1042

Query: 687  SKIGQCVI-------ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
            +++   +        I + DTGIGI +  + K+ QPF  + +  ++   G GLGLA+   
Sbjct: 1043 TQLSPDISTVQNFLQIAVIDTGIGIMQENINKLFQPFIQIDSALNRQYEGTGLGLALVKK 1102

Query: 740  LTNLHGGRLKIISQEGKGTIVTICMP 765
            +  LHGGR+ + S+ G G+  TI +P
Sbjct: 1103 IVELHGGRVGLTSELGIGSCFTIELP 1128


>gi|308270675|emb|CBX27286.1| hypothetical protein N47_I07060 [uncultured Desulfobacterium sp.]
          Length = 701

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 127/484 (26%), Positives = 246/484 (50%), Gaps = 43/484 (8%)

Query: 304 RLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGI 363
           +L+   +K + ++ + V   + + L +      A     W+++    +  ++G + ++ +
Sbjct: 232 KLLAAIDKHLSDLKKDVQSAYYESLKKWSSEDVAFNLPAWVKI----LGLVAGAVLLVSL 287

Query: 364 AMDLTEKYHLEKRYAE--ADQRLSKAIECTSEALVL-WDKNDRLVMCNANYQKAYG---- 416
              +  K+ +  R  E  A +R  + +   + +++L W  + R+   N   Q+ +G    
Sbjct: 288 LGSIILKHQVNARTHELRASERKYRELVMLANSIILRWSDDGRITFLNEFGQRFFGYSET 347

Query: 417 --LPDHVL---VPGNARSIIQDAQTRPIIEYRTSDPER-----SQDMSKEIKLADSRWLQ 466
             L  HV+   VP N  +       RP++E   +DP++     +++M +  +     W  
Sbjct: 348 EILGQHVIGTIVPENETT---GRNLRPLMEDILADPQKFERNINENMRRNCERVWIDW-- 402

Query: 467 INEWCTHDGGTI----SVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTEL 522
            N+    + G I    S+G+DIT    ++ Q  E   RL    NDL    + LE++  + 
Sbjct: 403 TNKVVLDESGRIKEILSIGSDIT----DRKQAEEQISRLN---NDLRRHAKELEQRVADR 455

Query: 523 SIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYY 582
           +   A+  + KERAE+A++ K  FLA MSHELRTPLN+I+GF+ ++ +E+ G L   +  
Sbjct: 456 T---AELVIAKERAESADRIKPAFLATMSHELRTPLNSIIGFTGIMLQELAGPLNEEQRK 512

Query: 583 EYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNI 642
           +    +  S +HLL++IN++L++SKIE  ++ +   + +L P I + ++L+   A+ K +
Sbjct: 513 QLTM-VQSSSRHLLSLINDVLDISKIEAGQLELSVTSFELRPSIEKMVKLVLPMAKKKGL 571

Query: 643 KIEKKIPSELFFNA-DKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTG 701
            +   I  ++   A D+R +++++  +L+N++KFT   G + I         +++++DTG
Sbjct: 572 DLRVYIADDINTAATDQRRLEQVVLNLLNNAVKFT-EKGYVHISCRIENDKYLLSVSDTG 630

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
            GI    L  + QPF  +     +   G GLGL+I   L ++ GG + + SQ GKG+   
Sbjct: 631 TGIRPEELSGLFQPFHQIDTGLTRKYEGTGLGLSICKRLLDMMGGTIDVQSQWGKGSTFI 690

Query: 762 ICMP 765
           +  P
Sbjct: 691 VRFP 694


>gi|192290456|ref|YP_001991061.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris TIE-1]
 gi|192284205|gb|ACF00586.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris TIE-1]
          Length = 610

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 132/224 (58%), Gaps = 1/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA MSHELRTPLNAI+GFS++I ++    LG  +  EYAQ I+ SGQHLL+++N I
Sbjct: 356 KSRFLATMSHELRTPLNAIIGFSDMILQDDVLMLGPERRKEYAQLINDSGQHLLSVVNGI 415

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRII 661
           L+MSK+E+    I  +     P +     L+   A+   I +  + P  L     D R  
Sbjct: 416 LDMSKMESGSFEIVPEPFAPRPALLNCCNLLALKARDSGIDLVTRAPENLPEVVGDPRAF 475

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           K+IL  ++SN+IKFT   G + +  +  G  +++ + DTG+GI +  L+++G PF     
Sbjct: 476 KQILLNLVSNAIKFTERGGTVTVSAAVEGTRLVLRVTDTGVGIAEEDLKRLGDPFFQAGK 535

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGL+I  +L  +HGG +++ SQ   GT VT+ +P
Sbjct: 536 TYQRRHEGTGLGLSIVKSLVRMHGGEIEVQSQIDCGTTVTVSLP 579


>gi|39934927|ref|NP_947203.1| sensor histidine kinase [Rhodopseudomonas palustris CGA009]
 gi|39648777|emb|CAE27299.1| sensor histidine kinase with a PAS domain [Rhodopseudomonas
           palustris CGA009]
          Length = 610

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 132/224 (58%), Gaps = 1/224 (0%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA MSHELRTPLNAI+GFS++I ++    LG  +  EYAQ I+ SGQHLL+++N I
Sbjct: 356 KSRFLATMSHELRTPLNAIIGFSDMILQDDVLMLGPERRKEYAQLINDSGQHLLSVVNGI 415

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRII 661
           L+MSK+E+    I  +     P +     L+   A+   I +  + P  L     D R  
Sbjct: 416 LDMSKMESGSFEIVPEPFAPRPALLNCCNLLALKARDSGIDLVTRAPENLPEVVGDPRAF 475

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           K+IL  ++SN+IKFT   G + +  +  G  +++ + DTG+GI +  L+++G PF     
Sbjct: 476 KQILLNLVSNAIKFTERGGTVTVSAAVEGTRLVLRVTDTGVGIAEEDLKRLGDPFFQAGK 535

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            Y +   G GLGL+I  +L  +HGG +++ SQ   GT VT+ +P
Sbjct: 536 TYQRRHEGTGLGLSIVKSLVRMHGGEIEVQSQIDCGTTVTVSLP 579


>gi|67923164|ref|ZP_00516653.1| ATP-binding region, ATPase-like:Histidine kinase A, N-terminal
           [Crocosphaera watsonii WH 8501]
 gi|67855006|gb|EAM50276.1| ATP-binding region, ATPase-like:Histidine kinase A, N-terminal
           [Crocosphaera watsonii WH 8501]
          Length = 445

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/239 (36%), Positives = 145/239 (60%), Gaps = 3/239 (1%)

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           K ++E ++ +++   KS++ + +SHELRT L  ILG S+++K+E++G L   K  EY   
Sbjct: 197 KIELENKQLKSSKNNKSDYFSHVSHELRTTLAGILGLSKMLKQELYGPLNE-KQKEYVNG 255

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           I  SG+HLL ++N+ L++SKIE +K  +  +N  +  I    I +I   A  +NI I  K
Sbjct: 256 IRVSGEHLLALVNDFLDLSKIEADKEELFLENVTVEDICLATISIIQPKADEQNIDIILK 315

Query: 648 IPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPK 706
           +  ++ F   D+R IK+IL  ++SN+IKFT   G + ++  K+   +   + DTGIGI +
Sbjct: 316 VSEQVDFCTVDQRKIKQILINLMSNAIKFTEE-GSVTLQVEKVDNWLKFCVIDTGIGIKE 374

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +K+ QPF+ +H++  +   G GLGLA+S  L  LH G L + S+ GKG+  T+ +P
Sbjct: 375 EDQKKLFQPFQQIHSKLSRQHKGTGLGLALSRKLAQLHEGELTLTSEYGKGSCFTLELP 433


>gi|148284508|ref|YP_001248598.1| PleC-like histidine kinase [Orientia tsutsugamushi str. Boryong]
 gi|146739947|emb|CAM79973.1| PleC-like histidine kinase [Orientia tsutsugamushi str. Boryong]
          Length = 515

 Score =  158 bits (399), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 141/243 (58%), Gaps = 6/243 (2%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN   +  +++AE  N  K++FLA +SHELRTPL+AI+G +E+I   +      + YY Y
Sbjct: 273 ANKYLEQARQKAEKENIAKNKFLANVSHELRTPLSAIIGLTEII---LSNSHCKINYYNY 329

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK- 643
            +DIH SG+HLL +IN+IL+ SK    K++++    DL  +    +RL+ + A+   IK 
Sbjct: 330 IRDIHNSGKHLLAVINDILDFSKASANKLTVENVAVDLNKLAASSLRLMYTKAKKAGIKL 389

Query: 644 IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--KIGQCVIITIADTG 701
           I K  P ++  NAD + +K+ LF +LSNSIKFT + G + +  S  ++   V I + DTG
Sbjct: 390 ISKFPPDQIIINADAKRLKQALFNLLSNSIKFTPSKGSITLEISMNELKSLVYIKVIDTG 449

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  + K    FE ++N       G GLGL ++  L  L  G  +I S  G+GT VT
Sbjct: 450 IGIAEQDIPKALSSFEQVNNNLSNQREGTGLGLPLTKKLIYLMEGDFEITSNIGQGTTVT 509

Query: 762 ICM 764
           I  
Sbjct: 510 ITF 512


>gi|189183162|ref|YP_001936947.1| histidine kinase sensor protein [Orientia tsutsugamushi str. Ikeda]
 gi|189179933|dbj|BAG39713.1| histidine kinase sensor protein [Orientia tsutsugamushi str. Ikeda]
          Length = 503

 Score =  158 bits (399), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 141/243 (58%), Gaps = 6/243 (2%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN   +  +++AE  N  K++FLA +SHELRTPL+AI+G +E+I   +      + YY Y
Sbjct: 256 ANKYLEQARQKAEKENIAKNKFLANVSHELRTPLSAIIGLTEII---LSNSHCKINYYNY 312

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK- 643
            +DIH SG+HLL +IN+IL+ SK    K++++    DL  +    +RL+ + A+   IK 
Sbjct: 313 IRDIHNSGKHLLAVINDILDFSKASANKLTVENVAVDLNKLAASSLRLMYTKAKKAGIKL 372

Query: 644 IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--KIGQCVIITIADTG 701
           I K  P ++  NAD + +K+ LF +LSNSIKFT + G + +  S  ++   V I + DTG
Sbjct: 373 ISKFPPDQIIINADAKRLKQALFNLLSNSIKFTPSKGSITLEISMNELKSLVYIKVIDTG 432

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI +  + K    FE ++N       G GLGL ++  L  L  G  +I S  G+GT VT
Sbjct: 433 IGIAEHDIPKALSSFEQVNNNLSNQREGTGLGLPLTKKLIYLMEGDFEITSNIGQGTTVT 492

Query: 762 ICM 764
           I  
Sbjct: 493 ITF 495


>gi|75907391|ref|YP_321687.1| multi-sensor signal transduction histidine kinase [Anabaena
           variabilis ATCC 29413]
 gi|75701116|gb|ABA20792.1| multi-sensor signal transduction histidine kinase [Anabaena
           variabilis ATCC 29413]
          Length = 676

 Score =  158 bits (399), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 164/301 (54%), Gaps = 12/301 (3%)

Query: 469 EWCTHDGGT-ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANA 527
           +W   D    IS+   + +  H      E  R L+   + L+  +  LE++  E ++A  
Sbjct: 378 QWNDSDKNLLISIAEQLAIAIHQS----ELMRSLQDAAHRLTQEKHTLEQRVIERTMALR 433

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
              +    AE A++ +SEFLA +SHEL TPL  ++G S  + +   GEL S +  +Y Q 
Sbjct: 434 DALLA---AEAASRLRSEFLATISHELLTPLTYVIGMSSTLLRWPLGEL-SQRQRDYLQT 489

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK--NIKIE 645
           IH SG+HLL+MIN+IL++S+IE  K  ++     LI +    I  +   A S+  N+K++
Sbjct: 490 IHDSGEHLLDMINDILDLSQIEAGKTVLNIAEFSLIKVAENTIESLVEKALSEKVNLKLD 549

Query: 646 KKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
            +I P    F AD   I++IL+ +L+N+IKFT   G + +R        I  + DTGIGI
Sbjct: 550 LQIDPRRDRFTADAARIEQILWNLLTNAIKFTPEGGNVTLRVWVEEDTSIFQVEDTGIGI 609

Query: 705 PKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           P+  L  + + F+ L   Y +   G GLGLA++  L  LH GR+++ S  G G+I T+ +
Sbjct: 610 PEEQLPLLFEKFQQLDTPYRRRYEGTGLGLALTKQLVELHRGRIEVESTVGIGSIFTVWI 669

Query: 765 P 765
           P
Sbjct: 670 P 670


>gi|148547224|ref|YP_001267326.1| multi-sensor hybrid histidine kinase [Pseudomonas putida F1]
 gi|148511282|gb|ABQ78142.1| multi-sensor hybrid histidine kinase [Pseudomonas putida F1]
          Length = 1155

 Score =  158 bits (399), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 96/286 (33%), Positives = 165/286 (57%), Gaps = 9/286 (3%)

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
           +LK +QA L   +  L+ T   LS     L+R+  ELS A  + Q   +  + ++K KSE
Sbjct: 430 VLKESQAHLETQQAELEQTNEQLSERTDALDRKNDELSQAQLELQARADDLQRSSKYKSE 489

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLN+ L  ++++ +   G L S +  ++A+ I+ +G  LLN+IN+IL++
Sbjct: 490 FLANMSHELRTPLNSSLILAKLLAENGEGNL-SEEQVKFAESIYSAGNDLLNLINDILDI 548

Query: 606 SKIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +K+E  K+ +  +   +  ++ EG+R     L G    +  +K+E ++P  LF   D++ 
Sbjct: 549 AKVEAGKLEVRPETTQVERLV-EGLRGMFQPLAGHKGLAFEVKVEPQVPVTLF--TDRQR 605

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           +++IL  +LSN+IKFT      M  + + G  ++  + DTGIGI     + I   F  + 
Sbjct: 606 LEQILKNLLSNAIKFTERGQVSMNVSFQAGSGIVFAVRDTGIGIAADQQQAIFGAFHQVD 665

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
              ++  GG GLGL+IS  L +L GG++ + S  G+G++ ++ +P+
Sbjct: 666 GTSNRRYGGTGLGLSISRDLAHLLGGQINVESSPGQGSVFSLILPE 711


>gi|258591257|emb|CBE67554.1| putative Histidine kinase [NC10 bacterium 'Dutch sediment']
          Length = 981

 Score =  158 bits (399), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 123/463 (26%), Positives = 218/463 (47%), Gaps = 72/463 (15%)

Query: 351 MRTISGGMNIIGIAMDLT-------EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           +R++ G  + + +A++ T       ++  LE+    + Q     ++ T +A+++ D + R
Sbjct: 533 VRSMEGFASQLAVALEQTRLREEAKDRRGLEEALYASRQLFQAVVQSTPDAVIVADGSTR 592

Query: 404 LVMCNANYQKAY--------GLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSK 455
           +V CNA  Q+ +        G+P   LVP   R   +    R              +++ 
Sbjct: 593 IVACNAGAQRLFGYTEGELQGMPVMALVPERYRETHRQGLDR-------------FEVTG 639

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQIL 515
           E ++   R ++++     DG  + V   +   K         +    A ++D++  +Q  
Sbjct: 640 EARVI-GRTIEVDA-LRKDGSDVPVELSLAGWKTG------DRVFYSAILHDITERKQYT 691

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
              +  +       +   ++ E A++ KSEFLA MSHE RTPLN+I+GFS++++   FG 
Sbjct: 692 THLEQTVQEKTRTLRAANQQLEAASRHKSEFLANMSHEFRTPLNSIIGFSDILRDPAFGP 751

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           L + K   +AQ+I  SGQHLL++IN++L++SK+E  KI +  +  +    I   +  +  
Sbjct: 752 L-TEKQARFAQNIQVSGQHLLSLINDLLDLSKVEAGKIDLHPEPFECREAIRAALAEVQP 810

Query: 636 SAQSKNIKIEKKI---PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK---- 688
            A  K +++  +    PS +   AD    K+IL  +LSN++KFT   G++ +   +    
Sbjct: 811 QADLKQLELTPQTDEAPSTII--ADPVRFKQILLNLLSNAVKFTPEGGRITVTVRRAARQ 868

Query: 689 ---------IGQ--------------CVI--ITIADTGIGIPKSALEKIGQPFEPLHNQY 723
                     GQ              C +  I +ADTGIGI    L ++ Q F  L    
Sbjct: 869 EEGDTSQGAAGQGLEILHSTPHTPHPCDVLEIAVADTGIGIKPDDLPRLFQEFTRLDAAI 928

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKGTIVTICMP 765
            +   G GLGLA++  L  LHGG +  +S  EG+G+  T+ +P
Sbjct: 929 AKRTKGTGLGLALTKRLVELHGGEIAAVSDGEGRGSTFTVRLP 971


>gi|220907215|ref|YP_002482526.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219863826|gb|ACL44165.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1501

 Score =  157 bits (398), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 136/549 (24%), Positives = 262/549 (47%), Gaps = 63/549 (11%)

Query: 239  QAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLS 298
            Q +K  E++  L E+   ++ A   GR G W++N    +   S  ++ ++ +  ++    
Sbjct: 846  QERKRVEDE--LRESEQRLQLAQQAGRIGTWDWNLLTNEVSWSDGIWPLLALEPKSVKPD 903

Query: 299  FRAIARLIHYDNKKICEIARSVTGKHVKQLDQI--FHMRHASGADIWIQVRAQMMRTISG 356
                   IH ++++  +  R+V     +  D    F +    GA  W+  + +++RT  G
Sbjct: 904  LETFTHFIHPEDRE--QAFRTVKLALAEGDDYYDEFRVIRQDGAICWLLSKGRVIRTPEG 961

Query: 357  -GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAY 415
                ++GI +D+T++   E+   ++++RL  A+  +   +  WD  ++ +  +    + +
Sbjct: 962  QPQRLLGINVDITDRKQAEEALRQSEERLRLALLVSQSGIWDWDIVNKQITWSERIYQFH 1021

Query: 416  GL-PD---------HVLVPGNARSIIQDAQTRPI-------IEYRTSDPERSQDMSKEIK 458
            GL PD           L+    R  +  A  R +       +E+R   P      S  I+
Sbjct: 1022 GLTPDTFGGTVAEFAALIHPEDRERVAAAIQRALAGESSYELEFRAVQP------SGAIR 1075

Query: 459  LADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQ 518
                       W +  GG I              Q  +  R L AT ND+ T R+ +E +
Sbjct: 1076 -----------WLSTTGGVIF------------DQQGQPVRMLGAT-NDI-TDRKAIEAE 1110

Query: 519  KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS 578
            +  L ++  +    +E AE+AN+ K EFLA +SHELR+PLN ILG++++++   F     
Sbjct: 1111 RERLLLSERRC---REAAESANRIKDEFLAVLSHELRSPLNPILGWTKLLQTRPFD---P 1164

Query: 579  VKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQ 638
             +  +  Q I  + +    +I ++L++S+I   K+ ++    +LI  I   +  +  +A+
Sbjct: 1165 QRTQQALQTIERNAKLQTQLIEDLLDISRILQGKMVLNTSPVNLITTIEAALDTVRLAAE 1224

Query: 639  SKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITI 697
            +K I+++  + P+      D   +++I++ +L+N++KFT   GK++IR  ++     I +
Sbjct: 1225 TKGIELQTCLSPAVGRVYGDSTRLQQIVWNLLTNAVKFTPAGGKVLIRLEQVDSFAQIQV 1284

Query: 698  ADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGK 756
             DTG GI  + L  + + F    +Q  +  GG GLGLAI   LT  HGG +++ S+ E +
Sbjct: 1285 QDTGKGISPAFLPHVFEYFRQEDSQTTRKFGGLGLGLAIVRYLTEQHGGTVEVESRGEDQ 1344

Query: 757  GTIVTICMP 765
            G   T+ +P
Sbjct: 1345 GASFTVHLP 1353


>gi|66045681|ref|YP_235522.1| response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|63256388|gb|AAY37484.1| Response regulator receiver:GAF:ATP-binding region,
           ATPase-like:Histidine kinase A, N-terminal:CHASE3
           [Pseudomonas syringae pv. syringae B728a]
          Length = 1172

 Score =  157 bits (398), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 167/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALAEQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRTLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  +   + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGSVSMVVSRQPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|330971298|gb|EGH71364.1| response regulator receiver [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 1172

 Score =  157 bits (398), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 167/285 (58%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  L+R   EL+IA A+ Q   +  + A+K KSEF
Sbjct: 438 LETQQAELEQTNEQLADQSQALAEQRDALDRNNEELNIAQAELQARADELQRASKYKSEF 497

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++  E  GE  + +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 498 LANMSHELRTPLNSSLILAKLLA-ENPGENLTAEQVKFAESIYSAGNDLLNLINDILDIS 556

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGS--SAQSK---NIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  ++ EG+R +    +A+ K    + I+   P+ LF   D++ +
Sbjct: 557 KVEAGKLEMRPENSSVSRLV-EGLRTLFQPLAAEKKLAFTVDIQAGAPTMLF--TDRQRL 613

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      M+ + + G  +   + D+GIGI +   + I + F     
Sbjct: 614 EQILKNLLSNAIKFTEAGSVSMVVSRQPGAGIAFIVRDSGIGIAEEHQQGIFEAFRQADG 673

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S  G+G+I ++ +P+
Sbjct: 674 TTNRRYGGTGLGLSISRDLAALLGGSISVTSAPGQGSIFSLVLPE 718


>gi|220925051|ref|YP_002500353.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
 gi|219949658|gb|ACL60050.1| PAS/PAC sensor signal transduction histidine kinase
           [Methylobacterium nodulans ORS 2060]
          Length = 969

 Score =  157 bits (398), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 156/272 (57%), Gaps = 13/272 (4%)

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
           E  RR  A + D++ +R      +TE  +  AK       AE AN  KS+FLA +SHE+R
Sbjct: 702 EGTRRFSALLRDVTAAR------RTEAELLRAKRA-----AEAANSQKSDFLATISHEIR 750

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TPLNAILGF+EV+ +E FG +G+ +Y +Y +DI  SG+H+++++ ++L+++KIE   + +
Sbjct: 751 TPLNAILGFTEVMMEEQFGPIGNERYRDYLRDIRTSGEHVVSLVTDLLDLAKIEAGHLDL 810

Query: 616 DKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIK 674
                 L  ++   + L+   A  + + +     S L    AD R +++    +++N+IK
Sbjct: 811 SFTGVALNDLVGASVSLMQPQAARQRVVVRTSFASGLKPVLADMRSMRQAALNLIANAIK 870

Query: 675 FTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLG 733
           FT+  G++++ T+   +  V + + DTGIG+    +E   QPF  +    ++   G GLG
Sbjct: 871 FTDAGGQVIVSTAMTDRGGVALRVRDTGIGMTPDEIETALQPFRQVATAQNRRGRGTGLG 930

Query: 734 LAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           L ++ AL   + G L++ S++ +GT+V +  P
Sbjct: 931 LPLTKALVEANRGTLRVTSRKHEGTLVEVLFP 962


>gi|83310211|ref|YP_420475.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
 gi|82945052|dbj|BAE49916.1| Signal transduction histidine kinase [Magnetospirillum magneticum
           AMB-1]
          Length = 687

 Score =  157 bits (398), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 101/300 (33%), Positives = 159/300 (53%), Gaps = 20/300 (6%)

Query: 469 EWCTH--DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIAN 526
           EW     DG    V   IT LK     L  +          L+ +  I ER+  E     
Sbjct: 142 EWTYRRKDGTRFPVSLSITPLKGGDGGLAGT----------LAAAMDITERKWAEEEAHR 191

Query: 527 AKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQ 586
           AK     + AE AN+ KS FLA MSHELRTPLNAI+G+SE++++E+  +LG         
Sbjct: 192 AK-----QAAEAANQAKSSFLANMSHELRTPLNAIIGYSEMLQEEM-EDLGQDDLIPDLA 245

Query: 587 DIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK 646
            IH +G+HLL +IN++L++SKIE  K+ +  +  ++ P++ + +  I    Q     +  
Sbjct: 246 KIHSAGRHLLTLINDVLDISKIEAGKMDLFVEAFEIAPMVADVVATISPLIQKNGNTLVV 305

Query: 647 KIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIP 705
               E+    AD   +++ LF +LSN+ KFT++ G + + T + G+ +   +ADTGIG+ 
Sbjct: 306 DGAGEIGAMEADLTKVRQTLFNLLSNASKFTSD-GTITLSTRRQGEWIEFAVADTGIGMA 364

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + L+++ Q F        +  GG GLGLAIS     + GG + + S+ G+GT  T+ +P
Sbjct: 365 PAELDRLFQAFSQADASTTRKFGGTGLGLAISRTFCRMMGGDIAVASEPGRGTTFTVRLP 424


>gi|313498283|gb|ADR59649.1| Multi-sensor hybrid histidine kinase [Pseudomonas putida BIRD-1]
          Length = 1149

 Score =  157 bits (397), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 165/286 (57%), Gaps = 9/286 (3%)

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
           +LK +QA L   +  L+ T   LS     L+R+  ELS A  + Q   +  + ++K KSE
Sbjct: 424 VLKESQAHLETQQAELEQTNEQLSERTDALDRKNDELSQAQLELQARADDLQRSSKYKSE 483

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLN+ L  ++++ +   G L S +  ++A+ I+ +G  LLN+IN+IL++
Sbjct: 484 FLANMSHELRTPLNSSLILAKLLAENGEGNL-SEEQVKFAESIYSAGNDLLNLINDILDI 542

Query: 606 SKIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +K+E  K+ +  +   +  ++ EG+R     L G    +  +K+E ++P  LF   D++ 
Sbjct: 543 AKVEAGKLEVRPETTQVERLV-EGLRGMFQPLAGHKGLAFEVKVEPQVPVTLF--TDRQR 599

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           +++IL  +LSN++KFT      M  + + G  ++  + DTGIGI     + I   F  + 
Sbjct: 600 LEQILKNLLSNALKFTERGQVSMNVSFQAGSGIVFAVRDTGIGIAADQQQAIFGAFHQVD 659

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
              ++  GG GLGL+IS  L +L GG++ + S  G+G++ ++ +P+
Sbjct: 660 GTSNRRYGGTGLGLSISRDLAHLLGGQINVDSSPGQGSVFSLILPE 705


>gi|158334364|ref|YP_001515536.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
 gi|158304605|gb|ABW26222.1| serine/threonine protein kinase and signal transduction histidine
            kinase (STHK) with GAF and PAS/PAC sensor [Acaryochloris
            marina MBIC11017]
          Length = 2817

 Score =  157 bits (397), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 125/437 (28%), Positives = 224/437 (51%), Gaps = 39/437 (8%)

Query: 343  WIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKND 402
            WIQ+ A++ R  +G     G+A+D++++   E     ++QR  +AIE     ++L  ++ 
Sbjct: 2102 WIQLIARIERLDNGDTVWDGVALDISDRKAAEANLRFSEQRFRRAIEDAPFPIMLHAEDG 2161

Query: 403  RLVMCNANYQKAYGLPDHVLVPGNA----RSIIQDAQTRPIIE-----YRTSDPERSQDM 453
             ++  N  + +  G   H  +P  A    R+  +DA  R + E     Y  +      + 
Sbjct: 2162 EVLQINTTWTELTGYT-HPEIPSTAAWAERAYGKDA-ARVLKEVMAKKYTLTSRWEEGEF 2219

Query: 454  SKEIKLAD-SRWLQINEWCTHDGGTISVGTDITL-LKHNQAQLRESKRRLKATINDLSTS 511
            + + K  D  RW    ++ +   G +  G  I + +  +  Q R+++  L+     L+  
Sbjct: 2220 TIQTKNGDQCRW----QFSSAPLGVLPDGRRIVISMAVDVTQRRQTEDELEQANQQLAEY 2275

Query: 512  RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
               LE++  E + A    Q+ KE+A++AN+ KSEFLA MSHELRTPLN ILG+++++ + 
Sbjct: 2276 SHTLEQRVEERTQA---LQIAKEQADSANQAKSEFLANMSHELRTPLNGILGYAQILNRS 2332

Query: 572  ---IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
               I  E   +K       IH  G HLL++I++IL+++KIE  K+ +   +  L  +++ 
Sbjct: 2333 TTLIDKERDGIKV------IHQCGSHLLSLIDDILDLAKIEARKLELVPVDTYLPAVLHS 2386

Query: 629  GIRLIGSSAQSKNIKI---EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM-- 683
             + +    AQ K I      K +P  +    D++ ++++L  +L N++KFT+N    +  
Sbjct: 2387 VVEICKIKAQQKGIDFVYAPKDLP--IGVRVDEKCLRQVLINLLGNAVKFTDNGTVTLNV 2444

Query: 684  --IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
              + TS     ++  + DTGIGI ++ L K+   FE +  + D+   G GLGLAIS  + 
Sbjct: 2445 EVLSTSNQEASLLFQVMDTGIGIAETDLSKLFDAFEQVGAR-DRRAEGTGLGLAISQRIV 2503

Query: 742  NLHGGRLKIISQEGKGT 758
             L G  +++ SQ G G+
Sbjct: 2504 QLMGHSIEVKSQVGIGS 2520


>gi|227823950|ref|YP_002827923.1| sensor protein [Sinorhizobium fredii NGR234]
 gi|227342952|gb|ACP27170.1| sensor protein [Sinorhizobium fredii NGR234]
          Length = 917

 Score =  157 bits (397), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 118/415 (28%), Positives = 212/415 (51%), Gaps = 57/415 (13%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV---LVPG 425
           EK  LE       + ++ A+E  S+  VL+D +D++++ N+ Y + +  P H    L   
Sbjct: 272 EKKKLEDEAERQRRTIAAALEAISDGFVLYDPDDKILVANSRYCEIF--PSHKPNELRGK 329

Query: 426 NARSIIQDAQTRPIIEYRTSDPE-----RSQDMSKEIKLADSR-----WLQINEWCTHDG 475
           + R I++    +  ++     PE     R +       LAD R     W++I +    DG
Sbjct: 330 SFREILEQNLAKGKVDLEGKAPEEWIEDRLRLHRDPAGLADERRFDDKWVRITKRKIPDG 389

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
           GT++V TDIT LK  QA+L                     ER K+               
Sbjct: 390 GTVAVYTDITELKQRQAEL---------------------ERAKSN-------------- 414

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE A++ KS FLA MSHELRTPLNAI+G+SE++ +E   + G  +     + I  +G+HL
Sbjct: 415 AEAASEAKSRFLASMSHELRTPLNAIIGYSEMLIEEAH-DHGENELVPDLEKIASAGRHL 473

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS-SAQSKNIKIEKKIPSELFF 654
           L +IN+IL++SKIE  K+ +  ++  +  ++ +    +    A+++N  +++        
Sbjct: 474 LALINDILDLSKIEANKMEVFLESFGVAQLLGDVSATVAPLMAKNRNAFVQEFDGDLGEM 533

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPKSALE 710
           ++D+  +++ LF +LSN+ KFT   G++ +   + G+     ++  ++DTGIG+    L+
Sbjct: 534 HSDQTKLRQNLFNLLSNAAKFT-TGGRVTLSARREGRADGDWLVFKVSDTGIGMTPEQLD 592

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++   F        ++ GG GLGL+I+ + + + GG + + S+ GKG++ T+ +P
Sbjct: 593 RLFNAFTQADASTTRNYGGTGLGLSITRSFSRMIGGIVNVESEAGKGSVFTMEVP 647


>gi|209966096|ref|YP_002299011.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
 gi|209959562|gb|ACJ00199.1| non-motile and phage-resistance protein [Rhodospirillum centenum
           SW]
          Length = 744

 Score =  157 bits (397), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 142/266 (53%), Gaps = 11/266 (4%)

Query: 500 RLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLN 559
           R+  T+ D++  + +  R    ++           +AE AN+ K++FLA MSHELRTPLN
Sbjct: 468 RIIGTVQDITPQKAVQARLDQAVA-----------QAEAANRAKTQFLATMSHELRTPLN 516

Query: 560 AILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQN 619
           AILGFSE+I+   FG++    Y EYA  +  S  HLL++IN++L+++K+E+  +++  + 
Sbjct: 517 AILGFSEIIRDGTFGQVSPGIYQEYAGHVFDSASHLLDIINDVLDLAKVESATVTLTPEP 576

Query: 620 ADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679
             L   +   ++ +   A+ + I    +    +   AD+R + + L+ ILSN+++ +  N
Sbjct: 577 VPLEETVRRAVQTVRPIARDRRISFAVQGGPAVTVLADRRALLQSLYNILSNALRHSPEN 636

Query: 680 GKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDA 739
           G + +R         +TI D G G P   L ++GQP+    N Y  +    GLG AI+ A
Sbjct: 637 GTVEVRLEPEDGFGALTIRDFGPGFPPDVLAELGQPYPGRRNVYVSAARSTGLGYAITAA 696

Query: 740 LTNLHGGRLKIISQEGKGTIVTICMP 765
           L    GG ++  +    G  VT  +P
Sbjct: 697 LLGAMGGEIEACNAPDGGACVTFRLP 722


>gi|20090805|ref|NP_616880.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19915870|gb|AAM05360.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 499

 Score =  157 bits (397), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 119/455 (26%), Positives = 219/455 (48%), Gaps = 31/455 (6%)

Query: 313 ICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYH 372
           + E  R V    V  L  IF      G   ++ + A +++ +S   ++  +  ++ ++  
Sbjct: 46  LYESLRLVGENPVSPLHNIFLKAFLGGPVSYVLIAAGLLKWVSTVASVEKLKAEVEKRKE 105

Query: 373 LEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ 432
           ++++ +     LS  +    +A+   D     + CN  + +    P   +V         
Sbjct: 106 MQEKLSRERSMLSGLLNSIPDAVFFKDPEGTYLGCNPVFCEFVKRPTEGVVGKKN----P 161

Query: 433 DAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINE-WCTHDGGTISVGTDITLLKHNQ 491
           D  ++ +  +  ++ +   +  K I         I E W T   G         LL+  +
Sbjct: 162 DFYSKEVASFLNAEDKEIFETGKAI---------IRERWATRPDGRK------VLLQTVK 206

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
           A L +        I  +  SR I ERQ+ E ++   +       AE A++ KSEF+A +S
Sbjct: 207 APLYDETGNF---IGLVGVSRDITERQRAEDALLKVRI------AEDASQAKSEFIATVS 257

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HEL+TPLN+I+GFS+++ ++  G+L S +   Y  +I  SG+HLL  I++IL++SKIE  
Sbjct: 258 HELKTPLNSIIGFSDLLLEDSSGKL-SERQARYINNISISGKHLLQFIDDILDLSKIEAG 316

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILS 670
           K  ++ +N +   I  +  ++       K + +  ++ S +  F ADK + K+IL+ ++S
Sbjct: 317 KTFLEPENFEFTKIFKDIEKVFRPRVSGKKLSLNFEVDSGIKSFYADKMMFKQILYNLIS 376

Query: 671 NSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGF 730
           N++KFT   G + +  +KIG  V I + DTGIGI +  ++   QPF+   + + +     
Sbjct: 377 NAVKFTPEEGSITVSAAKIGNMVRICVKDTGIGISREDMDSFFQPFKQPDSFFKRRYERT 436

Query: 731 GLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           GLGL +      +HGG ++  S  G+G+   I +P
Sbjct: 437 GLGLFLVKRFVEMHGGNIQAESVPGEGSSFIIELP 471


>gi|172035081|ref|YP_001801582.1| two-component sensor histidine kinase [Cyanothece sp. ATCC 51142]
 gi|171696535|gb|ACB49516.1| two-component sensor histidine kinase [Cyanothece sp. ATCC 51142]
          Length = 453

 Score =  157 bits (396), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 144/239 (60%), Gaps = 3/239 (1%)

Query: 528 KYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD 587
           K ++E ++ + ++  KS++ + +SHELRTPL  ILGFS+++++EI+G L   K  +Y   
Sbjct: 197 KIELENKKLKLSSHNKSDYFSHVSHELRTPLAGILGFSKMLREEIYGTLNE-KQKQYVNG 255

Query: 588 IHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK 647
           I  SG+HLL ++N+ L++SKIE  K  +  +   +  I    I ++   A  +N+ +   
Sbjct: 256 IRVSGEHLLALVNDFLDLSKIEANKEELFLETVAVEDICLAAISIVQPKANEQNLDLILN 315

Query: 648 IPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPK 706
           +  ++ F   D+R IK+IL  +LSN+IKFT   G + ++  KI   +   + DTGIGI +
Sbjct: 316 LSEQVDFCTVDQRKIKQILINLLSNAIKFTEK-GSVTLQVKKIESLLTFCVIDTGIGIKE 374

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              +K+ QPF+ +H+  ++   G GLGLA+S  L  LH G L + S+ GKG+  T+ +P
Sbjct: 375 EDQQKLFQPFQQIHSNLNRKHKGTGLGLALSRKLAQLHQGNLTLTSEYGKGSCFTLELP 433


>gi|26990466|ref|NP_745891.1| multi-sensor hybrid histidine kinase [Pseudomonas putida KT2440]
 gi|24985438|gb|AAN69355.1|AE016572_11 sensor histidine kinase/response regulator [Pseudomonas putida
           KT2440]
          Length = 1155

 Score =  157 bits (396), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 165/286 (57%), Gaps = 9/286 (3%)

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
           +LK +QA L   +  L+ T   LS   + L+R+  ELS A  + Q   +  + ++K KSE
Sbjct: 430 VLKESQAHLETQQAELEQTNEQLSERTEALDRKNDELSQAQLELQARADDLQRSSKYKSE 489

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLN+ L  ++++ +   G L S +  ++A+ I+ +G  LLN+IN+IL++
Sbjct: 490 FLANMSHELRTPLNSSLILAKLLAENAEGNL-SEEQVKFAESIYSAGNDLLNLINDILDI 548

Query: 606 SKIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +K+E  K+ +  +   +  ++ EG+R     L G    +  +K+E ++P  LF   D++ 
Sbjct: 549 AKVEAGKLEVRPETTQVERLV-EGLRGMFQPLAGHKGLAFEVKVEPQVPVTLF--TDRQR 605

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           +++IL  +LSN+IKFT      M  + +    ++  + DTGIGI     + I   F  + 
Sbjct: 606 LEQILKNLLSNAIKFTERGQVSMNVSFQADSGIVFAVRDTGIGIAADQQQAIFGAFHQVD 665

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
              ++  GG GLGL+IS  L +L GG++ + S  G+G++ ++ +P+
Sbjct: 666 GTSNRRYGGTGLGLSISRDLAHLLGGQINVDSSPGQGSVFSLILPE 711


>gi|124265292|ref|YP_001019296.1| signal transduction histidine kinase-like protein [Methylibium
           petroleiphilum PM1]
 gi|124258067|gb|ABM93061.1| signal transduction histidine kinase-like protein [Methylibium
           petroleiphilum PM1]
          Length = 938

 Score =  157 bits (396), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 128/491 (26%), Positives = 222/491 (45%), Gaps = 65/491 (13%)

Query: 296 TLSFRAIARLIHYDNKKICEIARSVT--GKHVKQLDQIFHMRHASGADIWIQVRAQMMRT 353
           TL   A+    H     +  + +++      + +L+  F M    G+  W ++RA   R 
Sbjct: 342 TLQADALTFFRHVHPPDLAPLGKALAEGAARLTRLEHSFRMTLPDGSLRWFEMRAAPTRL 401

Query: 354 ISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTS---EALVLWD---KNDRLVMC 407
             GG    G   D+T +  +E+     ++R   A +         VL D     DR    
Sbjct: 402 GDGGTLWHGFTADVTARKAIEEALQAHEERWQIAADAARIGIAEFVLADGLVNLDRRACI 461

Query: 408 NANYQKAYG---LPDHV--LVPGNARSIIQD-----AQTRPI-IEYRTSDPERSQDMSKE 456
           N      +G   L D +  + P +  +++       A  RP    YR   P+ S      
Sbjct: 462 NHGLSYPHGRVTLDDWMAQIDPADRDAVMAGIGEALAGERPFEGRYRIRQPDGS------ 515

Query: 457 IKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
                 RWL+     T D      G                          + T R + E
Sbjct: 516 -----VRWLEFVVRATRDEAGAPTGV-------------------------IGTCRDVHE 545

Query: 517 RQ-KTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           +Q   ELS          + AE A++ KSEFL+++SHELRTPLN ILGF++++  +    
Sbjct: 546 QQLADELSRG-------MQEAERASRAKSEFLSRVSHELRTPLNGILGFTQLMALDEDHP 598

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
           L + +    A  +  +G  LLN+IN++LE+S+IE+ ++++     DL   ++  + L+ S
Sbjct: 599 LAAPQAQRLAS-VQRAGNRLLNLINDVLEISRIESAEVAVRTLAVDLDAALHASLSLVQS 657

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
            A+ ++I IE   PS L+ + D+R ++++L  +LSN+IK++     +++   +    V I
Sbjct: 658 LARGRSITIEPTPPSGLWVSGDERALEQVLVNLLSNAIKYSGEQSPVVLNLQRSDGTVKI 717

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
            + D G+G+      ++ QPF+ L  +  + I G GLGL I+  L    GGR+ ++S  G
Sbjct: 718 AVRDRGVGLTAEQQARLFQPFDRLGAER-RRIEGSGLGLVIARQLAEAMGGRIDVVSVPG 776

Query: 756 KGTIVTICMPQ 766
            G+  T+ +P+
Sbjct: 777 AGSTFTLQLPE 787


>gi|148253661|ref|YP_001238246.1| hypothetical protein BBta_2154 [Bradyrhizobium sp. BTAi1]
 gi|146405834|gb|ABQ34340.1| hypothetical protein BBta_2154 [Bradyrhizobium sp. BTAi1]
          Length = 786

 Score =  157 bits (396), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 138/514 (26%), Positives = 243/514 (47%), Gaps = 32/514 (6%)

Query: 264 GRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGK 323
           GR G W  +   +    S  ++EI G+   ++ ++F  +  +IH ++      AR  +  
Sbjct: 116 GRLGHWVTDPSGEFAVWSDELFEIAGLEPVDQ-VAFAKMLDIIHPEDVGAYVRARDRSRA 174

Query: 324 HVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYHLEKRYAEADQ 382
                 Q       +G   W+++ A       G      GI  D+TE+   E    +A  
Sbjct: 175 TGCAFIQELRFVTPNGQVRWVRIEANASDEADGVFRERFGIVQDITERKLAEINADQARL 234

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIE 441
            L  AIE  +   VL+DK+DR VM N  +++ +     ++ PG +   +++ A    +I 
Sbjct: 235 LLMDAIESLTNGFVLFDKDDRFVMSNTMFREMFPAWTVLMKPGISFTELMRRAYEHGLIR 294

Query: 442 YRTSDPERSQDMSKEIKLADSR----------WLQINEWCTHDGGTISVGTDITLLKHNQ 491
            +    E          L  SR          W+Q  +    DGGT+ + TDIT  K  Q
Sbjct: 295 SKGDRFEEWLARKTAWHLGGSRMIEHRELNGRWIQSVDHRISDGGTVCLVTDITAFKTVQ 354

Query: 492 AQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMS 551
           A+L +    ++A  +DL       E+Q  EL    A+ +  ++ AE AN+ KS+FLA MS
Sbjct: 355 AELEQKLAYVEAIRSDL-------EQQTQELEARGAELRAARDAAEAANRAKSDFLAIMS 407

Query: 552 HELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETE 611
           HE+RTPL+ ++G  ++++     E    +Y   A++   S   LL +IN+IL+ SK+E  
Sbjct: 408 HEIRTPLSGMVGMVDLLRGTSLSE-EQKRYTALAKE---SADLLLEVINDILDFSKLEAG 463

Query: 612 KISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPIL 669
           ++  +  + D+  ++   +  +G  A+ + + ++  +   L  +   D   I++++  ++
Sbjct: 464 RLQSECIDFDVPNLVESAVSFMGEKARRRGLDLKVSLAPGLPQYLEGDPTRIRQVMLNLV 523

Query: 670 SNSIKFTNNNGKMMIRTS--KIGQCVI---ITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
            N+IKFT   G + +R S  ++   V+   I + DTGIG+    L +I  PF        
Sbjct: 524 GNAIKFT-EQGSIEVRASHRQLDGGVVDLRIEVIDTGIGMSPEILAQIFDPFVQADTSIS 582

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           +  GG GLGLAI   L  + GG + + S+ G+G+
Sbjct: 583 RKYGGSGLGLAICRQLCTIMGGSIGVDSELGRGS 616


>gi|71908962|ref|YP_286549.1| response regulator receiver:ATP-binding region,
           ATPase-like:histidine kinase, HAMP region:histidine
           kinase A, N-terminal:Hpt [Dechloromonas aromatica RCB]
 gi|71848583|gb|AAZ48079.1| Response regulator receiver:ATP-binding region,
           ATPase-like:Histidine kinase, HAMP region:Histidine
           kinase A, N-terminal:Hpt [Dechloromonas aromatica RCB]
          Length = 923

 Score =  157 bits (396), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 104/316 (32%), Positives = 168/316 (53%), Gaps = 39/316 (12%)

Query: 456 EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQ--AQLRESKRRLKATINDLSTSRQ 513
           +I+ ADSR  +I++  T                 NQ   Q+RE    L   + +L    Q
Sbjct: 206 DIRAADSRVTEIDQLVT---------------GFNQMVEQIRERDHWLSTHLGNLE---Q 247

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I+E++  EL +A       KE AE  ++ KSEFLA MSHE+RTP+N +LG +E++     
Sbjct: 248 IVEQRTRELRLA-------KEAAEAGSQAKSEFLATMSHEIRTPMNGVLGMTELL----L 296

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G        ++ + +  SG+HLL++IN+IL+ SKIE  K+ +D  + DL  ++ E + L 
Sbjct: 297 GTELEPTQRQFVEAVERSGKHLLHIINDILDFSKIEAGKLELDVVDFDLRNLLEESLELF 356

Query: 634 GSSAQSKNIKIEKKIPSE--LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-- 689
              A+ K +++   +P +  L    D   +++I+  +L N++KFT   G++++R   +  
Sbjct: 357 SQPARRKGLELVADLPPDEKLIVRGDPLRLRQIVTNLLGNAVKFTET-GEILLRLLVVEP 415

Query: 690 ---GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G  + + ++DTGIGIP  A EKI + F        +  GG GLGLAI   L ++ GG
Sbjct: 416 RDNGLKLALVVSDTGIGIPLDAQEKIFEHFLQADGSTTRKYGGTGLGLAICRHLVDMMGG 475

Query: 747 RLKIISQEGKGTIVTI 762
           R+ + S  GKG   T+
Sbjct: 476 RIHVESTPGKGAAFTV 491


>gi|119490047|ref|ZP_01622671.1| two-component sensor kinase [Lyngbya sp. PCC 8106]
 gi|119454199|gb|EAW35351.1| two-component sensor kinase [Lyngbya sp. PCC 8106]
          Length = 641

 Score =  157 bits (396), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI-----FGELGSVKYYEYAQDIHY 590
           A++AN+ KSEFLA MSHELRTPL  ++G S  + +         ++   K  EY   IH 
Sbjct: 249 AQSANRAKSEFLATMSHELRTPLTCVIGISATLLRLYSNGAGIKQISREKQQEYLHKIHD 308

Query: 591 SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-- 648
           SG+HLL +IN+ILE+S++E  K  +      L  +  + +      AQ  N+ +   I  
Sbjct: 309 SGEHLLELINDILELSEVEAGKTILQISEFSLTKLAQKTLYSFRERAQEHNVLLISDIQV 368

Query: 649 -PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKS 707
            P E  F AD+R ++K+LF +LSN+IKFT  +G++ +R        I  I DTGIGI + 
Sbjct: 369 KPDEDLFIADQRRVEKVLFNLLSNAIKFTPESGQVTLRVGVNKNTAIFQIQDTGIGISEE 428

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               + + F+ L + Y +   G GLGLA++  L  LHGG +K+ S E  G+  T+ +P
Sbjct: 429 QQPLLFEKFQQLDSSYRRQYSGTGLGLALTKQLVELHGGVIKLTSTENVGSTFTVHIP 486


>gi|254787892|ref|YP_003075321.1| MASE1/CHASE/His Kinase A/ATPase domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237684334|gb|ACR11598.1| MASE1/CHASE/His Kinase A/ATPase domain protein [Teredinibacter
           turnerae T7901]
          Length = 757

 Score =  157 bits (396), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 144/235 (61%), Gaps = 4/235 (1%)

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           + A  AN  KS FLA MSHELRTPLN+I+GFS  + K +  +    K Y   + I  +G+
Sbjct: 523 DDARHANSAKSLFLASMSHELRTPLNSIIGFSVRLLKNL-NQSKDPKSYRSLEVIERNGR 581

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF 653
           HLLN+IN+IL++SK+E  K+SID++   L  +++E +  +   A+SK + +E K+     
Sbjct: 582 HLLNLINDILDLSKVEAGKMSIDREWVSLKTLLDETVTSLTPLAESKGLTLELKMVEVAN 641

Query: 654 FNADKRIIKKILFPILSNSIKFTNNNGKMMI--RTSKIG-QCVIITIADTGIGIPKSALE 710
             AD++ + ++L  ++SN IK+T+  G  +   R S+ G + V I + DTG+GI    ++
Sbjct: 642 VFADQKRLAQVLLNLVSNGIKYTSTGGISISSRRESREGHEGVAIDVVDTGVGIKPEDID 701

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++ + +E L      S  G GLGLA+++ L NLHGGRL + S+ G+G+  T  +P
Sbjct: 702 RVFRRYEQLDEPSHSSEVGTGLGLALAEELVNLHGGRLSVFSEYGEGSCFTCWLP 756


>gi|288941099|ref|YP_003443339.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
 gi|288896471|gb|ADC62307.1| multi-sensor hybrid histidine kinase [Allochromatium vinosum DSM 180]
          Length = 1650

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 137/569 (24%), Positives = 261/569 (45%), Gaps = 70/569 (12%)

Query: 230  LFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMG 289
            L  L  Y R   + K+ +      N  +  AL     G W+++        S  MY + G
Sbjct: 736  LVGLAGYVRDITERKQAEIAHQADNQRLHWALQAAHGGAWDWDLSTDVAWWSPEMYALWG 795

Query: 290  IPYENKTLSFRAIARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRA 348
            +  E K +   +++ +   D   +   + R++  +  + L   F +RH    + W+    
Sbjct: 796  VEPETKMVLDNSLSLVADQDRASLRANVERAI--QDGRDLQCEFRIRHPQHGERWMASWG 853

Query: 349  QMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCN 408
            +++    G  +++G++ D+T++  +E+   +++ R    +E  +  ++    +  +   N
Sbjct: 854  RLVTDADGLSHLLGLSFDITDQKRMEQALKDSESRYRDLVENVNSVILRLAPDGLIAFAN 913

Query: 409  ANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK--LADS-RWL 465
                + +G     L+             RP+     +     Q++S  ++  LA+S R++
Sbjct: 914  EYALRFFGYAAEELI------------GRPVTVLVPTVDSTGQNLSAMVQEILANSERYV 961

Query: 466  Q-INEWCTHDG--------------------GTISVGTDITLLKHNQAQLRESKRRLKAT 504
              INE   HDG                    G ++VG DIT  +  + +L   +R L+A 
Sbjct: 962  HHINENLCHDGRRVWMAWTNKALYDDRGRLIGVLAVGNDITERRRLEQELDRHRRHLEAL 1021

Query: 505  INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
            +++ +                 A+    + RAE AN+ KS FLA MSHE+RTP+NA+LGF
Sbjct: 1022 VDERT-----------------AQLTEARARAEAANQAKSAFLANMSHEIRTPMNAVLGF 1064

Query: 565  SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
              ++++       +    +  + IH +GQ LL++IN+IL+ SKIE  ++ ++     L  
Sbjct: 1065 CYLLEQHALDPASA----DLVRKIHNAGQALLDLINDILDFSKIEAGRLELEAAPFRLSE 1120

Query: 625  IINEGIRLIGSSAQSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKM 682
            +++    ++ ++A  K +++    P         D   ++++L  +L N+IKFT   G++
Sbjct: 1121 LLDTLAGIMTAAAGDKPLELILTPPEADIEGLIGDAGRLRQVLINLLGNAIKFTAR-GEV 1179

Query: 683  MIRTSKIGQC-----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAIS 737
             +R   + +      +   + DTGIGI   + E++ QPF        +  GG GLGL+IS
Sbjct: 1180 ELRIECLAEHDDAVELRFAVRDTGIGIDPESQERLFQPFTQADVSTTRRFGGTGLGLSIS 1239

Query: 738  DALTNLHGGRLKIISQEGKGTI--VTICM 764
              L  L GG L+I SQ G+G+    ++C+
Sbjct: 1240 RQLVRLMGGTLEIESQPGQGSTFHFSLCL 1268


>gi|159897746|ref|YP_001543993.1| multi-sensor signal transduction histidine kinase [Herpetosiphon
            aurantiacus ATCC 23779]
 gi|159890785|gb|ABX03865.1| multi-sensor signal transduction histidine kinase [Herpetosiphon
            aurantiacus ATCC 23779]
          Length = 1877

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 152/252 (60%), Gaps = 10/252 (3%)

Query: 522  LSIANAKYQVEK----ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELG 577
            +++ NA+   E+    +R +  ++ KS FLA MSHELRTPLN+ILGF+EVI + I G + 
Sbjct: 1606 IALQNARLFAEQTATMQRLQELDQLKSAFLANMSHELRTPLNSILGFTEVILEGINGPIN 1665

Query: 578  SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA 637
             + + + +  IH +G+HLLN+IN+IL+M+KIE+ K+++ ++  D++ +++E    +G  A
Sbjct: 1666 DLIHNDLSI-IHRNGRHLLNLINDILDMAKIESGKLTLFRETFDVVEVLHEVASTVGPLA 1724

Query: 638  QSKNIKIEKKIPSELFFN--ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
              K++++   I   L     AD+  I+++L  I+ N++KFT   G + I         +I
Sbjct: 1725 TQKHLELLVDIEPNLKLPVYADRFRIRQVLLNIVGNALKFT-EQGSVTIGIDTTPTTRMI 1783

Query: 696  TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS--Q 753
             I DTGIGIP    + I   F  + N   +  GG GLGL IS  L  +HGG+L ++S   
Sbjct: 1784 KIQDTGIGIPLDNQDTIFMEFHQVDNSTTRKAGGTGLGLPISRHLVEMHGGKLSMVSSGN 1843

Query: 754  EGKGTIVTICMP 765
             G+G++ TI +P
Sbjct: 1844 PGEGSLFTIELP 1855


>gi|296448146|ref|ZP_06890045.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
 gi|296254327|gb|EFH01455.1| PAS/PAC sensor signal transduction histidine kinase [Methylosinus
           trichosporium OB3b]
          Length = 899

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 137/228 (60%), Gaps = 11/228 (4%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K++FLAK+SHE+RTPLNAI+GF+EV+ +E FG LGS +Y EY +DIH SG H+L+++N++
Sbjct: 670 KTDFLAKVSHEVRTPLNAIIGFAEVMMEERFGPLGSERYKEYLKDIHTSGLHVLSLVNDL 729

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADK 658
           L++SKIE  K+ +D +  D   +I E + ++   A    + I      ++P  L   AD 
Sbjct: 730 LDLSKIEAGKMELDVERIDANAMIAECVSIMQPQANRSRVLIRLSLWPRLPRVL---ADG 786

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIGIPKSALEKIGQPFE 717
           R +++IL  +LSN++KF    G++++ ++      V+I + DTGIG+ +S +E      E
Sbjct: 787 RSLRQILLNLLSNAVKFNEAGGQVIVSSALTDAGYVVIRVKDTGIGMSESEIETA---LE 843

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           P          G GLGL ++ AL   +     I S+  +GT+V +  P
Sbjct: 844 PFRQVGPHKASGTGLGLPVTKALIEANRASFSITSRRNEGTLVEVAFP 891


>gi|257059244|ref|YP_003137132.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8802]
 gi|256589410|gb|ACV00297.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8802]
          Length = 1611

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 210/418 (50%), Gaps = 46/418 (11%)

Query: 361  IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG---- 416
            +GI  D+T++   E+   ++++RL  A+E + + L  W+     V  +  Y +  G    
Sbjct: 998  LGIGSDITQRKQAERALRDSEERLQLALEASGDGLWDWNIETGEVYFSPRYAEMLGYRVN 1057

Query: 417  -LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDG 475
             LP +V               + I++    D   S D    ++    +W    +W    G
Sbjct: 1058 ELPPNVTTWERLVYPKDMIWVKEILDSHLKDSTTSYDFDYRVRTKSGQW----KWIADYG 1113

Query: 476  GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
              ++               R+ + +    +  L T + I +R+  EL +  AK     E 
Sbjct: 1114 KVVA---------------RDGEGK---PLRMLGTHKDITQRKHIELELQKAK-----ET 1150

Query: 536  AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
            A  AN +KS FLA MSHELRTPLNAILGF++++ ++      S  + E  Q I+ SG+HL
Sbjct: 1151 AIAANLSKSIFLANMSHELRTPLNAILGFTQLLGRDTS---LSAYHQERLQIINRSGEHL 1207

Query: 596  LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK--IEKKIPSELF 653
            L +I++IL++SKIET +I++   + DL  ++     ++   A+SK IK  IEK      +
Sbjct: 1208 LGLIDDILDLSKIETGQIALFLTDCDLSGLLLTVEEMLSPKAESKGIKLIIEKDDNLPRY 1267

Query: 654  FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQCVIIT---IADTGIGIPKSA 708
               D + +++IL  +L+N+IKFT + G + +R   SKI Q  +I    + DTG+GI    
Sbjct: 1268 IKIDSKKLRQILINLLNNAIKFT-HQGTVTLRVNLSKIDQKAVIVKFIVEDTGVGIAADE 1326

Query: 709  LEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            L+ + Q F  +  +  + I  G GLGLAIS  L  L GG++++ S   +G+I +  +P
Sbjct: 1327 LDNLFQLF--VQAEAGKKINQGSGLGLAISQKLVQLMGGKIEVNSILNQGSIFSFEIP 1382


>gi|45657401|ref|YP_001487.1| histidine kinase sensor protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600640|gb|AAS70124.1| histidine kinase sensor protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 731

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 158/270 (58%), Gaps = 16/270 (5%)

Query: 502 KATINDLSTSRQILE---RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           K  + +L   R+ LE    Q+TE      +  ++KE AE ANK KSEFLA MSHELRTPL
Sbjct: 305 KNILEELKVHREKLEVLVSQRTE------ELNLQKEMAEKANKAKSEFLANMSHELRTPL 358

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           N+I+GFS +++   F E G  +   Y   I +SG HLLN+IN+IL++S+IE +K+ +++ 
Sbjct: 359 NSIIGFSRLMQ---FPE-GMERENRYLDLIFHSGVHLLNIINDILDLSRIEADKLVLNES 414

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFN--ADKRIIKKILFPILSNSIKF 675
           + DL  +I+  + +I   A +K +++  +  P    F   AD + I++++  +L N+IKF
Sbjct: 415 DFDLKELISTSVEMILGEAITKKLEMTFEFFPKNANFEIRADPKRIRQVILNLLGNAIKF 474

Query: 676 TNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
           T++ GK++I  +K+     + + D+GIGIP   + KI + F  +  +   +  G GLGL 
Sbjct: 475 TDSTGKILITLNKLENNFQLAVQDSGIGIPTEEISKIFETFYQVKGEDRAAYEGSGLGLP 534

Query: 736 ISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           I   +   H G +++ S  GKG+   +  P
Sbjct: 535 IVKKIVEAHHGSIQVESALGKGSKFVVIFP 564


>gi|309790216|ref|ZP_07684788.1| sensory box histidine kinase/response regulator [Oscillochloris
           trichoides DG6]
 gi|308227801|gb|EFO81457.1| sensory box histidine kinase/response regulator [Oscillochloris
           trichoides DG6]
          Length = 906

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 132/475 (27%), Positives = 223/475 (46%), Gaps = 68/475 (14%)

Query: 306 IHYDNKKICE-IARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGI 363
           ++ D  +I + + R++ G+    L+Q          D   + R   M  + G +  +IG+
Sbjct: 194 LYADQPQIIQSVRRALAGEDFAILNQY--------KDFSFETRFHPMYDVQGQVTGVIGV 245

Query: 364 AMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL--PDHV 421
           A D++ +         A+ RLS  I      +++ D + RL + N  +   +GL  P   
Sbjct: 246 AFDISPRLQATAASQNANSRLSTLIANLQAGVLVEDDDCRLTLVNQTFCTIFGLSMPPDA 305

Query: 422 LVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKE--------IKLADSRWLQINEWCTH 473
           L+  +   + +     P +E+  S     Q + ++        +++AD R L+ +     
Sbjct: 306 LIGMDCYDVAR--MIAPSLEHSESFFTHFQQILEQRQPVTGYMVRMADGRSLECD----- 358

Query: 474 DGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEK 533
               + V  D     H                  L   R + ER +    +  AK     
Sbjct: 359 ---FVPVFEDDGYHGH------------------LWLYRDVSERVRGTAELVRAK----- 392

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           E AE A   KS FLA MSHE+RTP+NA++G + ++         + +  +YA+ I  SG 
Sbjct: 393 EAAEAATMAKSSFLATMSHEIRTPMNAVIGMTTLMLDTDL----TREQRQYAETIRTSGD 448

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL- 652
            LL +INNIL+ SKIE+  + +++Q   L   I E   L+G  A  K I +   +  ++ 
Sbjct: 449 MLLALINNILDFSKIESGHMELEQQPFSLHACIEEVNELLGPKAAEKGIVLTGMVSGQVP 508

Query: 653 -FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK------IGQCVIITI--ADTGIG 703
              + D   +++IL  ++SN+IKFTN  G++ +R S        G+ +IITI  ADTGIG
Sbjct: 509 AMISGDSTRVRQILVNLISNAIKFTNV-GEVTVRASARPDEALSGEHLIITITVADTGIG 567

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           IP+  ++++ +PF  +     +  GG GLGLAIS  L+ L GG + + S+ G G+
Sbjct: 568 IPEDRMDRLFRPFSQIDASTTRRFGGTGLGLAISRRLSELMGGSITVQSKVGVGS 622


>gi|163794299|ref|ZP_02188271.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
 gi|159180467|gb|EDP64988.1| PAS/PAC Sensor Signal Transduction Histidine Kinase [alpha
           proteobacterium BAL199]
          Length = 637

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 127/494 (25%), Positives = 245/494 (49%), Gaps = 37/494 (7%)

Query: 279 HLSRSMYEIMGIPYENKTLSFR-AIARLI-HYDNKKICEIARSVTGKHVKQLDQIFHMRH 336
           ++S  + E+ G P E     +  A+A L+   D  +  E   + + + + +L+    +  
Sbjct: 169 YMSDRILELTGTPSEAFIADWGCALADLLAQPDTHRFTE-GLNTSAEQLDELNIRLPLAR 227

Query: 337 ASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALV 396
            +G+  W++VRA   R   G     GI  D T         A++++R    I+  S+   
Sbjct: 228 PAGSTRWLRVRAAARRLTDGTTLWSGIFTDATLSVESTAALAQSERRFRDIIDIASD--W 285

Query: 397 LWDKN--DRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
           +W+ N   ++   +  + +  G+P   +V    R +       P  ++     +  ++  
Sbjct: 286 VWETNAAGQITFVSDRFVEISGIPTDRIVGRTRREL-------PFYDWDDPGLQALEEDL 338

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
           +E +    R ++I        GT S    ++L          + +  + T  D++   + 
Sbjct: 339 RERRPIHGRRIRI--------GTPSGDRQVSLRGRPILGDDGTFQGYRGTGTDVTREHEY 390

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           ++R    +        VE   A+ AN+ KS FLA MSH+LRTPLNAI+GFSE+++ E+FG
Sbjct: 391 VQRLHDAM--------VE---AQAANRAKSRFLANMSHDLRTPLNAIMGFSEIMQAEVFG 439

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            +G  +Y EY++DI  S  HLL +I+++L++++IE+ +I + K+   +  I++E I L+ 
Sbjct: 440 PVGHPRYAEYSRDIRTSAVHLLELIDDLLDLARIESGRIEMVKEPLVIRDIVDEAIMLVA 499

Query: 635 SSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMM--IRTSKIGQ 691
              +++ + +     ++    ++D R +K+IL  +L+N+ KFT   G ++  I+    G 
Sbjct: 500 PRCEARGVSLTVTGAADAPVVHSDGRAVKQILVNLLTNASKFTERGGSIVVDIKPDSTGN 559

Query: 692 CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKII 751
            V +++ D G GIP + ++++ +PF        +   G GLGLAI  +L+   G + +I 
Sbjct: 560 -VWVSVCDDGCGIPTAMIDEVTKPFVQASETASRPRDGVGLGLAIVRSLSEAIGAKFQIE 618

Query: 752 SQEGKGTIVTICMP 765
           S+ G+GT   + +P
Sbjct: 619 SRIGEGTTARVRLP 632



 Score = 40.0 bits (92), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 13/136 (9%)

Query: 383 RLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG-------LPDHVLVPGNARSIIQDAQ 435
           RL  A++ T  A+ +WD  DRLV  NA +++ +         PD   +    R   +D  
Sbjct: 26  RLLFALDHTQIAVAVWDTEDRLVHTNARFRELFAHTGPFDDRPDFATITERTRRFFRDD- 84

Query: 436 TRPIIEYRTSD---PERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQA 492
             P+IE    +     +  + + E    ++R ++ ++  T DGG +++  DI+  +  +A
Sbjct: 85  --PVIEAAADERLHRRKRGNPTGEFLSVENRVIRFHDIQTPDGGAVTIYEDISRERSVEA 142

Query: 493 QLRESKRRLKATINDL 508
            L    + L   I +L
Sbjct: 143 TLSALAKTLPGAIFEL 158


>gi|24215121|ref|NP_712602.1| histidine kinase sensor protein [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24196185|gb|AAN49620.1| histidine kinase sensor protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 731

 Score =  156 bits (395), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 158/270 (58%), Gaps = 16/270 (5%)

Query: 502 KATINDLSTSRQILE---RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPL 558
           K  + +L   R+ LE    Q+TE      +  ++KE AE ANK KSEFLA MSHELRTPL
Sbjct: 305 KNILEELKVHREKLEVLVSQRTE------ELNLQKEMAEKANKAKSEFLANMSHELRTPL 358

Query: 559 NAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQ 618
           N+I+GFS +++   F E G  +   Y   I +SG HLLN+IN+IL++S+IE +K+ +++ 
Sbjct: 359 NSIIGFSRLMQ---FPE-GMERENRYLDLIFHSGVHLLNIINDILDLSRIEADKLVLNES 414

Query: 619 NADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFN--ADKRIIKKILFPILSNSIKF 675
           + DL  +I+  + +I   A +K +++  +  P    F   AD + I++++  +L N+IKF
Sbjct: 415 DFDLKELISTSVEMILGEAITKKLEMTFEFFPKNANFEIRADPKRIRQVILNLLGNAIKF 474

Query: 676 TNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLA 735
           T++ GK++I  +K+     + + D+GIGIP   + KI + F  +  +   +  G GLGL 
Sbjct: 475 TDSTGKILITLNKLENNFQLAVQDSGIGIPTEEISKIFETFYQVKGEDRAAYEGSGLGLP 534

Query: 736 ISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           I   +   H G +++ S  GKG+   +  P
Sbjct: 535 IVKKIVEAHHGSIQVESALGKGSKFVVIFP 564


>gi|218246196|ref|YP_002371567.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8801]
 gi|218166674|gb|ACK65411.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 8801]
          Length = 1578

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 126/418 (30%), Positives = 210/418 (50%), Gaps = 46/418 (11%)

Query: 361  IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYG---- 416
            +GI  D+T++   E+   ++++RL  A+E + + L  W+     V  +  Y +  G    
Sbjct: 965  LGIGSDITQRKQAERALRDSEERLQLALEASGDGLWDWNIETGEVYFSPRYAEMLGYRVN 1024

Query: 417  -LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDG 475
             LP +V               + I++    D   S D    ++    +W    +W    G
Sbjct: 1025 ELPPNVTTWEGLVYPKDMIWVKEILDSHLKDSTTSYDFDYRVRTKSGQW----KWIADYG 1080

Query: 476  GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
              ++               R+ + +    +  L T + I +R+  EL +  AK     E 
Sbjct: 1081 KVVA---------------RDGEGK---PLRMLGTHKDISQRKHIELELQKAK-----ET 1117

Query: 536  AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
            A  AN +KS FLA MSHELRTPLNAILGF++++ ++      S  + E  Q I+ SG+HL
Sbjct: 1118 AIAANLSKSIFLANMSHELRTPLNAILGFTQLLGRDTS---LSAYHQERLQIINRSGEHL 1174

Query: 596  LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK--IEKKIPSELF 653
            L +I++IL++SKIET +I++   + DL  ++     ++   A+SK IK  IEK      +
Sbjct: 1175 LGLIDDILDLSKIETGQIALFLTDCDLSGLLLTVEEMLSPKAESKGIKLIIEKDDNLPRY 1234

Query: 654  FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQCVIIT---IADTGIGIPKSA 708
               D + +++IL  +L+N+IKFT + G + +R   SKI Q  +I    + DTG+GI    
Sbjct: 1235 IKIDSKKLRQILINLLNNAIKFT-HQGTVTLRVNLSKIDQKAVIVKFIVEDTGVGIAADE 1293

Query: 709  LEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            L+ + Q F  +  +  + I  G GLGLAIS  L  L GG++++ S   +G+I +  +P
Sbjct: 1294 LDNLFQLF--VQAEAGKKINQGSGLGLAISQKLVQLMGGKIEVNSILNQGSIFSFEIP 1349


>gi|150375914|ref|YP_001312510.1| multi-sensor hybrid histidine kinase [Sinorhizobium medicae WSM419]
 gi|150030461|gb|ABR62577.1| multi-sensor hybrid histidine kinase [Sinorhizobium medicae WSM419]
          Length = 917

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 204/418 (48%), Gaps = 63/418 (15%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH---VLVPG 425
           EK  LE       + ++ A+E  S+  VL+D +DR+++ N+ Y + +  P H    L   
Sbjct: 271 EKKKLEDEAERQRRTIAAALEVISDGFVLYDSDDRILVANSKYCEIF--PSHKPNTLRGR 328

Query: 426 NARSIIQDAQTRPIIEYRTSDP-----ERSQDMSKEIKLADS-----RWLQINEWCTHDG 475
           + R I++       ++     P     ER +       L D      RW++I++    DG
Sbjct: 329 SFREIVEQNLETGQVDLEGKSPQEWVDERVRLHRDPAGLVDEKRFGERWVRISKRKIPDG 388

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
           GT++V TDIT LK  Q +L                     ER K+               
Sbjct: 389 GTVAVYTDITELKQRQVEL---------------------ERAKSH-------------- 413

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD---IHYSG 592
           AE+AN+ KS+FLA MSHELRTPLNAI+G+SE++ +E        K  E   D   I  +G
Sbjct: 414 AESANEAKSQFLASMSHELRTPLNAIIGYSEMLIEEARDH----KEEELVPDLDKIASAG 469

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
           +HLL +IN+IL++SKIE  K+ +  +   L  ++ +    +            +    +L
Sbjct: 470 RHLLTLINDILDLSKIEANKMDVFLETFSLAELLRDVAATVAPLMARNGNAFTQDFEDDL 529

Query: 653 F-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPKS 707
              ++D+  +++ LF +LSN+ KFT   G++++R  +  +     ++  ++DTGIG+   
Sbjct: 530 GKMHSDQTKLRQNLFNLLSNAAKFT-KGGRVILRVRREQRAEHDWLVFQVSDTGIGMTPE 588

Query: 708 ALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             +++   F        ++ GG GLGL+I+ +   L GG + + S+ GKG++ T+ +P
Sbjct: 589 QQDRLFNAFTQADASTTRNYGGTGLGLSITRSFCRLIGGVVTVESEAGKGSVFTMEVP 646


>gi|90423287|ref|YP_531657.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
 gi|90105301|gb|ABD87338.1| multi-sensor signal transduction histidine kinase [Rhodopseudomonas
           palustris BisB18]
          Length = 612

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 134/227 (59%), Gaps = 1/227 (0%)

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
           + ++S FLA MSHELRTPLNAI+GFSE+I +E    + + +  EYAQ I+ SGQHLL+++
Sbjct: 348 DASRSHFLATMSHELRTPLNAIIGFSEMIVQEDVLMISAARRKEYAQLINDSGQHLLSVV 407

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADK 658
           N IL+MSK+E+ K  I  +     P +     L+   A+   + +  + P  L     D 
Sbjct: 408 NGILDMSKMESGKFEILPEPFAPRPALLNCCNLLALKARENEVDLVTRAPENLPQLTGDP 467

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEP 718
           R  K+I+  ++SN+IKFT   G + +  +  G  + + ++DTG+GI    L++IG+ F  
Sbjct: 468 RAFKQIVLNLVSNAIKFTERGGTVTVSAAVEGARLALRVSDTGVGIGADDLKRIGEAFFQ 527

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               Y +   G GLGL+I  +L  LHGG + + S+  +GT VT+ +P
Sbjct: 528 ASKSYHRRHEGTGLGLSIVKSLVALHGGEMSVESKLDEGTTVTVMLP 574


>gi|302037237|ref|YP_003797559.1| putative sensor histidine kinase [Candidatus Nitrospira defluvii]
 gi|300605301|emb|CBK41634.1| putative Sensor histidine kinase [Candidatus Nitrospira defluvii]
          Length = 1013

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 133/528 (25%), Positives = 251/528 (47%), Gaps = 50/528 (9%)

Query: 244 KENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIA 303
           K  +  LL +   +  AL   + G+W+++        S ++  I G+  E    ++ A  
Sbjct: 212 KRMEAALLVSEERLRLALGAAQAGIWDWDIRTNAVQWSDNVSTIFGLSRETFVGTYEAYL 271

Query: 304 RLIH-YDNKKICEIARSVTGKHVKQLDQIFH-MRHASGADIWIQVRAQMMRTISG-GMNI 360
            L+   D  ++ +  R     +V+   QI H +    G   W+  R  ++R   G  + +
Sbjct: 272 ALVDPQDLDRLLQAIRQSIQANVEY--QIEHRILWPDGTVHWLACRGDVLRDADGTPVRM 329

Query: 361 IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH 420
           +G  +D+T +  ++ + A ++ +L   ++ +   + L D+  R +  N  +++A+ L   
Sbjct: 330 VGTVLDVTARKEMDLKLANSEAQLRAILDHSPALIFLKDREGRYLDVNRQFERAFNLSRE 389

Query: 421 VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT-HDGGTIS 479
            ++      +    Q      ++T+D          + L   R L+  E    HDG   S
Sbjct: 390 AILGKTDTELFSPKQA---AVFQTND---------RLVLEAKRPLRFEETADYHDGPRTS 437

Query: 480 VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
           +     LL  +         R+   +  ++T   I +R++ E ++A A+ Q     A  A
Sbjct: 438 IVFKFPLLDRD---------RMLYAVGGVATD--ITDRKRAEEALALARDQ-----AMEA 481

Query: 540 NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
            + KSEFLA MSHE+RTP+N ++G + ++ +       + +  E A+ +  SG HLL +I
Sbjct: 482 ARLKSEFLATMSHEIRTPMNGVIGMTNLLLESAL----TPEQRECAEVVRNSGDHLLMII 537

Query: 600 NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK----IEKKIPSELFFN 655
           N+IL+ SKIE  +++++  + D   +I++ + LI   A+ K +     I+  +PS +   
Sbjct: 538 NDILDFSKIEAGRLTLETIDFDFRGMIDDTLDLIAEQARQKGLDLVGLIDASVPSAV--R 595

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIR--TSKIGQCVII---TIADTGIGIPKSALE 710
            D   ++++L  +L N+IKFT+  G++++R   ++  Q  ++    + DTGIGI      
Sbjct: 596 GDPGRLRQVLINLLGNAIKFTDR-GEVVLRMTVAQDAQSHVVLRGDVTDTGIGISPEGRN 654

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
           K+ Q F  +     +  GG GLGLAI   LT L  G + + S  GKG+
Sbjct: 655 KLFQTFSQVDASTTRRYGGTGLGLAICKRLTELMQGEIGMESAPGKGS 702


>gi|209965987|ref|YP_002298902.1| sensor protein divL [Rhodospirillum centenum SW]
 gi|209959453|gb|ACJ00090.1| sensor protein divL [Rhodospirillum centenum SW]
          Length = 821

 Score =  156 bits (394), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 145/233 (62%), Gaps = 4/233 (1%)

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           E  ETA++ KSEF+A +S++LRTPLNAI+GF+E++  + FG L + +  EYA+ +  + +
Sbjct: 576 EALETADRLKSEFIANVSYQLRTPLNAIMGFAEILNNQYFGPL-NPRQIEYARGVLEASR 634

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL- 652
            LL ++N+IL+++ IE   + +++   D+  ++N    L    A+ + + +   IP+ + 
Sbjct: 635 RLLALVNDILDLATIEAGFMVLERAPVDVAGLVNGVAMLTRDWARQQELDLRTDIPAGIG 694

Query: 653 FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKI 712
              AD++ +K+ LF ++SN+++FT   G++++   + G  V++++ DTGIGIP+   +++
Sbjct: 695 TLEADEKRLKQALFNLVSNAVRFTPAGGRIILSARRAGDEVVLSVRDTGIGIPQDDQQRV 754

Query: 713 GQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              FE  H+Q     GG GLGL++  +   LHGGR++I S    GT V   +P
Sbjct: 755 FGRFERAHHQ--SRSGGAGLGLSLVKSFIELHGGRVEIDSAPEHGTEVRCHLP 805


>gi|254411336|ref|ZP_05025113.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Microcoleus chthonoplastes PCC 7420]
 gi|196181837|gb|EDX76824.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Microcoleus chthonoplastes PCC 7420]
          Length = 789

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 137/237 (57%), Gaps = 8/237 (3%)

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGS-----VKYYEYAQDIHYS 591
           + AN  KSEFLA MSHELRTPL  ++G S  + +   GE GS      K   Y Q I  +
Sbjct: 411 QAANHAKSEFLAAMSHELRTPLTCVIGLSATLLRWSLGEGGSKTVSIEKQRRYLQTIQEN 470

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI--EKKIP 649
           G+HLL +IN+IL+ S++E  K  ++     L  +  + +R +   A S  +++  + ++P
Sbjct: 471 GEHLLALINDILDFSQLEAGKAVLNINEFSLRYLAQQTLRSLKEKASSGQVELILDWQVP 530

Query: 650 S-ELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
           + +  F AD R +++ILF +L N+IKFT   G++ +R  +     +  I DTGIGIP+  
Sbjct: 531 TPKDRFQADPRRLRQILFNLLGNAIKFTPAGGQVTLRGWREQNRAVFQIEDTGIGIPQEQ 590

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +  + Q F+ L   Y ++  G GLGLA++  L  LHGG + + S  GKG+I T+ +P
Sbjct: 591 IPLMFQKFQQLEKTYQRTYEGTGLGLALTQQLVELHGGTIDVESTVGKGSIFTVRVP 647


>gi|298505027|gb|ADI83750.1| sensor histidine kinase [Geobacter sulfurreducens KN400]
          Length = 456

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 148/248 (59%), Gaps = 9/248 (3%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
            ++ Q  +E AE+AN  KSEFLA MSHELRTPLNA++GF++V+   I+GE+  ++  E+ 
Sbjct: 199 TSELQAAREMAESANLAKSEFLATMSHELRTPLNAVIGFTDVLLSRIYGEVTDIQ-AEFL 257

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
             +  S +HLL++IN+IL++SKIE +++ ++  + D+  + +  + ++   AQ   I++ 
Sbjct: 258 GYVLQSSRHLLSLINDILDLSKIEADRMELEPSDVDIRQLASGSLVMVKERAQQHRIRLT 317

Query: 646 KKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTS--KIGQC---VIITIA 698
           +++   +     AD+R +K+I+F +L+N++KFT + G + +        +C   ++I + 
Sbjct: 318 EEVAPAVPPTITADERKLKQIVFNLLANAVKFTPDGGSVTLSVGLPPAEECEGGIMIAVQ 377

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKG 757
           DTGIG+    LE+I  PF        +   G GLGL ++  L  LHGG ++  S   G G
Sbjct: 378 DTGIGLAAGDLERIFDPFVQADGSATRRYEGTGLGLPLTRKLVELHGGTIRAESPGPGLG 437

Query: 758 TIVTICMP 765
           +   + +P
Sbjct: 438 STFRVIIP 445


>gi|159897998|ref|YP_001544245.1| multi-sensor hybrid histidine kinase [Herpetosiphon aurantiacus ATCC
            23779]
 gi|159891037|gb|ABX04117.1| multi-sensor hybrid histidine kinase [Herpetosiphon aurantiacus ATCC
            23779]
          Length = 1380

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 153/256 (59%), Gaps = 11/256 (4%)

Query: 513  QILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI 572
            Q L++Q  ELSIANA      E A+ A + K EFLA MSHELRTPL  IL F+E ++ + 
Sbjct: 870  QTLQQQTDELSIANA------ELAKAA-RLKDEFLASMSHELRTPLTGILAFTEALRYDQ 922

Query: 573  FGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
            +G L   +     Q I  + +HLL++IN+IL++SKIE  K++I+ Q+  +  I    IR+
Sbjct: 923  YGALNQAQAQALQQ-IDENSRHLLDLINDILDLSKIEAGKLTINHQSMLIDEICQASIRM 981

Query: 633  IGSSAQSKNIKI-EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ 691
            +   AQ+K +++  +   ++    AD R +K++L  +LSN++KFT   G++ +      Q
Sbjct: 982  VQKLAQNKQLELLYEPCAADAMLCADSRRLKQMLVNLLSNAVKFTPAGGRIGLSVKLDSQ 1041

Query: 692  C--VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
               V +T+ DTGIGI    + K+ +PF  L ++  +   G GLGLA+   + NLHGGR++
Sbjct: 1042 FHQVELTVWDTGIGINTQDIPKLFRPFSQLDSKLSRQYAGTGLGLALVYHMANLHGGRVE 1101

Query: 750  IISQEGKGTIVTICMP 765
            + S+ G G+   + +P
Sbjct: 1102 LQSEVGVGSQFRLVLP 1117


>gi|91774312|ref|YP_567004.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanococcoides burtonii DSM 6242]
 gi|91713327|gb|ABE53254.1| luxQ-like PAS sensor signal transduction histidine kinase
           [Methanococcoides burtonii DSM 6242]
          Length = 371

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/259 (38%), Positives = 152/259 (58%), Gaps = 7/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L+ +R I ER+K E ++ +AK       AE ANK+KSEFLA MSHELRTPLN+I+GFS+V
Sbjct: 105 LAVARNITERKKAEEAMLSAKLA-----AEDANKSKSEFLANMSHELRTPLNSIIGFSDV 159

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           I  E  G L  ++  ++  ++  +G+HLLN+IN+IL  S+IET K+ +      +   IN
Sbjct: 160 ISNESHGSLNELQK-KFISNVISNGKHLLNIINDILSASQIETGKMELHISEFHVSESIN 218

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           E   L+   A  KNI+++  I   +    AD    ++I++ +++N+IKFTN   K+ IR 
Sbjct: 219 EIEVLMIPIASEKNIELKFNIDIGMPNIRADATKFEQIIYNLVNNAIKFTNEGEKVEIRG 278

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 V I++ D+GIGI      K+  PF  + +   +  GG GLGLAI      +HGG
Sbjct: 279 EISDDFVHISVKDSGIGISPDDQNKLFTPFFQVDSSNTREYGGTGLGLAIVKKYVEMHGG 338

Query: 747 RLKIISQEGKGTIVTICMP 765
           ++ + S+ GKG+     MP
Sbjct: 339 KVWVESEVGKGSTFGFRMP 357


>gi|294494881|ref|YP_003541374.1| GAF sensor signal transduction histidine kinase [Methanohalophilus
           mahii DSM 5219]
 gi|292665880|gb|ADE35729.1| GAF sensor signal transduction histidine kinase [Methanohalophilus
           mahii DSM 5219]
          Length = 621

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 137/241 (56%), Gaps = 1/241 (0%)

Query: 525 ANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEY 584
           AN  +   K   E    TK+EF+A MSHELRTPLNAI+GFS+++    +G +   K  +Y
Sbjct: 373 ANKAFLRAKSLEEDVKTTKTEFIATMSHELRTPLNAIIGFSQLLSSNRYGNMNE-KELKY 431

Query: 585 AQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI 644
           +  I   G+HLLN+IN+IL+ SKI + K+ ++ +  +L  I +E    I   A  K I +
Sbjct: 432 SFSILKGGKHLLNLINDILDFSKIHSNKMELNIETINLKEICDEIKTFITPLATKKGITV 491

Query: 645 EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGI 704
           E     ++  N DK    +I+  +LSN++KFT + GK+ +    + + V +++ D+GIGI
Sbjct: 492 EYNNKFDIDINLDKLKFIQIMSNLLSNAVKFTPDKGKVSVDIDFVAEYVQVSVTDSGIGI 551

Query: 705 PKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
           P+  L  I  PF    +   +  GG GLGLA+      +HGG + + S+ GKG+  T  +
Sbjct: 552 PEHKLNMIFDPFIQADSSNTRKYGGTGLGLALVKEYVEMHGGTIWVESELGKGSTFTFTI 611

Query: 765 P 765
           P
Sbjct: 612 P 612


>gi|92118136|ref|YP_577865.1| multi-sensor signal transduction histidine kinase [Nitrobacter
           hamburgensis X14]
 gi|91801030|gb|ABE63405.1| multi-sensor signal transduction histidine kinase [Nitrobacter
           hamburgensis X14]
          Length = 614

 Score =  155 bits (393), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 149/259 (57%), Gaps = 6/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           ++  R I ER+  E ++      +    AE A+  K+ FLA MSHELRTPLNAI+GFSE+
Sbjct: 320 VAVMRDITERKHQEHAL-----DLALTTAERADAAKTRFLATMSHELRTPLNAIIGFSEM 374

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           + +E    L + +  EYAQ I+ SGQHLL+++N+IL++SK+E+    I  +      ++ 
Sbjct: 375 MVQEDALSLDAARRKEYAQLINDSGQHLLSVVNSILDISKMESGNFEILPEPFAPREVLL 434

Query: 628 EGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
               L+   A+   I++  ++P +L     D R  ++I+  ++SN++KFT   G++ I  
Sbjct: 435 NSSNLLALKARDNGIELVTRVPEDLPQITGDPRAFRQIVLNLVSNAVKFTERGGRVTISA 494

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
              G  +++ + D G+GI +  L++IG PF      Y +   G GLGL+I  +L  LH G
Sbjct: 495 RVEGSRMVLRVMDNGVGIAQEDLKRIGDPFFQAGKTYQRRHEGTGLGLSIVKSLVALHRG 554

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S+  +GT VT+ +P
Sbjct: 555 EIDVQSKVEEGTTVTVMLP 573


>gi|90419932|ref|ZP_01227841.1| signal transduction histidine kinase [Aurantimonas manganoxydans
            SI85-9A1]
 gi|90335973|gb|EAS49721.1| signal transduction histidine kinase [Aurantimonas manganoxydans
            SI85-9A1]
          Length = 1040

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 142/235 (60%), Gaps = 2/235 (0%)

Query: 533  KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
            +  AE A+  KS+FLA +SHELRTPLNAI+GF++VI  E FG +G+ +Y EY  DI  SG
Sbjct: 799  RSEAEAASLQKSQFLANVSHELRTPLNAIIGFADVIATECFGPIGNERYLEYLDDIKRSG 858

Query: 593  QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             H+L+++N++L++SKIE  K+ +  +   L  +I E + L+   A  + + +   +PS +
Sbjct: 859  HHVLDLVNDLLDISKIEAGKLELAFEAVSLNEVIGEVVALMQPQANREQVIVRSNLPSSV 918

Query: 653  -FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIGIPKSALE 710
                AD+R +++I   ++SN+++FT   G++++ TS   +  V++   D+GIG+ +  +E
Sbjct: 919  PPVVADRRSMRQIALNLVSNAVRFTPAGGQIIVSTSYSPEGDVVVRFRDSGIGMSEDEIE 978

Query: 711  KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
                PF+ ++    +   G GLGL ++ AL   +     + S  G+GT+V I  P
Sbjct: 979  IAMMPFQQVNPGNRRRGEGTGLGLPLTKALAEANRAGFAMSSTPGEGTLVEISFP 1033


>gi|315122143|ref|YP_004062632.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495545|gb|ADR52144.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 806

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 146/238 (61%), Gaps = 5/238 (2%)

Query: 533 KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
           K+ AE  N  K++FLA++SHE+RTPL AI+GFSEVIK + FG +GS +Y EYA  I  SG
Sbjct: 567 KKMAEKENSHKNDFLARVSHEIRTPLTAIIGFSEVIKNQRFGPVGSPRYIEYANYIDRSG 626

Query: 593 QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             +L+++N++L++SKIE+ K++   ++  L   I+E I L+   A  K I +     +++
Sbjct: 627 NLVLDIVNDLLDISKIESGKMNFHFESVSLNETISEAISLMELYANEKRILVRTSFSNDI 686

Query: 653 --FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVIITIADTGIGIPKSAL 709
              F AD R IK+I   ILSN+I FT + G+++I T+    + V++ + DTGIG+    L
Sbjct: 687 PPIF-ADLRSIKQIALNILSNAIHFTPSGGQIVISTAYTRNKEVVLRVKDTGIGMTDYEL 745

Query: 710 EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM-PQ 766
           EK  +PF  + N       G GLGL ++ A+ + + G+  + S   KGT++ I   PQ
Sbjct: 746 EKAMKPFGQIPNSQQVRGEGTGLGLPLTKAMVDANMGKFSVFSTPSKGTLIEIIFTPQ 803


>gi|239831437|ref|ZP_04679766.1| integral membrane sensor signal transduction histidine kinase
           [Ochrobactrum intermedium LMG 3301]
 gi|239823704|gb|EEQ95272.1| integral membrane sensor signal transduction histidine kinase
           [Ochrobactrum intermedium LMG 3301]
          Length = 610

 Score =  155 bits (392), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLEEIATLKAELESERI-----GKGRLLAAVSHELRTPLNSIIGFSDMLSH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           E+ G+L S K  EYA  IH SG +LL ++N +L+ S++ET   SID Q            
Sbjct: 357 EMGGKLASEKQREYAGLIHQSGHYLLELVNAVLDNSRLETGNYSIDPQTLAFREAAEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  +  N++KFT + G + I  +++
Sbjct: 417 AVMLPLAEKKGVAFCHRVGNGIGELVADRRAVQQILLNLAGNAVKFTQSGGCVTIDAARV 476

Query: 690 ---GQCVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
              G+ ++  +++DTGIGI    +++IG PF   +N Y ++  G GLGL++   L  LH 
Sbjct: 477 MAEGRAMLEFSVSDTGIGIEPEDMQRIGTPFVRANNNYARAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S  G+GT+VT+ +P
Sbjct: 537 GTMQLKSCPGEGTVVTVRLP 556


>gi|91201123|emb|CAJ74182.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 1110

 Score =  155 bits (392), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 169/303 (55%), Gaps = 26/303 (8%)

Query: 476 GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
           GT+ +  DIT  K  + +L +  + L+   N+L    ++LER        NA  ++ +E 
Sbjct: 377 GTVGISKDITEEKRMKGELEKKNKELEELTNNLE--EKVLER-------TNALEKMNREL 427

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
              AN+ K  F+A  SHELRTPL++I+GFSE++ ++ FG+L + K   Y   I  S +HL
Sbjct: 428 VR-ANELKGRFIANASHELRTPLHSIIGFSEILLQKTFGDL-TEKQQRYLNTIFGSAKHL 485

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFN 655
           L ++NNIL+++KI+  K  I  Q   +  +I+E + +I   A  K I  E  +  +++F 
Sbjct: 486 LYLVNNILDLAKIDAGKAEISYQTFPVKSVIDEVLVVIRPLADRKMIVPETVVHHDVYFT 545

Query: 656 ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-------------GQCVIITIADTGI 702
           ADK   K+IL+ ++SN+IKFT ++G + I   KI              + + +++ DTGI
Sbjct: 546 ADKIKFKQILYNLISNAIKFTADSGNVGIAIEKIISDKKTFPWVTESQEFLKVSVWDTGI 605

Query: 703 GIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           GI     E+I + FE + +   +S  G GLGL+++  L  +HGG + +    G+G++  +
Sbjct: 606 GIKPEDRERIFEEFEQIDSS--KSTEGTGLGLSLTKKLVEIHGGHITVEGIYGQGSVFNV 663

Query: 763 CMP 765
            MP
Sbjct: 664 YMP 666


>gi|154251517|ref|YP_001412341.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
 gi|154155467|gb|ABS62684.1| integral membrane sensor signal transduction histidine kinase
           [Parvibaculum lavamentivorans DS-1]
          Length = 509

 Score =  155 bits (392), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 132/226 (58%), Gaps = 4/226 (1%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           KS FLA MSHELRTPLNAI+GFSEV+  EIFG+ G   Y EYA DI+ SGQHLL +IN++
Sbjct: 271 KSHFLANMSHELRTPLNAIIGFSEVMASEIFGKHGVPTYKEYANDINRSGQHLLGLINDV 330

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRII 661
           L++S+IE  +  I ++  D+  +  +  R++   AQ++ + I +     L     D R +
Sbjct: 331 LDLSRIEAGRFQITEEEVDIAHLAEDCRRILEIRAQAQRVSITEDFADGLPIVYGDARAL 390

Query: 662 KKILFPILSNSIKFT--NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           ++    +L+N+IKF+  ++  KM  R    G+ +   + D G GI +S ++K+   F   
Sbjct: 391 RQTWINLLTNAIKFSPPDSEVKMFARMEASGE-MRFGVHDNGPGIAESEIDKVLHAFTQG 449

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            +   Q   G GLGL+I   L  +HGGR ++ SQ G GT     +P
Sbjct: 450 ASGLAQPGKGSGLGLSIVKGLLAVHGGRFELKSQLGAGTQAECTLP 495


>gi|300867967|ref|ZP_07112606.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
 gi|300333988|emb|CBN57784.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
          Length = 1102

 Score =  155 bits (392), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 132/224 (58%), Gaps = 4/224 (1%)

Query: 545 EFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILE 604
           EFLA MSHELRTPL AILG SE ++ E+FG L + K ++    I  SGQHLL +IN++L+
Sbjct: 598 EFLANMSHELRTPLTAILGLSEALRDEVFGPL-TAKQHQKLATIEQSGQHLLELINDVLD 656

Query: 605 MSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKK 663
           +SKIE+ K+ +   N D+  + +  +  +   A  K IK+   +P  +     D+R +++
Sbjct: 657 LSKIESGKMELHLSNTDIQGLCDASLAFVRQQAHQKQIKLSAHVPPRIGKVKIDERRMRQ 716

Query: 664 ILFPILSNSIKFTNNNGKMMIRTSKI--GQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           +L  +LSN++KFT  +G + I        + +   +ADTGIGI    + K+ QPF  + +
Sbjct: 717 LLINLLSNAVKFTPESGAVWIEVKGDLEHETLQFIVADTGIGIAPENIGKLFQPFVQVDS 776

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            + +   G GLGLA+   +  LHGG + + S+ G G+  T+ +P
Sbjct: 777 SFTRRYAGTGLGLALVRQVIELHGGSVSLESELGSGSRFTVSLP 820


>gi|20093164|ref|NP_619239.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
 gi|19918507|gb|AAM07719.1| sensory transduction histidine kinase [Methanosarcina acetivorans
           C2A]
          Length = 1028

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 149/259 (57%), Gaps = 7/259 (2%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           L T   I   +++E  +  AK +     AE A+ TKSEFLA MSHELRTPLN+I+GFS++
Sbjct: 458 LQTGLDITAHRRSEEKLLQAKLE-----AEAASCTKSEFLANMSHELRTPLNSIIGFSDI 512

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           + + +FGEL   K  +Y  +I  SG+HLL +IN+IL++SK+E  K+ +      +  +  
Sbjct: 513 LIERVFGELNE-KQLKYVNNISGSGKHLLGLINDILDLSKVEAGKMDLHYSEFTVDSVFE 571

Query: 628 EGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
           E    +   AQ+K+++I   + P      AD+  + +IL+ ++SN+IKFT   G++ +  
Sbjct: 572 EVKSTLFPLAQAKSLEINFVVGPDFGDIQADRSRLIQILYNLVSNAIKFTPEGGRVSVYC 631

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            K G   + ++ DTGIGI     +K+ QPF  + +   +   G GLGLA+   + NLH G
Sbjct: 632 KKSGSRALFSVTDTGIGISSEDQKKLFQPFTQIDSSSARQYCGTGLGLALVKKIVNLHKG 691

Query: 747 RLKIISQEGKGTIVTICMP 765
            + + S+  KG+     +P
Sbjct: 692 DIWVESELEKGSTFMFTIP 710


>gi|296535743|ref|ZP_06897908.1| cytoplasmic sensor hybrid histidine kinase [Roseomonas cervicalis
           ATCC 49957]
 gi|296263931|gb|EFH10391.1| cytoplasmic sensor hybrid histidine kinase [Roseomonas cervicalis
           ATCC 49957]
          Length = 689

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/407 (28%), Positives = 192/407 (47%), Gaps = 70/407 (17%)

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG-NARSIIQDAQTRPIIEY 442
           L  A++  S+  V+WD NDRLV CNA Y+  Y +    + PG +   I+++        Y
Sbjct: 326 LENALDSMSDGFVMWDANDRLVACNARYKDFYQVSAPFIEPGAHFDDIMREGF------Y 379

Query: 443 RTSDPERSQDMSK----------------EIKLADSRWLQINEWCTHDGGTISVGTDITL 486
           R   P+  +D+                  E  L D RW+ I E  T  GGT+ + TDIT 
Sbjct: 380 RGQYPQAGEDLDAFLAEMRRWHRGDNPPMERLLPDGRWVLITERATPGGGTVGIRTDITE 439

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           LK    +L                                      ++ A  A + KS+F
Sbjct: 440 LKRAMQEL-----------------------------------AAARDAAAAAGEAKSQF 464

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA+MSHELRTPLN ILGF++V+  +      +    E  + +H + +HLL ++N +L++S
Sbjct: 465 LARMSHELRTPLNGILGFAQVLLND---PRLAPDQREQLRVLHEASRHLLELVNGLLDLS 521

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKI 664
           KI   K+ +  Q   L P++     L+    Q K+++    +  +L     AD   ++++
Sbjct: 522 KIAAGKLELQPQPTALAPLLERSAALLAPEVQRKSLQFALDLAPDLPPAVAADATRLRQL 581

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKI--GQCVIITIADTGIGIPKSALEKIGQPF----EP 718
           L  +LSN++KFT + G++ +R   +  G  + + + DTG G+P      + + F     P
Sbjct: 582 LLNLLSNAVKFTPHGGRVTLRARTLPDGPGLRLEVEDTGPGVPAEQRHLLFRDFVQLASP 641

Query: 719 LHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +   ++  I G GLGL+I+  L  L GGR+  ++   +G++  + +P
Sbjct: 642 VAMPHEIGI-GTGLGLSIAAQLAELMGGRIGYLAGPVRGSVFWVELP 687


>gi|73670466|ref|YP_306481.1| two component system histidine kinase [Methanosarcina barkeri str.
           Fusaro]
 gi|72397628|gb|AAZ71901.1| two component system histidine kinase [Methanosarcina barkeri str.
           Fusaro]
          Length = 729

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 148/250 (59%), Gaps = 3/250 (1%)

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
           R  TE   A    Q EK+ AE AN+TKSEFLA MSHELRTPLN+I+GF++++ ++++GEL
Sbjct: 463 RDITESKAAETLLQ-EKQIAEAANRTKSEFLANMSHELRTPLNSIIGFADLLYEQVYGEL 521

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
              +  +   +I  SG+HLLN+IN IL++SKIE  K+ +  +  +L   +N    L+   
Sbjct: 522 NE-RQLKSVGNISKSGKHLLNLINGILDLSKIEAGKMELSYKQFELASKLNIIKNLLSPI 580

Query: 637 AQSKNIKIEKKIPSELFFN-ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
           A  KN++IE  I S L    AD+    +I++ ++ N+IKF+  NG + I   K G  V I
Sbjct: 581 ADRKNVQIEISIDSSLSSIYADEARFVQIMYNLVDNAIKFSYENGLVKIEARKKGDLVEI 640

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           T+ DTGIGI      K+ +PF  + +   +   G GLGL++   +  LHGG +   S+ G
Sbjct: 641 TVTDTGIGIKPEDQSKLFKPFSQVDSFLSKQFQGTGLGLSLVKQIVQLHGGDIWFRSKPG 700

Query: 756 KGTIVTICMP 765
           +G+     +P
Sbjct: 701 EGSTFAFVIP 710


>gi|114706954|ref|ZP_01439853.1| putative sensor histidine kinase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537504|gb|EAU40629.1| putative sensor histidine kinase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 490

 Score =  155 bits (391), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 130/221 (58%), Gaps = 2/221 (0%)

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
            LA +SHELRTPLNAI+GFS +++ E+FG L S K  EY   I  SG+HLL+++N+IL++
Sbjct: 234 MLATVSHELRTPLNAIIGFSGILENELFGALNSDKQREYVGLIQSSGRHLLSVVNDILDV 293

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKI 664
           SKIE     +  ++  L  ++ E   ++   A  K + IE    P     + D+R +  +
Sbjct: 294 SKIEAGAYQLHCEHFLLDEVVEEASAMVRCQADQKGVSIEIACPPGGTTIHGDRRALNHM 353

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYD 724
           L  +L+N++KFT + G + +   + G+ + + +ADTGIGIP   + K+G+PF        
Sbjct: 354 LVNLLANAVKFT-DAGTVTLSWERAGRDLRLNVADTGIGIPADQIGKLGKPFVQASCGMS 412

Query: 725 QSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           +   G GLGLA    +  LHGG + I S EG+GT V + MP
Sbjct: 413 RRYEGTGLGLAYVRGMCELHGGAMTIESTEGEGTRVMLDMP 453


>gi|217979578|ref|YP_002363725.1| PAS/PAC sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
 gi|217504954|gb|ACK52363.1| PAS/PAC sensor signal transduction histidine kinase [Methylocella
           silvestris BL2]
          Length = 836

 Score =  155 bits (391), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/255 (34%), Positives = 151/255 (59%), Gaps = 9/255 (3%)

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKE 571
           R +   +K E  + +A+ +     AE A+  KS+FLAK+SHE+RTPLNAI+GF+EVI +E
Sbjct: 571 RDMTHWKKVERELDDARRE-----AERASALKSDFLAKVSHEIRTPLNAIIGFAEVIMEE 625

Query: 572 IFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIR 631
            FG +G+ +Y +Y +DIH SG  +++++N++L++SKIE  K+ +  +  D   I+ E + 
Sbjct: 626 RFGPIGNARYKDYLKDIHSSGSLVMSLVNDLLDLSKIEAGKMDLSFEAVDANRIVTECVS 685

Query: 632 LIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           ++   A S  + I   +  +L    AD+R +++I+  +LSN+IKFT   G++++ T+   
Sbjct: 686 IMQPQASSARVVIRLSLAPQLPHIFADERSVRQIVLNLLSNAIKFTQGGGQVIVSTALND 745

Query: 691 Q-CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLK 749
           + C  + I DTG+G+ +  L+   +PF        +  GG GLGL ++ AL   +     
Sbjct: 746 ENCAALRIRDTGVGMSEGDLKVALEPFG--QAPRARGSGGTGLGLPLTKALVEANRASFS 803

Query: 750 IISQEGKGTIVTICM 764
           I S+   GT+V +  
Sbjct: 804 IKSKVQDGTLVEVAF 818


>gi|163842855|ref|YP_001627259.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis ATCC 23445]
 gi|163673578|gb|ABY37689.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis ATCC 23445]
          Length = 609

 Score =  155 bits (391), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + SN++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLASNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|158337549|ref|YP_001518724.1| circadian input kinase [Acaryochloris marina MBIC11017]
 gi|158307790|gb|ABW29407.1| circadian input kinase [Acaryochloris marina MBIC11017]
          Length = 735

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 159/279 (56%), Gaps = 17/279 (6%)

Query: 490 NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
           +QA L++  R+ K T++     +Q+ E++  EL  A          A+++N+ KS+FLA 
Sbjct: 330 HQAALQDQVRQHKQTLD-----KQV-EQRTQELHAALLA-------AQSSNQAKSDFLAT 376

Query: 550 MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
           MSHELRTPL  ++G S  + +   G L   K     Q IH SG+HLL +IN+IL+ S ++
Sbjct: 377 MSHELRTPLTCVIGMSATLLRWSLGPLTD-KQRSCLQTIHDSGEHLLELINDILDFSHVQ 435

Query: 610 TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEK--KIPSEL-FFNADKRIIKKILF 666
           + K +++  +  L  ++ + ++++   A +  ++++   KIP E   F AD R +++IL 
Sbjct: 436 SGKATLNVSDFSLTTLVQQLLQVMRDKADAHQVQLKANLKIPPERDRFIADLRRVQQILI 495

Query: 667 PILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
            +  N+IKFT   GK+ +R       V+  + DTGIGI  S L  + + F+ L   Y ++
Sbjct: 496 SLTDNAIKFTPMGGKVTLRVWVETNTVVFQVEDTGIGISSSQLPHLFEKFQQLDGSYHRT 555

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             G GLGLA++     LH G + + S+EG+G+I T+ +P
Sbjct: 556 YEGAGLGLALAQQCVTLHQGWIDVSSEEGQGSIFTVQLP 594


>gi|323139256|ref|ZP_08074310.1| integral membrane sensor hybrid histidine kinase [Methylocystis sp.
           ATCC 49242]
 gi|322395477|gb|EFX98024.1| integral membrane sensor hybrid histidine kinase [Methylocystis sp.
           ATCC 49242]
          Length = 923

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 91/270 (33%), Positives = 153/270 (56%), Gaps = 3/270 (1%)

Query: 499 RRLKATINDLSTSRQILERQKT-ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTP 557
           R +   + +L  S +   R +T EL +AN +  V +  AE A+KTKS FLA MSHELRTP
Sbjct: 385 RSMTGELRELYGSMEDKIRARTRELQMANEELSVARVAAEEASKTKSAFLANMSHELRTP 444

Query: 558 LNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDK 617
           LNAI+G+SE+++++   + G  +  E  + I  +G+HLL +IN+IL++SKIE  K+ +  
Sbjct: 445 LNAIIGYSEMLQEDALDK-GDAEPLEDLKKIEGAGRHLLGLINDILDLSKIEAGKMEVFI 503

Query: 618 QNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFT 676
           +  D+ P++NE + ++   A+     +E   P +   F++D+  +K+ L  ++SN+ KFT
Sbjct: 504 EKVDIRPLVNEVMSIVQPLAEKNGNALELVCPDDAGSFHSDETKVKQCLLNLMSNANKFT 563

Query: 677 NNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAI 736
           +     +I        V+  ++DTG+G+ +  L ++   F        +  GG GLGLAI
Sbjct: 564 SKGKVTLIVERDAQASVVFRVSDTGLGMTEEQLGRLFLAFTQADASTTKRFGGTGLGLAI 623

Query: 737 SDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
           +    N  GG++ + S    G+  TI +P 
Sbjct: 624 TKHFCNALGGQISVQSAPDAGSTFTITLPD 653


>gi|218441977|ref|YP_002380306.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
 gi|218174705|gb|ACK73438.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7424]
          Length = 1058

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 205/424 (48%), Gaps = 59/424 (13%)

Query: 372 HLEKRYAE---ADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD--------- 419
            L+K +AE      RL++ +E     + + D   +L   N   Q+  G+           
Sbjct: 430 QLQKSFAELQNTQHRLNQFLEAIPVGISVHDTTGKLYYANRKSQEILGITSPLDAQKEQL 489

Query: 420 ----HVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCT--- 472
               H    G  +  +   +T P+I     +    +DM       D++ + I  W T   
Sbjct: 490 SQAYHTYQAGTNQ--LYPIETMPVIRALRGETAYVEDMELH---QDNKIIPIEVWATPIY 544

Query: 473 HDGG----TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAK 528
            D G     I+   DIT  KH +  L +    L+         +Q+++R   EL+ A   
Sbjct: 545 DDQGQIVYAIAAFQDITQRKHTEQLLADYNHTLE---------KQVIQR-TAELAEA--- 591

Query: 529 YQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDI 588
               KE+AE AN+ KS F+A MSHELRTPLNAILGFS+++ +         ++ E  Q I
Sbjct: 592 ----KEKAEVANQAKSRFIANMSHELRTPLNAILGFSQLMNR---STTLPPEHQENIQII 644

Query: 589 HYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI---- 644
           + SG++LL +INNIL ++KIE  K S++  N DL  ++NE   +   +A+ KN+ +    
Sbjct: 645 NRSGEYLLTLINNILTLAKIEAGKTSLNLSNFDLYSLLNEIEEIFYLAAKKKNLNLTFER 704

Query: 645 EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ---CVIITIADTG 701
           +K IP   +   D+  ++++L  +LSN+IKFT   G +++    + Q    ++ T+ DTG
Sbjct: 705 DKTIPQ--YIRTDEVKLREVLINLLSNAIKFT-PRGDILVDVQTLSQKPITLLFTVKDTG 761

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           +GI    L+ +   F    +  + S  G GLGLAIS     L GG L + SQ   GTI  
Sbjct: 762 VGITPEELDILFDAFSQTQSGKN-SQEGTGLGLAISRQFVELMGGELTVDSQIAVGTIFR 820

Query: 762 ICMP 765
             +P
Sbjct: 821 FTLP 824


>gi|21228983|ref|NP_634905.1| sensor histidine kinase/response regulator [Methanosarcina mazei
           Go1]
 gi|20907524|gb|AAM32577.1| Sensor histidine kinase/response regulator [Methanosarcina mazei
           Go1]
          Length = 854

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 147/250 (58%), Gaps = 6/250 (2%)

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           +R++ E  +  AK       AE+AN++ SEFLA MSHELRTPL AI+GFSE++     GE
Sbjct: 260 DRKQAEEELLQAKIA-----AESANRSMSEFLATMSHELRTPLTAIIGFSELMLGGSTGE 314

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
              +   ++  +I  SG+HLL++IN+IL++SKIE  K+ +      L  I +    ++  
Sbjct: 315 FDELNK-KFLGNISTSGKHLLSLINSILDLSKIEAGKMELQSDYFSLQDIFSNTKNILSP 373

Query: 636 SAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVII 695
            A  KNI ++  +    F  AD+   K+I++ ++SN++KFT   G + +      + V +
Sbjct: 374 LALKKNISMDFNVEPGFFVYADRTRFKQIMYNLVSNAVKFTQKGGSVEVLGIVSEKGVRV 433

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI K  ++++ +PF+ + +   +   G GLGL +S     +HGGR+ + S+ G
Sbjct: 434 SVSDTGIGISKDEIKQLFKPFKQIDSTLSRKYEGTGLGLVLSKKFVEMHGGRIWVESEPG 493

Query: 756 KGTIVTICMP 765
           KG+  T  +P
Sbjct: 494 KGSTFTFEVP 503


>gi|73537902|ref|YP_298269.1| PAS/PAC sensor hybrid histidine kinase [Ralstonia eutropha JMP134]
 gi|72121239|gb|AAZ63425.1| PAS/PAC sensor hybrid histidine kinase [Ralstonia eutropha JMP134]
          Length = 1284

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 134/495 (27%), Positives = 235/495 (47%), Gaps = 64/495 (12%)

Query: 309 DNKKICEIARSVTGKHVKQLD---QIFHMRHASGADIWIQVRAQMM-------------- 351
           D+  +  +A+ V      Q+    Q +  +  +GA +WI      +              
Sbjct: 276 DDAPLTRMAQQVLHSETLQVSFGYQDYRGKRVAGAGLWIPALGSALILEQDMEEALSSYL 335

Query: 352 --RTISGGMN-----IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRL 404
             RT+   M      +IG+A     K   + R A++++RL   ++ +   + L D+N   
Sbjct: 336 STRTVVASMAAAIMLLIGVAAWALRKS--QHRLAQSEERLRALLDHSPAIMHLKDRNHAF 393

Query: 405 VMCNANYQKAYGLP-DHVLVPGNARSIIQDAQTRPI--IEYRTSDPERSQDMSKEIKLAD 461
           +  N + +K  GL  D VL   +    +    TR    IE R     R+++    ++  +
Sbjct: 394 LQLNPSMEKLLGLTRDQVLGKTDRELAVMPDGTRERWEIEARVMATGRAEEQIYAMEAPE 453

Query: 462 -SRWLQINEWCTHDG------GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
            SR L++  +  HD       G  +VG DIT  +    +L+E  + L+          ++
Sbjct: 454 GSRQLRVIRFPVHDPTSNAVVGVGAVGIDITDQERANRELKEMSQTLE---------HKV 504

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
            ER + EL++ANA+    K  AE+A + K+ FLA MSHE+RTP+NA++G + +       
Sbjct: 505 WERTR-ELAVANAELAKAKHEAESAAQAKASFLANMSHEIRTPMNAVIGMAHLALSTQL- 562

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
                +  +Y + I  SGQHLL ++N+IL++SKIE  K+ I++ +  L  ++     L+ 
Sbjct: 563 ---DPQQRDYVEKIQRSGQHLLGILNDILDLSKIEAGKLEIEQIDFSLERLLRTVGDLVS 619

Query: 635 SSAQSKN----IKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
             A +K     + ++  +P  L    D   I+++L    +N++KFT   G+++IR ++  
Sbjct: 620 ERAAAKQLELVVDVQPDVPDSL--RGDPLRIRQVLINFTTNAVKFT-ERGEIVIRVARCA 676

Query: 691 Q-------CVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
                    +   + DTGIGI   A+ ++ + FE   +   +  GG GLGLAIS  L  L
Sbjct: 677 GEHAESRVRLHFEVRDTGIGIDADAIPRLFRSFEQADSSTTRRYGGSGLGLAISHRLVTL 736

Query: 744 HGGRLKIISQEGKGT 758
            GG + + S+ GKG+
Sbjct: 737 TGGTIGVQSELGKGS 751


>gi|255615580|ref|XP_002539686.1| sensory transduction histidine kinase, putative [Ricinus communis]
 gi|223503534|gb|EEF22698.1| sensory transduction histidine kinase, putative [Ricinus communis]
          Length = 217

 Score =  154 bits (390), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 77/199 (38%), Positives = 126/199 (63%), Gaps = 4/199 (2%)

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           E+FG LG  +Y  Y+ DIH SGQHLL +IN+IL+MSKIE  K+++  +   L  +  + +
Sbjct: 4   EMFGPLGDQRYKGYSLDIHNSGQHLLALINDILDMSKIEAGKMALKFEPLHLEDVTEDAV 63

Query: 631 RLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM----IRT 686
           RL+ + A++  +K+E   P      AD R +K++L  +LSN+IKFT   G+++    IR 
Sbjct: 64  RLVRNRAEAAGLKLEVDFPPLPEIEADYRAVKQVLLNLLSNAIKFTPRQGRVVVRAEIRR 123

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
             +G+ V +++ DTGIGI    L ++ +PFE + +Q+ ++  G GLGLA++ +L  +H G
Sbjct: 124 DPLGERVKVSVTDTGIGIAAEDLARLARPFEQVESQHSKTTQGTGLGLALTKSLVEMHDG 183

Query: 747 RLKIISQEGKGTIVTICMP 765
            L+++S  G GT V+  +P
Sbjct: 184 ALEMVSTPGDGTTVSFTLP 202


>gi|325108211|ref|YP_004269279.1| multi-sensor hybrid histidine kinase [Planctomyces brasiliensis DSM
           5305]
 gi|324968479|gb|ADY59257.1| multi-sensor hybrid histidine kinase [Planctomyces brasiliensis DSM
           5305]
          Length = 797

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 167/318 (52%), Gaps = 27/318 (8%)

Query: 460 ADSRWLQIN-EWCTHDGGTISVGT--DIT--LLKHNQAQLRESKRRLKATINDLSTSRQI 514
            + RWL+I       D G + VGT  DIT   L H+Q         L  T +DL  S++ 
Sbjct: 315 GEQRWLEILISPVFSDDGAVFVGTIEDITEKKLAHDQ---------LGKTADDLRISKEQ 365

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
           LE+    L     + +V KERAE + ++KSEFLA MSHE+RTP+ AILG+++V+  E+  
Sbjct: 366 LEKNSRRLQDVVEQLEVAKERAEQSARSKSEFLANMSHEIRTPMTAILGYTDVLLHEV-- 423

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
              +  + +    I  +G+HLL +IN+IL++SKIE  K+ ++        +I +   L+ 
Sbjct: 424 -ADNPHFQDSLTTIKRNGEHLLQIINDILDISKIEAGKMEVEIIPTSPTQLIADVYTLMA 482

Query: 635 SSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNG---KMMIRTSKI 689
             AQ K++++  +  S L      D   +++IL  ++SN+IKFT+  G   +  I     
Sbjct: 483 VRAQEKDVELSYEFASRLPHTIQTDPTRLRQILLNLVSNAIKFTDKGGVRIRAAIEQGLP 542

Query: 690 GQC---VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
           GQ    + I + D+GIG+      K+ QPF        +  GG GLGL IS  L    GG
Sbjct: 543 GQTDPRLAIYVQDSGIGMSDEQKAKLFQPFTQADTSMSRRFGGTGLGLTISQRLAQKLGG 602

Query: 747 RLKIISQEGKGTIVTICM 764
           ++ + S  GKG+  T C+
Sbjct: 603 KISVESMPGKGS--TFCV 618


>gi|157737045|ref|YP_001489728.1| two-component sensor histidine kinase [Arcobacter butzleri RM4018]
 gi|157698899|gb|ABV67059.1| two-component sensor histidine kinase [Arcobacter butzleri RM4018]
          Length = 765

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 154/275 (56%), Gaps = 9/275 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L  N+  +   K      + D+  + +I +    +L  +  + ++  E A+ AN+ KS F
Sbjct: 264 LSSNETNVEIEKNEFDDEMGDMIGAVEIFKENTEKLITSEHQLKIAMEDAKNANQAKSIF 323

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA+MSHELRTPLNAILGF+ ++KK +     + +  E    I  SG+HLLN+IN ILE+S
Sbjct: 324 LARMSHELRTPLNAILGFANILKKSMN---ATNQEKENLNIIKKSGEHLLNIINEILELS 380

Query: 607 KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKI 664
           KIE  KI I+ +N D   +I E   +     +SKN+K      + L  F  AD++ +++I
Sbjct: 381 KIEAGKIEINPKNFDFCELIKEIEDIFALRCKSKNLKFTINQTNNLPKFIKADEQRLRQI 440

Query: 665 LFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH-NQY 723
           L  +L NS+KFT N G++ +    +   +   + DTGIGI     EKI +PFE +  + Y
Sbjct: 441 LINLLGNSLKFT-NEGQIFLNIYSLNNKLFFEVKDTGIGIDLKNQEKIFKPFEQVKLDNY 499

Query: 724 DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
            Q   G GLGLAI+  L  L GG + + SQ  KG+
Sbjct: 500 TQQ--GTGLGLAITKELIALMGGTIYVKSQINKGS 532


>gi|124268351|ref|YP_001022355.1| signal transduction histidine kinase-like protein [Methylibium
           petroleiphilum PM1]
 gi|124261126|gb|ABM96120.1| signal transduction histidine kinase-like protein [Methylibium
           petroleiphilum PM1]
          Length = 1077

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 204/412 (49%), Gaps = 45/412 (10%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPG 425
           ++TE+   E+   E++QR           +V  D   R+   NA Y    G         
Sbjct: 548 EITERLATEQALRESEQRFRSIFNSVPIGVVYTDLQGRIKQPNAAYCTMTG--------- 598

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSR---WLQINEWCTHDGGTISVGT 482
                 ++      +   T   +R+ D++ +  L D R   + +   + T +G  + V  
Sbjct: 599 ----YSEEELLSLSLASLTHPEDRAADLASQQDLVDGRLPLYRRRKRYVTRNGPVLWVSV 654

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
            ++LL+    Q      RL   + D+S   ++ E +              +E AETAN+ 
Sbjct: 655 TVSLLRDEHGQ----PHRLVGLVEDISEHLRLEEAEHA------------RESAETANRA 698

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K+EFL++MSHELRTPLNA+LGF++++  +  GE    ++  +   I  +G HLL MIN++
Sbjct: 699 KNEFLSRMSHELRTPLNAMLGFAQLLDLD-RGEPLHERHRMWVTQIQQAGWHLLEMINDV 757

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI----PSELFFNADK 658
           L++S+IE+  +S+  ++  L P+I   + L+   A+ + + + + +    P ++  +A +
Sbjct: 758 LDLSRIESGTLSLQVESLSLEPLIAASMALVEPQARGRGLTLVRTMAEHAPLQVLGDATR 817

Query: 659 RIIKKILFPILSNSIKFTNNNGKMMIRTSKI----GQCVI-ITIADTGIGIPKSALEKIG 713
             +K+IL  +LSN++K+    G++ + T +     G  ++ + + DTG+GI    L ++ 
Sbjct: 818 --VKQILTNLLSNAVKYNREAGEVRVSTRRTEDRDGTPMLELDVCDTGLGIEPQLLTQLF 875

Query: 714 QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           QPF  L  +   +  G G+GL I+  L    GG LK+ S+ G G+  T+ +P
Sbjct: 876 QPFNRLGRERG-ATEGTGIGLVIAKLLAERQGGSLKVRSEPGVGSTFTLRLP 926


>gi|307316590|ref|ZP_07596033.1| integral membrane sensor hybrid histidine kinase [Sinorhizobium
           meliloti AK83]
 gi|306897788|gb|EFN28531.1| integral membrane sensor hybrid histidine kinase [Sinorhizobium
           meliloti AK83]
          Length = 917

 Score =  154 bits (390), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/419 (28%), Positives = 206/419 (49%), Gaps = 65/419 (15%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH---VLVPG 425
           EK  LE       + ++ A+E  S+  VL+D  DR+++ N+ Y + +  P H    L   
Sbjct: 271 EKKKLEDEAERQRRTIAAALEVISDGFVLYDSEDRILVANSKYCEIF--PSHKPNTLRGR 328

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQD-----------MSKEIKLADSRWLQINEWCTHD 474
           + R I++       ++     P+   D           +  E +  D +W++I++    D
Sbjct: 329 SFREIVEQNLEMGQVDLEGKSPQEWVDERVRLHRDPAGLVDEKRFGD-KWVRISKRKIPD 387

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GGT++V TDIT LK  Q +L                     ER K+              
Sbjct: 388 GGTVAVYTDITELKQRQVEL---------------------ERAKSH------------- 413

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD---IHYS 591
            AE+AN+ KS FLA MSHELRTPLNAI+G+SE++ +E        +  E   D   I  +
Sbjct: 414 -AESANEAKSRFLASMSHELRTPLNAIIGYSEMLIEEARDH----EDEELVPDLDKIASA 468

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
           G+HLL++IN+IL++SKIE  K+ +  +   +  ++ +    +         ++ +   ++
Sbjct: 469 GRHLLSLINDILDLSKIEANKMEVFLETFSVADLLRDVAATVAPLMARNGNELTQDFETD 528

Query: 652 LF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPK 706
           L   ++D+  +++ LF +LSN+ KFT N G++ +R  +  +     ++  + DTGIG+  
Sbjct: 529 LGEMHSDQTKLRQNLFNLLSNAAKFT-NGGRVTLRVRREQRADRDWLVFQVTDTGIGMSP 587

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              E++   F        ++ GG GLGL+I+ +   + GG + + S+ GKG++ TI +P
Sbjct: 588 EQQERLFNAFTQADASTTRNYGGTGLGLSITRSFCRMIGGVVTVESEVGKGSVFTIEVP 646


>gi|254787007|ref|YP_003074436.1| sensory box histidine kinase/response regulator [Teredinibacter
           turnerae T7901]
 gi|237685955|gb|ACR13219.1| sensory box histidine kinase/response regulator [Teredinibacter
           turnerae T7901]
          Length = 668

 Score =  154 bits (390), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 126/517 (24%), Positives = 246/517 (47%), Gaps = 54/517 (10%)

Query: 267 GLWNFNFDNKKFHLSRSMYEIMGIP-YENKTLSF-RAIARLIHYDNKKICEIARSVTGKH 324
           G W ++    K     + +  +G    + +T++    +   IH D++ + + A + T + 
Sbjct: 35  GFWEWDLGTNKLRWYGTFWRELGYSELDIQTMTAPEVLLNYIHPDDRALFQQAVTATIRE 94

Query: 325 VKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMN-IIGIAMDLTEKYHLEKRYAEADQR 383
              LD  + ++  +G  +W++V  Q  R  SG  + + G   ++++    E+    ++ R
Sbjct: 95  GVALDLCYRLQAKAGYYLWVRVNGQGFRDASGWTHQLAGANYNISQLKQTEQALRASEAR 154

Query: 384 LSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQ-DAQTRPIIEY 442
            S+ I  T + +  W  ++ ++  +    +  G     +   N  +I   +A+  P+   
Sbjct: 155 YSRIIAGTRDGVWDWSFDNNVISFSDICWEQIGFTAEDVRELNLTTIADWEARMSPVDVK 214

Query: 443 RTSDPERSQ-------DMSKEIKLADS--RWLQINEWCTHDGGTISVGTDITLLKHNQAQ 493
           R  +  R         D+  +IK  D   RW++     T++                   
Sbjct: 215 RFKEALRKHILERAPFDIEYQIKAKDGTQRWIRARAEATYN------------------- 255

Query: 494 LRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHE 553
             +  R +K +     ++  I E + T+L++  AK       AE AN+ KSEFL+ MSHE
Sbjct: 256 --KEGRAVKIS----GSNMDITELKNTQLAVVQAKVA-----AEQANQAKSEFLSSMSHE 304

Query: 554 LRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKI 613
           LRTPLNAILG+ ++     +    +    +  Q++  +G HLL++IN +L+++KIE  ++
Sbjct: 305 LRTPLNAILGYVQLFD---YDTNLTPDQCDNLQEVKKAGTHLLHLINEVLDLAKIEAGRM 361

Query: 614 SIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI----PSELFFNADKRIIKKILFPIL 669
           ++  +      +++E +RL+   AQ + I IE+       S +F  AD   +K+ L  ++
Sbjct: 362 TLSMEPVYPQRLLDEAVRLVSPLAQEQGITIERDALQHQQSAIF--ADNTRLKQALLNLI 419

Query: 670 SNSIKFTNNNGKMMIRTSKIGQCVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG 728
           SN++K+   +G + I  + +G+  + I + DTG GIP +   ++ +PF  LH +   ++ 
Sbjct: 420 SNAVKYNTKDGSVNISLTAVGEGRLRIMVTDTGRGIPDALQAQVFEPFNRLHAELG-AVE 478

Query: 729 GFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           G G+GL I+  L  + GG L   S+ G G+   + +P
Sbjct: 479 GSGVGLVITKRLVEMMGGTLGFHSEVGVGSRFWMDLP 515



 Score = 42.0 bits (97), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query: 265 RCGLWNFNFDNKKFHLSRSMYEIMGIPYEN-KTLSFRAI----ARLIHYDNKKICEIARS 319
           R G+W+++FDN     S   +E +G   E+ + L+   I    AR+   D K+  E  R 
Sbjct: 163 RDGVWDWSFDNNVISFSDICWEQIGFTAEDVRELNLTTIADWEARMSPVDVKRFKEALR- 221

Query: 320 VTGKHVKQ---LDQIFHMRHASGADIWIQVRAQMMRTISG-GMNIIGIAMDLTEKYHLEK 375
              KH+ +    D  + ++   G   WI+ RA+      G  + I G  MD+TE  + + 
Sbjct: 222 ---KHILERAPFDIEYQIKAKDGTQRWIRARAEATYNKEGRAVKISGSNMDITELKNTQL 278

Query: 376 RYAEADQRLSKAIECTSEAL 395
              +A     +A +  SE L
Sbjct: 279 AVVQAKVAAEQANQAKSEFL 298


>gi|170721287|ref|YP_001748975.1| multi-sensor hybrid histidine kinase [Pseudomonas putida W619]
 gi|169759290|gb|ACA72606.1| multi-sensor hybrid histidine kinase [Pseudomonas putida W619]
          Length = 1155

 Score =  154 bits (389), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 163/286 (56%), Gaps = 9/286 (3%)

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
           +LK +QA L   +  L+ T   LS     L+R+  EL  A  + Q   +  + ++K KSE
Sbjct: 430 VLKESQAHLETQQAELEQTNEQLSERTDALDRKNDELMQAQQELQARADELQRSSKYKSE 489

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLN+ L  ++++ +   G L S +  ++A+ I+ +G  LLN+IN+IL++
Sbjct: 490 FLANMSHELRTPLNSSLILAKLLAENGEGNL-SAEQVKFAESIYSAGNDLLNLINDILDI 548

Query: 606 SKIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +K+E  K+ +  +   L  ++ EG+R     L      +  + +E  +P  LF   D++ 
Sbjct: 549 AKVEAGKLEVRPETTQLERLV-EGLRGMFLPLAEHKGLAFEVNVEPHVPVTLF--TDRQR 605

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH 720
           +++IL  +LSN+IKFT++    +  + + G  ++  + D+GIGI     + I   F  + 
Sbjct: 606 LEQILKNLLSNAIKFTDHGQVSLTISHQAGTGIVFAVRDSGIGIAADQQQAIFGAFHQVD 665

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
              ++  GG GLGL+IS  L +L GG++ + S  G+G++ ++ MP+
Sbjct: 666 GSSNRRYGGTGLGLSISRDLAHLLGGQISVDSNPGQGSVFSLTMPE 711


>gi|330962291|gb|EGH62551.1| sensory box histidine kinase/response regulator [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 775

 Score =  154 bits (389), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 153/257 (59%), Gaps = 14/257 (5%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R I +R+  E+++  A+     E AE A++ KSEFL++MSHELRTPLN+ILGF+++++ 
Sbjct: 378 TRDISDRRVAEIALGTAR-----EEAERASRAKSEFLSRMSHELRTPLNSILGFAQLLEM 432

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           +                I  +GQHLL +IN +L++++IE   IS+  +   L  ++ E +
Sbjct: 433 D-----SPASQRPQVGHILRAGQHLLKLINEVLDIARIEAGHISLSLEPVPLSNVLQEAL 487

Query: 631 RLIGSSAQSKNIKIE--KKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            L+   A   NI++    ++P EL   AD++ + ++L  +LSN+IK+   NG++ I   +
Sbjct: 488 VLVSPMAADGNIELPALPQLPDELGVVADRQRLIQVLLNLLSNAIKYNRPNGQVRIEVEQ 547

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
             + V +++ D+G GI    ++++ +PFE L+   D S+ G GLGLA+S ++  +  G L
Sbjct: 548 SAERVAVSVVDSGHGIAPELIDQLFKPFERLN--ADPSVEGTGLGLALSKSMLEMMHGTL 605

Query: 749 KIISQEGKGTIVTICMP 765
            + S  G+G+  T+ +P
Sbjct: 606 SVHSVPGEGSRFTLELP 622


>gi|269960019|ref|ZP_06174396.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835318|gb|EEZ89400.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 787

 Score =  154 bits (389), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 91/236 (38%), Positives = 138/236 (58%), Gaps = 9/236 (3%)

Query: 534 ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQ 593
           E+AE A K KS+FLA MSHELRTP+N +LG S++I  E        +  E+ Q I  SGQ
Sbjct: 261 EKAERAAKAKSQFLATMSHELRTPMNGVLGISQIIASET----KERETKEHVQVILDSGQ 316

Query: 594 HLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK--IEKKIPSE 651
           HL+ ++N+IL+ SK+E  K+ ++    +L  ++      I    + KNIK  +E ++P  
Sbjct: 317 HLMTILNDILDFSKVEENKLELEAAPFNLPQVLTPVCSAIQPLIEEKNIKLYVENEVPEN 376

Query: 652 LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQCVIITIADTGIGIPKSAL 709
           + FN D   I++ILF +  N++KFT++ G ++IR    +  + ++++I DTGIGIP    
Sbjct: 377 IEFNGDCARIRQILFNLAGNAVKFTSD-GHVLIRAELDEPRKRLLLSINDTGIGIPADKQ 435

Query: 710 EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++I   FE       +  GG GLGLAI   LT L GG +K+ S E  GT   + +P
Sbjct: 436 DRIFNSFEQADTSTTRKFGGTGLGLAIVKKLTELMGGEVKLKSVESIGTQFLVELP 491


>gi|157803446|ref|YP_001491995.1| histidine kinase sensor protein [Rickettsia canadensis str. McKiel]
 gi|157784709|gb|ABV73210.1| Histidine kinase sensor protein [Rickettsia canadensis str. McKiel]
          Length = 497

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 152/258 (58%), Gaps = 13/258 (5%)

Query: 511 SRQILERQKTELSIANAKYQVEK-ERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
           +RQI+E Q    +  N K Q+ K ER  ++N   ++F A +SHELRTPLN+I+GFSE++ 
Sbjct: 241 ARQIIEEQLE--TNRNLKAQIVKLERTSSSN---TKFFANISHELRTPLNSIIGFSEILM 295

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
            E   E    K   Y +DI+ +G+HLL+MIN+IL++SK   +K+ +D  + DL  +I+  
Sbjct: 296 SERDAE----KSKNYIKDINDAGKHLLSMINDILDLSKASADKLKVDSMDLDLNKLISSS 351

Query: 630 IRLIGSSAQSKNIKIEKKIPSE-LFFNADKRIIKKILFPILSNSIKFTNNNGKMMI--RT 686
           + L+ S A    + +  K+P E +   AD + +K++L  +LSN++KFTN+ G + I  + 
Sbjct: 352 LALVKSRADQAEVALISKLPKEHVVIKADPKRLKQVLLNLLSNAVKFTNSGGSVTIALKK 411

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
            ++ + V I + DTGIGI +  + K    F  + ++  +   G GLGL ++  L  L  G
Sbjct: 412 DELAKLVYIKVIDTGIGIEEKDIPKTLSVFGQIDSELSRKYEGTGLGLPLTKKLVELMKG 471

Query: 747 RLKIISQEGKGTIVTICM 764
           +  + S+  KGT VTI  
Sbjct: 472 KFDLQSKINKGTTVTITF 489


>gi|209525380|ref|ZP_03273921.1| GAF sensor hybrid histidine kinase [Arthrospira maxima CS-328]
 gi|209494231|gb|EDZ94545.1| GAF sensor hybrid histidine kinase [Arthrospira maxima CS-328]
          Length = 625

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 138/237 (58%), Gaps = 8/237 (3%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVI-----KKEIFGELGSVKYYEYAQDIHY 590
           A+ AN+ KSEFLA MSHELRTPL  ++G S  +     + + F  L   K   Y Q IH 
Sbjct: 240 AQCANRAKSEFLATMSHELRTPLTHVIGISSTLLRLYSQPDNFPALPLEKQKHYLQTIHD 299

Query: 591 SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK--NIKIEKKI 648
           SG++LL +IN+IL++S++E+ K  +      L  +  + +  +   A+ K  N+ ++ K+
Sbjct: 300 SGENLLALINDILDLSQVESGKTVLKFSEFSLQKLAQQCLHTLRDFAKEKGVNVNLQIKV 359

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
             +LF  AD R +++IL  +LSN+IKFT   G++ +  S+  +  I  + DTGIGI K  
Sbjct: 360 DQDLF-RADYRRVRQILLNLLSNAIKFTPKGGRVTLTVSRKDKTAIFQVKDTGIGISKEQ 418

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              + + F+ L + Y +  GG GLGLA++  L  LHGG ++  S+ G GT  T+ +P
Sbjct: 419 QSLLFEKFQQLDSPYRRQYGGTGLGLALTKQLVELHGGSIQFESEVGLGTKFTVYIP 475


>gi|306845191|ref|ZP_07477767.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. BO1]
 gi|306274350|gb|EFM56157.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. BO1]
          Length = 609

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRADNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|23501466|ref|NP_697593.1| sensor histidine kinase [Brucella suis 1330]
 gi|161618552|ref|YP_001592439.1| integral membrane sensor signal transduction histidine kinase
           [Brucella canis ATCC 23365]
 gi|225627084|ref|ZP_03785122.1| sensor histidine kinase [Brucella ceti str. Cudo]
 gi|254701372|ref|ZP_05163200.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 5 str. 513]
 gi|254703917|ref|ZP_05165745.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 3 str. 686]
 gi|254707707|ref|ZP_05169535.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M163/99/10]
 gi|254709710|ref|ZP_05171521.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis B2/94]
 gi|254712867|ref|ZP_05174678.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M644/93/1]
 gi|254716779|ref|ZP_05178590.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M13/05/1]
 gi|256031201|ref|ZP_05444815.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M292/94/1]
 gi|256159299|ref|ZP_05457094.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M490/95/1]
 gi|256254609|ref|ZP_05460145.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti B1/94]
 gi|256369016|ref|YP_003106524.1| sensor histidine kinase [Brucella microti CCM 4915]
 gi|260168337|ref|ZP_05755148.1| sensor histidine kinase [Brucella sp. F5/99]
 gi|260566834|ref|ZP_05837304.1| sensor histidine kinase [Brucella suis bv. 4 str. 40]
 gi|261757798|ref|ZP_06001507.1| sensor histidine kinase [Brucella sp. F5/99]
 gi|294851947|ref|ZP_06792620.1| two-component system protein [Brucella sp. NVSL 07-0026]
 gi|23347370|gb|AAN29508.1| sensor histidine kinase [Brucella suis 1330]
 gi|161335363|gb|ABX61668.1| integral membrane sensor signal transduction histidine kinase
           [Brucella canis ATCC 23365]
 gi|225617919|gb|EEH14963.1| sensor histidine kinase [Brucella ceti str. Cudo]
 gi|255999176|gb|ACU47575.1| sensor histidine kinase [Brucella microti CCM 4915]
 gi|260156352|gb|EEW91432.1| sensor histidine kinase [Brucella suis bv. 4 str. 40]
 gi|261737782|gb|EEY25778.1| sensor histidine kinase [Brucella sp. F5/99]
 gi|294820536|gb|EFG37535.1| two-component system protein [Brucella sp. NVSL 07-0026]
          Length = 609

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|304393143|ref|ZP_07375071.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
            R2A130]
 gi|303294150|gb|EFL88522.1| PAS/PAC sensor signal transduction histidine kinase [Ahrensia sp.
            R2A130]
          Length = 1323

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 147/236 (62%), Gaps = 4/236 (1%)

Query: 533  KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSG 592
            K  AE AN+ K++FLAK+SHE+RTPLNAI+GFSE++ +E  G + + +Y  Y +DI+ SG
Sbjct: 1081 KAAAEGANELKTQFLAKISHEIRTPLNAIIGFSEMMIEERLGRIDNDRYRGYLRDINRSG 1140

Query: 593  QHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             H+L+++N++L+++KIE  K+ +D    DL   ++E + ++ + A +  I I   + + +
Sbjct: 1141 AHVLDLVNDLLDITKIEAGKMEMDFDAVDLNRTVSENVAILQAEANADRIIIRTSLSTVV 1200

Query: 653  F-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQCVIITIADTGIGIPKSAL 709
                AD+R +++I+  ++SNSIKFT + G++++ T     G+ V++ + DTG+G+  S +
Sbjct: 1201 PKVVADQRSMRQIVLNLVSNSIKFTKSGGQVIVSTVYEDSGE-VVLRVRDTGVGMSASEM 1259

Query: 710  EKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            E+  QPF    +    +  G GLGL ++ AL   +     I S   +GT+V I  P
Sbjct: 1260 EQALQPFRQTASAAVSATKGTGLGLPLTKALVEANRADFHIESTPDEGTLVEIHFP 1315


>gi|254718728|ref|ZP_05180539.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. 83/13]
 gi|306838706|ref|ZP_07471541.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. NF 2653]
 gi|306406193|gb|EFM62437.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. NF 2653]
          Length = 609

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRADNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|330878543|gb|EGH12692.1| sensory box histidine kinase/response regulator [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
          Length = 775

 Score =  154 bits (388), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 151/258 (58%), Gaps = 16/258 (6%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R I +R+  E+++  A+     E AE A++ KSEFL++MSHELRTPLN+ILGF++++  
Sbjct: 378 TRDISDRRVAEIALGTAR-----EEAERASRAKSEFLSRMSHELRTPLNSILGFAQLLDM 432

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           +                I  +GQHLL +IN +L++++IE   +S+  +   L  ++ E +
Sbjct: 433 D-----SPASQRPQVGHILRAGQHLLKLINEVLDIARIEAGHVSLSLEPVSLSSVLKETL 487

Query: 631 RLIGSSAQSKNIKIEK--KIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            L+   A   NI++E+   +P EL   AD++ + ++L  +LSN+IK+   +G++ I   +
Sbjct: 488 VLVSPMAADGNIELEELPHLPDELGVIADRQRLVQVLLNLLSNAIKYNRPDGQVRIEVDR 547

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHN-QYDQSIGGFGLGLAISDALTNLHGGR 747
             + V +++ DTG GI   A E++GQ F+P      + S+ G GLGLA+S ++  +  G 
Sbjct: 548 SAERVTVSVVDTGYGI---APERLGQLFKPFERLDANPSVEGTGLGLALSKSMLEMMNGT 604

Query: 748 LKIISQEGKGTIVTICMP 765
           L + + + +G   T+ +P
Sbjct: 605 LSVQTTQNEGCCFTLALP 622


>gi|256060709|ref|ZP_05450873.1| integral membrane sensor signal transduction histidine kinase
           [Brucella neotomae 5K33]
          Length = 609

 Score =  154 bits (388), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|219850003|ref|YP_002464436.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
 gi|219544262|gb|ACL26000.1| multi-sensor hybrid histidine kinase [Chloroflexus aggregans DSM
            9485]
          Length = 1352

 Score =  154 bits (388), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 159/292 (54%), Gaps = 14/292 (4%)

Query: 477  TISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERA 536
             I  G +  +L  +    R ++ +L+A   DL   R + ER   ELS ANA      E A
Sbjct: 796  AIPTGDEAIVLVRDITAWRVAELQLQAE-RDLLAQR-VAER-TAELSRANA------ELA 846

Query: 537  ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
             +  + K EFLA MSHELRTPLN IL  SE + +E+ G L   +     Q I  SG+HLL
Sbjct: 847  RSV-RVKDEFLANMSHELRTPLNTILTLSESLLEELRGPLNE-RQRASIQLIETSGRHLL 904

Query: 597  NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE-LFFN 655
             +IN++L+++KIE  ++ + K+   +  +    + LI   A  K I++   I +    F 
Sbjct: 905  TLINDVLDVAKIEAGRMELVKEVVAVSDVCESSLVLIKEQAAKKQIRLHCVIDAPHTRFL 964

Query: 656  ADKRIIKKILFPILSNSIKFTNNNGKMMIR-TSKIGQCVI-ITIADTGIGIPKSALEKIG 713
            AD R +K+IL  +LSN++KFT   G + +R T+   Q  I   ++DTGIGI    L ++ 
Sbjct: 965  ADPRRLKQILVNLLSNAVKFTPEGGSVELRVTTDTAQGTIAFAVSDTGIGIAPDQLPRLF 1024

Query: 714  QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            QPF  L +   +   G GLGLA+   L +LHGG + + S  G G++ T+ +P
Sbjct: 1025 QPFVQLDSSLTREHEGSGLGLALVRRLVDLHGGSVSVTSTPGSGSVFTVTLP 1076


>gi|197311343|gb|ACH61904.1| putative blue light receptor protein [bacterium enrichment culture
            clone pWThLOV]
          Length = 1204

 Score =  154 bits (388), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 121/471 (25%), Positives = 223/471 (47%), Gaps = 65/471 (13%)

Query: 316  IARSV-TGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAM--DLTEKYH 372
            +AR++ +G+ V +  +++ +R   G   W+ V AQ +R       +  +    D+T++  
Sbjct: 623  VARALASGEPVTE--RVYGLRRRDGQIRWLGVSAQPLRMAPHDKPLSAVVTFRDITQQRI 680

Query: 373  LEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLV--PGNARSI 430
             E+  + ++QR   AIE + + +  WD     V  +  +++  G  +H L   P    S 
Sbjct: 681  AEQALSMSEQRWKFAIEGSGDGVWDWDAVADRVYYSRRWKELLGYQEHELTDSPEEWSSR 740

Query: 431  IQDAQTRPIIE---YRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTIS-------- 479
            +       ++E       D          ++    RWL    W    G  +         
Sbjct: 741  VHPEDLPRVLEKLELHLKDVVPVYHSEHRLRHRSGRWL----WVFERGRVVQRNEQGRAL 796

Query: 480  --VGT--DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKER 535
              VGT  DIT LK  +  LR+                                    K+ 
Sbjct: 797  RIVGTYSDITRLKEAEKALRD------------------------------------KQA 820

Query: 536  AETANKTKSEFLAKMSHELRTPLNAILGFSEVIK-KEIFGELGSVKYYEYAQDIHYSGQH 594
            AE A+++K+EFL++MSHE+RTPLNA++GFS+++K      +  + +   YA  +  +GQH
Sbjct: 821  AELASRSKTEFLSRMSHEMRTPLNAMIGFSQLLKLSATNAQPSASQVRHYADHMLQAGQH 880

Query: 595  LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFF 654
            LL +IN++L++ ++ET +++I+ +   L   I + + L+   A +  +  + +I  ++  
Sbjct: 881  LLALINDVLDLQRVETGQLTINIETISLRRTIEQALELLAPLAHASAVSFDNRIDEDVLV 940

Query: 655  NADKRIIKKILFPILSNSIKFTNNNGKM-MIRTSKIGQCVIITIADTGIGIPKSALEKIG 713
             AD + ++++L  I+SN+IK+   +G + +    + G  + + I DTG G+    L ++ 
Sbjct: 941  RADAQRLRQVLINIISNAIKYNRPDGVVRLTLGDRQGDAIDVLIEDTGEGLRPDQLARLF 1000

Query: 714  QPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
            QPFE L  +    I G GLGL I+  L +   G +++ S+ GKGT VT+ +
Sbjct: 1001 QPFERLGRET-SPIEGTGLGLIIAKRLIDEMKGSIEVSSEPGKGTCVTLMV 1050


>gi|189425046|ref|YP_001952223.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
 gi|189421305|gb|ACD95703.1| multi-sensor hybrid histidine kinase [Geobacter lovleyi SZ]
          Length = 767

 Score =  154 bits (388), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 118/399 (29%), Positives = 198/399 (49%), Gaps = 48/399 (12%)

Query: 379 EADQRLSKAIECTSEALVLWDKNDRLVMCN--ANYQKAYGLPDHVLVPGNARSIIQDAQT 436
           +++QR    IE   +A+ + D N +++  N     Q  Y L + ++ P +      D QT
Sbjct: 245 QSEQRFRSMIENAGDAIYIHDHNGKILSANQVCCCQTGYTLDELLMSPVSLVDRQIDVQT 304

Query: 437 -RPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLR 495
              I    T+ P R       +K   +R          DG +  V   ++LL        
Sbjct: 305 LEEICRLATAAPAR---FPMTLKTVHTR---------KDGSSFPVEVRLSLLPAGD---- 348

Query: 496 ESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELR 555
                    ++ ++  R I ER++ E  +  AK       AETAN TKSEFLA MSHE+R
Sbjct: 349 --------DVHFVAMVRDITERKRAEDELLRAKAA-----AETANTTKSEFLANMSHEIR 395

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TP+N ++G +++++     E  S +Y EY   I    +HL+++IN++L++SKIE  K+ +
Sbjct: 396 TPMNGVIGNAQLLRFTDLTEEQS-RYLEY---IEADAKHLVSVINDLLDISKIEAGKMEL 451

Query: 616 DKQNADLIPIINEGIRLIGSSAQSK----NIKIEKKIPSELFFNADKRIIKKILFPILSN 671
           ++ +  L   IN+ ++ +     +K    N +I   +P  L    D+  +K+IL  ++ N
Sbjct: 452 EQTSFSLRGCINDLLKPMTPRIATKGLIFNTEIANTVPDAL--TGDQLRLKQILRNLVGN 509

Query: 672 SIKFTNNNGKMMIRT-----SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
           +IKFT+  G + +R      S+       ++ DTGIGIP+ ALE++  PF    +   + 
Sbjct: 510 AIKFTDQ-GSITLRVELLEHSENKALFYFSVIDTGIGIPQEALERLFTPFTQADSSVTRK 568

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            GG GLGL+I + L  L GG + + S EG G+   + +P
Sbjct: 569 FGGTGLGLSICNRLAGLMGGNISVESSEGAGSCFHVTLP 607


>gi|320322879|gb|EFW78970.1| two-component sensor/regulator [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320329812|gb|EFW85800.1| two-component sensor/regulator [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330874310|gb|EGH08459.1| two-component sensor/regulator [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330890506|gb|EGH23167.1| two-component sensor/regulator [Pseudomonas syringae pv. mori str.
           301020]
          Length = 576

 Score =  154 bits (388), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 168/310 (54%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNVELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE +K  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALKDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           +IL++SK+E   ++++ +  DL  +++  + ++   A  + I+++ +  ++      D+R
Sbjct: 373 DILDLSKVEAGMMTLELEPVDLDELLSNSLLIVREQAALQRIQLKLETEADFGLLELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVII---------------------- 695
             K+I++ +L+N++KF+   G   + +R     Q  +I                      
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLAVRQVSFAQAGVIEGDWPAHTFPLPSSEYEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|148559005|ref|YP_001258574.1| sensor histidine kinase [Brucella ovis ATCC 25840]
 gi|148370262|gb|ABQ60241.1| sensor histidine kinase [Brucella ovis ATCC 25840]
          Length = 609

 Score =  153 bits (387), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 302 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 356

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 357 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 416

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 417 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 476

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 477 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 536

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 537 GSMQLKSRPGEGTVVMIRLP 556


>gi|269839224|ref|YP_003323916.1| PAS/PAC sensor hybrid histidine kinase [Thermobaculum terrenum ATCC
            BAA-798]
 gi|269790954|gb|ACZ43094.1| PAS/PAC sensor hybrid histidine kinase [Thermobaculum terrenum ATCC
            BAA-798]
          Length = 1363

 Score =  153 bits (387), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 129/528 (24%), Positives = 243/528 (46%), Gaps = 47/528 (8%)

Query: 242  KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRA 301
            + K  +  L E+     +A      G+     D +   ++ S+  ++G  Y  + L    
Sbjct: 570  QRKRAEEALRESMELFVSAFDHAPIGMALVATDGRWLRVNPSLCRMLG--YSERELLGMT 627

Query: 302  IARLIHYDNKKI-CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISG-GMN 359
               + H D+ ++  +  R V    + Q +      H  G+ +W  +   ++R + G  + 
Sbjct: 628  FQDITHPDDLELDLQHVRQVLDGEIAQYEMEKRYYHKHGSIVWALLSVSLVRDLDGQPLY 687

Query: 360  IIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPD 419
             +    D+T++  +E+   E+++R  + +E   + L+   ++ R+   N    +  G  D
Sbjct: 688  FVSQIQDITQRKEIERAITESEERYRRLVEAFPD-LIAIVQDGRVAYVNPAGARMLGAKD 746

Query: 420  HVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTIS 479
                        Q+   R ++E+    PER  +++ +I                +GG   
Sbjct: 747  P-----------QELVGRSVLEF--VHPERRGEVAAQID------------SIGEGGPPP 781

Query: 480  VGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETA 539
               +   +  +  ++    + +  +  D   S QI+ R  TE      + +  +++A  A
Sbjct: 782  DSIEERFITLDGREIYAEVKVVPTSHEDRPAS-QIIARDITESRRVAEELRRARDQAIEA 840

Query: 540  NKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMI 599
            ++ KSEF+A MSHE+RTPLNAI+G +E+++     E    +  E+ Q I  S Q LL++I
Sbjct: 841  SRLKSEFVANMSHEIRTPLNAIIGMTELLQDTPLSE----RQREFVQTIQTSSQSLLSII 896

Query: 600  NNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK----IEKKIPSELFFN 655
            N+IL+ SKIE  K+ +++ + DL+ ++     ++  +A+ K I     ++  IP  L   
Sbjct: 897  NDILDFSKIEAGKMVLEEVDFDLVSLVEGTSEMLAGAARGKGISLMTFVDPTIPRTLI-- 954

Query: 656  ADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-----VIITIADTGIGIPKSALE 710
             D   ++++L  +LSN++KFT   G++++R            ++  + DTGIGI  + L 
Sbjct: 955  GDPARLRQVLLNLLSNAVKFT-EQGEVLLRVLPHRAADSEVELLFEVRDTGIGIDSAHLG 1013

Query: 711  KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
            K+ QPF        +  GG GLGL IS  L  L GG +   SQ G G+
Sbjct: 1014 KLFQPFTQADASTTRRYGGTGLGLTISKTLVELMGGTIWAESQPGVGS 1061



 Score = 39.7 bits (91), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 27/185 (14%)

Query: 332 FHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECT 391
           + +RH  G+  +++   Q +R   G   + G+  D+T++ H E+   +  +R     E  
Sbjct: 405 YRLRHRDGSLRFVEEYGQCVRVTEGMPLLEGLLTDVTDRKHAEQAVQQVQRRYQDIFERI 464

Query: 392 SEALVLWDKNDRLVMCNANYQK--AYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPER 449
           SE +     + RL++ N    +   Y  P+ +L      S +QD   +  I  R +D +R
Sbjct: 465 SEGIFQTSLDGRLLLANPALARMLGYASPEELL------SEVQDVARQ--IYARPADRDR 516

Query: 450 ----------SQDMSKEIKLADSR--WLQI-NEWCTHD--GGTISVGT--DITLLKHNQA 492
                      +D   E    D    WL I + W   +  G  I  GT  DIT  K  + 
Sbjct: 517 YLRIMLEEGEVRDFELEAVRKDGEHIWLSISSRWLLDEARGMRIIEGTCQDITQRKRAEE 576

Query: 493 QLRES 497
            LRES
Sbjct: 577 ALRES 581


>gi|163794580|ref|ZP_02188551.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
 gi|159180304|gb|EDP64827.1| Signal transduction histidine kinase [alpha proteobacterium BAL199]
          Length = 860

 Score =  153 bits (387), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 126/219 (57%), Gaps = 1/219 (0%)

Query: 536 AETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHL 595
           AE AN+ KSEFLA +SHE RTPLNAI GFSE++    FG+LGS KY EYA +I  S QHL
Sbjct: 461 AERANQAKSEFLATISHEFRTPLNAISGFSEMLACRYFGDLGSPKYEEYAHNIWSSSQHL 520

Query: 596 LNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKI-PSELFF 654
           L ++N  L++S  E    ++  +  D+  I+++ +R +    +   I     + P     
Sbjct: 521 LQLVNATLDLSSAEAGNPALTIEPVDIAEIVDDCVRSLTVEFERGGITTSVSVQPDRPPL 580

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD   I++IL  +LSN++K T   G + +R        ++ ++DTG+G+P+  ++++  
Sbjct: 581 HADAGAIRQILLNLLSNAVKATPPGGSISVRVEANSDKHVLVVSDTGMGVPEHLVDRMTD 640

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
           PF  +      S  G GLGLAI  +L   H G L+I S+
Sbjct: 641 PFTVIGGNAYHSRDGKGLGLAIVKSLVQRHRGDLRIESR 679


>gi|265983704|ref|ZP_06096439.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. 83/13]
 gi|264662296|gb|EEZ32557.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. 83/13]
          Length = 532

 Score =  153 bits (387), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 225 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 279

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 280 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 339

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 340 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 399

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 400 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRADNSYTQAQEGSGLGLSVVKGLVELHQ 459

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 460 GSMQLKSRPGEGTVVMIRLP 479


>gi|21227050|ref|NP_632972.1| sensory transduction histidine kinase [Methanosarcina mazei Go1]
 gi|20905373|gb|AAM30644.1| Sensory transduction histidine kinases [Methanosarcina mazei Go1]
          Length = 397

 Score =  153 bits (387), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 179/321 (55%), Gaps = 14/321 (4%)

Query: 446 DPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATI 505
           DPE+ ++  KEI   + R L     CT     +S G+++  L   +  L + K   +  +
Sbjct: 66  DPEKLEENLKEINRDNERKLTY--LCTFPLEELS-GSELLRLVEEKGVLVKRKGGWECLM 122

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
           +  + + Q    ++ E ++  AK     + AE  N+ K+ F+  MSHELRTPLN+++GFS
Sbjct: 123 HTCNINGQ----KELETTLLRAK-----KDAEATNRAKNSFIMNMSHELRTPLNSVIGFS 173

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           +++ +  FG + + K  +Y  +I  SG++LL +INN+L++S++E  + ++  ++ D+  +
Sbjct: 174 DLLLEGAFGPM-NTKQSKYVNNILISGKNLLEIINNLLDISRLEAGEKTLKYEDVDVASL 232

Query: 626 INEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMI 684
           I E    + S A  K I +E KI PS     AD   +++IL+ ++SN+IKFT   GK++I
Sbjct: 233 IGEVRMNLLSPASVKKINVELKIDPSVGNVEADISKLRQILYNLVSNAIKFTPARGKVVI 292

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
              K    + + ++D GIGI + + EKI  PF    +   +  GG GLGL I     +LH
Sbjct: 293 SACKKEGVLEVKVSDNGIGISEDSYEKIFMPFTQADSSAARGYGGAGLGLFIVRNFVDLH 352

Query: 745 GGRLKIISQEGKGTIVTICMP 765
           GG + + S+ GKG+  T  +P
Sbjct: 353 GGDISVNSEVGKGSTFTFTIP 373


>gi|154252416|ref|YP_001413240.1| multi-sensor hybrid histidine kinase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156366|gb|ABS63583.1| multi-sensor hybrid histidine kinase [Parvibaculum lavamentivorans
           DS-1]
          Length = 846

 Score =  153 bits (387), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 114/411 (27%), Positives = 211/411 (51%), Gaps = 40/411 (9%)

Query: 381 DQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL---------PDHVLVPGNARSII 431
           +++L+     T   +++ D+  ++V  NA Y +  GL         P  +LV       +
Sbjct: 262 NEQLALVANGTDAGVLIADRTGQIVWANAGYLRMTGLEREDIEGRLPRDILVRHAGIGAL 321

Query: 432 QDAQTRPIIEYRTSDPE-RSQDMSKEIKLADSRWLQINEWCTHDG-GTIS----VGTDIT 485
           +      I+    +D E R+ +M    K     W  I      D  G+I     V  D++
Sbjct: 322 K------ILAESAADGEGRNVEMIGLTKQGTQYWASIEIRPVRDAKGSIRNYIVVENDVS 375

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
             K  + +L+ S+  L+  + DL  +   LE+++ +L+       + KE AE AN+ KS 
Sbjct: 376 RAKQTEIKLKRSQLELQDRVLDLQHTSLQLEQERAKLTRTAQDLSIAKEAAENANRAKSA 435

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTP+N +LG ++++   + G L + +  +    I  SG+ LL ++N+IL++
Sbjct: 436 FLATMSHELRTPMNGVLGMADLL---LSGPL-TQEQRDGVTTIRESGECLLTILNDILDL 491

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKK----IPSELFFNADKRII 661
           SK+E  ++ ++ +    + ++   + ++  +A+ K + + K     IP  +   +D   +
Sbjct: 492 SKLEAGRLELEPEPTSPMTVLETVVEVLRPNAKEKGLVLTKSEEGHIPQRIM--SDPTRL 549

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQC-------VIITIADTGIGIPKSALEKIGQ 714
           ++ILF ++ N+IKFT   G++ +  +    C       ++ T+ DTGIGIP++ L ++  
Sbjct: 550 RQILFNLVGNAIKFT-PQGEVSVSLAARA-CDDPDTAELVFTVRDTGIGIPEAMLPRLFT 607

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            F+   +   ++ GG GLGLAI+  LT L  G +++ S EGKG+  T+ +P
Sbjct: 608 RFQQADSSISRTYGGTGLGLAITRELTTLMNGTIEVESTEGKGSCFTVRLP 658


>gi|261218576|ref|ZP_05932857.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M13/05/1]
 gi|261221784|ref|ZP_05936065.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti B1/94]
 gi|261315201|ref|ZP_05954398.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M163/99/10]
 gi|261317242|ref|ZP_05956439.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis B2/94]
 gi|261320575|ref|ZP_05959772.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M644/93/1]
 gi|261751910|ref|ZP_05995619.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 5 str. 513]
 gi|261754568|ref|ZP_05998277.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 3 str. 686]
 gi|265988281|ref|ZP_06100838.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M292/94/1]
 gi|265997748|ref|ZP_06110305.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M490/95/1]
 gi|260920368|gb|EEX87021.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti B1/94]
 gi|260923665|gb|EEX90233.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M13/05/1]
 gi|261293265|gb|EEX96761.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M644/93/1]
 gi|261296465|gb|EEX99961.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis B2/94]
 gi|261304227|gb|EEY07724.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M163/99/10]
 gi|261741663|gb|EEY29589.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 5 str. 513]
 gi|261744321|gb|EEY32247.1| integral membrane sensor signal transduction histidine kinase
           [Brucella suis bv. 3 str. 686]
 gi|262552216|gb|EEZ08206.1| integral membrane sensor signal transduction histidine kinase
           [Brucella ceti M490/95/1]
 gi|264660478|gb|EEZ30739.1| integral membrane sensor signal transduction histidine kinase
           [Brucella pinnipedialis M292/94/1]
          Length = 532

 Score =  153 bits (387), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 225 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 279

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 280 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 339

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 340 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 399

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 400 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 459

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 460 GSMQLKSRPGEGTVVMIRLP 479


>gi|306842152|ref|ZP_07474821.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. BO2]
 gi|306287739|gb|EFM59170.1| integral membrane sensor signal transduction histidine kinase
           [Brucella sp. BO2]
          Length = 522

 Score =  153 bits (387), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 148/260 (56%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 215 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 269

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 270 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 329

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 330 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 389

Query: 690 ----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               G  +  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 390 MADGGPMLEFSVSDTGIGIDLEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 449

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 450 GSMQLKSRPGEGTVVMIRLP 469


>gi|289623553|ref|ZP_06456507.1| two-component sensor/regulator [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649156|ref|ZP_06480499.1| two-component sensor/regulator [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330867856|gb|EGH02565.1| two-component sensor/regulator [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 576

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 168/310 (54%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNVELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE +K  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALKDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           +IL++SK+E   ++++ +  DL  +++  + ++   A  + I+++ +  ++      D+R
Sbjct: 373 DILDLSKVEAGMMTLELEPVDLDELLSNSLLIVREQAALQRIQLKLETEADFGLLELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNG--KMMIRTSKIGQCVII---------------------- 695
             K+I++ +L+N++KF+   G   + +R     Q  +I                      
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLSVRQVSFAQAGVIEGGWPAHTFPLPSSDYEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|229590478|ref|YP_002872597.1| putative two-component system histidine kinase/response regulator
           fusion [Pseudomonas fluorescens SBW25]
 gi|229362344|emb|CAY49246.1| putative two-component system histidine kinase/response regulator
           fusion [Pseudomonas fluorescens SBW25]
          Length = 1184

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 162/285 (56%), Gaps = 9/285 (3%)

Query: 487 LKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
           L+  QA+L ++  +L      L+  R  ++R+  EL+ A  + +   E  + ++K KSEF
Sbjct: 457 LETQQAELEQTNEQLAEQTQTLAEQRDAMDRKNVELNQAQLELEDRAEELQRSSKYKSEF 516

Query: 547 LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
           LA MSHELRTPLN+ L  ++++ +     L S +  ++A+ I+ +G  LLN+IN+IL++S
Sbjct: 517 LANMSHELRTPLNSSLILAKLLAENPQENL-SAEQVKFAESIYSAGNDLLNLINDILDIS 575

Query: 607 KIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRII 661
           K+E  K+ +  +N+ +  +++ G+R     L         + +++  P+ LF   D++ +
Sbjct: 576 KVEAGKLEVRPENSSVARLVD-GLRGMFEPLAADRKLGFQVDVQEGSPTMLF--TDRQRL 632

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHN 721
           ++IL  +LSN+IKFT      +  +   G+ +  T+ D+GIGI     E I + F     
Sbjct: 633 EQILKNLLSNAIKFTEQGDVSLSVSRAPGEGIAFTVRDSGIGIAPDQQESIFEAFRQADG 692

Query: 722 QYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             ++  GG GLGL+IS  L  L GG + + S+ GKG+I T+ +P+
Sbjct: 693 TTNRRYGGTGLGLSISRDLAALLGGYISVASEPGKGSIFTLVLPE 737


>gi|291568899|dbj|BAI91171.1| two-component hybrid sensor and regulator [Arthrospira platensis
           NIES-39]
          Length = 953

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 148/264 (56%), Gaps = 18/264 (6%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I ER+  E+ +     ++++     A + K EFLA MSHELRTPLN ILG SE +K+ I 
Sbjct: 546 ISERKLMEIELQKTVAELDR-----ATRLKDEFLANMSHELRTPLNGILGMSEALKEGIL 600

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L S +++  A  I  SG+HLL +I++IL++SKIE  K+ +      +  +    + L+
Sbjct: 601 GALNSNQHHAIAM-IEKSGKHLLELISDILDISKIEAGKLELYLTEVRVQELCTSSLTLV 659

Query: 634 GSSAQSKNIKIEKKIPSEL---FFNADKRIIKKILFPILSNSIKFTNNNGKM----MIRT 686
              A +K I IE  IP  L       D R ++++L  +LSN++KFT+ +GK+     I+T
Sbjct: 660 NHLAFTKQINIEINIPQALEKTLIKVDNRRLRQVLINLLSNALKFTHKSGKINLNVGIKT 719

Query: 687 SK-----IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           S        Q +  ++ D GIGI    L K+  PF  + +  ++   G GLGLA+   + 
Sbjct: 720 SPNAAISTPQSIYFSVIDNGIGIAPDDLNKLFLPFTQIDSSLNRQYSGTGLGLALVKQII 779

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG +++ SQ GKG+  T+ +P
Sbjct: 780 ELHGGCVEVSSQLGKGSCFTVYLP 803


>gi|261324700|ref|ZP_05963897.1| integral membrane sensor signal transduction histidine kinase
           [Brucella neotomae 5K33]
 gi|261300680|gb|EEY04177.1| integral membrane sensor signal transduction histidine kinase
           [Brucella neotomae 5K33]
          Length = 532

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 149/260 (57%), Gaps = 10/260 (3%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R +   QK    IA  K ++E ER       K   LA +SHELRTPLN+I+GFS+++  
Sbjct: 225 GRSLEGEQKLLDEIAMLKAELESERI-----GKGRLLATVSHELRTPLNSIIGFSDMLTH 279

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           EI G+L S +  EYA  IH SG +LL ++N +L+ S++ET   SI  Q+      +    
Sbjct: 280 EIGGKLASDRQREYAGLIHQSGHYLLELVNAVLDNSRLETGTYSIAPQSFVFRDAVEMCT 339

Query: 631 RLIGSSAQSKNIKIEKKIPSELF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKI 689
            ++   A+ K +    ++ + +    AD+R +++IL  + +N++KFT + G + I  +++
Sbjct: 340 AVMLPQAEKKGVAFCHRVGNGVGELVADRRAVQQILLNLATNAVKFTQSGGCVTIDAARV 399

Query: 690 --GQCVII--TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
               C ++  +++DTGIGI    L++IG PF    N Y Q+  G GLGL++   L  LH 
Sbjct: 400 MADGCPMLEFSVSDTGIGIEPEDLQRIGTPFVRAGNSYTQAQEGSGLGLSVVKGLVELHQ 459

Query: 746 GRLKIISQEGKGTIVTICMP 765
           G +++ S+ G+GT+V I +P
Sbjct: 460 GSMQLKSRPGEGTVVMIRLP 479


>gi|289678178|ref|ZP_06499068.1| PAS [Pseudomonas syringae pv. syringae FF5]
          Length = 425

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 173/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 112 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 162

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE ++  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 163 HMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 221

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKR 659
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I+++ +  +E      D+R
Sbjct: 222 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLETEAEFGELELDRR 281

Query: 660 IIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCVII 695
             K+I++ +L+N++KF+   G +     ++  S+ G                   Q + +
Sbjct: 282 KTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPAYGFALPSGNCEQFLEL 341

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 342 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 401

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 402 LGARFVVWLP 411


>gi|119492436|ref|ZP_01623757.1| hybrid sensory kinase [Lyngbya sp. PCC 8106]
 gi|119453102|gb|EAW34271.1| hybrid sensory kinase [Lyngbya sp. PCC 8106]
          Length = 885

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 133/432 (30%), Positives = 229/432 (53%), Gaps = 46/432 (10%)

Query: 337 ASGADIWIQV-RAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSK-AIECTSEA 394
             G  IW+ + R  M+ T    + IIG+  D+TE+  ++++      RL++ +I+ + + 
Sbjct: 239 TDGRQIWLDISRVPMLDTDGYVIGIIGVLEDITEQKEIDEKL-----RLTQFSIDKSRDY 293

Query: 395 LVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMS 454
           ++  D N R    N    K  G      +    + I  +A          S+ + S    
Sbjct: 294 VLFTDINARFFYTNEAATKTLGYSRDEFLQMQVKDIDPNA----------SENQWSISWE 343

Query: 455 KEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQI 514
              +     +  I++  T  G  ISV   ++ L++N      +K    A + D+S     
Sbjct: 344 NLRQQGSFTFESIHKMKT--GEHISVEITLSYLEYN------NKEYGCAVVRDIS----- 390

Query: 515 LERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFG 574
            ER+ TE+ +  AK     E AE AN++KSEFLA+MSHELRTPLNAILGF++++ +++  
Sbjct: 391 -ERKHTEIVLQQAK-----EAAEAANRSKSEFLARMSHELRTPLNAILGFTQLMNRDLKR 444

Query: 575 ELGSV--KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRL 632
           +   +   + E+ + I  SG+HLLN+IN++LEMSKIE  +IS++  + DL+ +++    +
Sbjct: 445 KQSVLLQDHQEHLEIIGRSGEHLLNLINDVLEMSKIEAGQISLNSAHFDLLKLLHCLRDM 504

Query: 633 IGSSAQSKNIKIEKKIPSEL--FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIG 690
           +   AQSK +K+  +I S++  +   D+  ++++L  +L N+IKFT + G +++RT  + 
Sbjct: 505 LELKAQSKGLKLLFEIDSDVPQYIQTDESKLRQVLINLLGNAIKFT-DAGCIILRTKTVK 563

Query: 691 QC----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
                 +I  + DTG GI    L+ + +PF        +S  G GLGL+IS     L GG
Sbjct: 564 NSKANRLIFEVEDTGYGISPEELQYVFKPFIQTETGR-KSQQGTGLGLSISQKFIKLMGG 622

Query: 747 RLKIISQEGKGT 758
           ++ + SQ G+GT
Sbjct: 623 KITVSSQLGQGT 634


>gi|56750891|ref|YP_171592.1| two-component sensor kinase [Synechococcus elongatus PCC 6301]
 gi|81299455|ref|YP_399663.1| GAF sensor hybrid histidine kinase [Synechococcus elongatus PCC
           7942]
 gi|8953946|gb|AAF82192.1|AF258464_1 circadian input kinase [Synechococcus elongatus PCC 7942]
 gi|56685850|dbj|BAD79072.1| two-component sensor kinase [Synechococcus elongatus PCC 6301]
 gi|81168336|gb|ABB56676.1| GAF sensor hybrid histidine kinase [Synechococcus elongatus PCC
           7942]
          Length = 754

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 137/227 (60%), Gaps = 4/227 (1%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNI 602
           K EFLA MSHELRTPL  ++G S  + +  FG L + +  EY + IH SG+HLL +IN+I
Sbjct: 384 KGEFLATMSHELRTPLTCVIGMSSTLLRWAFGPL-TERQREYIKAIHDSGEHLLELINDI 442

Query: 603 LEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKI--EKKIPSEL-FFNADKR 659
           L++S+IE  K ++  +   L  +  + +  +   A+   I++  + ++ + +  F AD +
Sbjct: 443 LDLSQIEAGKAALQVRPFSLSRLATQTLNTLQEKARLGEIQLMLDLQLNNRVDVFRADPK 502

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            +++IL  +LSN++KFT   G + +R  + G   I  ++DTGIGIP+S   ++ Q F+ L
Sbjct: 503 RLRQILINLLSNAVKFTEPQGTVFLRVWREGDRAIFQVSDTGIGIPESEQAQLFQKFQQL 562

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
                +  GG GLGLA++  L  LHGG ++I S  G+G+  T+ +P+
Sbjct: 563 DTSIRRQYGGTGLGLALTKQLVELHGGHIQIESTVGQGSTFTVWIPE 609


>gi|254443566|ref|ZP_05057042.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
 gi|198257874|gb|EDY82182.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
          Length = 730

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/319 (32%), Positives = 172/319 (53%), Gaps = 11/319 (3%)

Query: 450 SQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLS 509
           S+ +S+   +AD    Q++         + +  D+T   H       S+ RL A  N+L 
Sbjct: 278 SKGLSRSNFIADISKTQLHGINGQQSAIVGIIQDVTNRIH-------SENRLIAAFNELE 330

Query: 510 TSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIK 569
           TS++ LE+   E+     K +     A+++NK KS FL+ +SHELRTPLN+I+  ++ + 
Sbjct: 331 TSKEKLEQSNLEIRKGIEKAKKLAVVAQSSNKAKSYFLSNISHELRTPLNSIVSLTQALL 390

Query: 570 KEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEG 629
           +  FG+L + K +E  + +  S +HL ++IN+IL++SKIE  K+++    A +  I    
Sbjct: 391 EGTFGDLNA-KQHENLEIVSESSKHLQSLINDILDLSKIELGKMTLKFAQAGIGDIARSS 449

Query: 630 IRLIGSSAQSKNIKIEKKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGK--MMIRT 686
           IR+I   A  KN++   +I +EL     D + +++IL  +L N++KFT +N    + I  
Sbjct: 450 IRMIEQEASLKNVRCILEINTELENIEVDAKRLRQILLNLLVNAVKFTKSNTDVTLQIEE 509

Query: 687 SKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGG 746
           +   + V+  + D GIGI ++   KI  PF  L +   +   G GLGLAI+     LHGG
Sbjct: 510 NSENESVVFNVIDHGIGIDQNDFSKIFSPFTQLDDSLSRHYEGTGLGLAIASKFVELHGG 569

Query: 747 RLKIISQEGKGTIVTICMP 765
            L++ S    G+  TI +P
Sbjct: 570 GLRVASTPDLGSTFTISLP 588


>gi|332706978|ref|ZP_08427038.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
 gi|332354243|gb|EGJ33723.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
          Length = 779

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 134/231 (58%), Gaps = 8/231 (3%)

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE-----LGSVKYYEYAQDIHYSGQHLLN 597
           KSEFLA MSHELRTPL  ++G +  + +  FG+     L   K   Y + I  +GQHLL 
Sbjct: 401 KSEFLATMSHELRTPLTCVIGMAATLLRWCFGQDSSQRLPVEKQQRYLKTIQENGQHLLE 460

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSA--QSKNIKIEKKIPSEL-FF 654
           +IN+IL++S++E  K+ +      L  + N+ +  +   A  Q   ++++ ++P E   F
Sbjct: 461 LINDILDLSQVEAGKLVLTISKFSLSKLANQLLSSLNEQAYQQQVTLQLDWRVPPERDCF 520

Query: 655 NADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQ 714
           +AD+R +K+ILF +LSN IKFT   GK+++R       V+  + DTGIGI +  L  + Q
Sbjct: 521 SADQRRVKQILFNLLSNGIKFTPEGGKVILRVWPENHLVVFQVEDTGIGIAQDQLPLLFQ 580

Query: 715 PFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            F+ L   Y +   G GLGLA++  L  LH G++++ S   +G+  T+ +P
Sbjct: 581 KFQQLETPYRRKYEGTGLGLALTKQLIELHRGKIEVESVVAEGSCFTVWLP 631


>gi|209966568|ref|YP_002299483.1| histidine protein kinase DivJ [Rhodospirillum centenum SW]
 gi|209960034|gb|ACJ00671.1| histidine protein kinase DivJ [Rhodospirillum centenum SW]
          Length = 478

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 138/235 (58%), Gaps = 1/235 (0%)

Query: 532 EKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYS 591
           ++ RA  ++++K+EFLA +SHE RTPLNAI+G SE+ +          +  EY   IH S
Sbjct: 228 QRLRALESSRSKTEFLAMVSHEFRTPLNAIIGLSELGRTLPPSGAEGGRTREYFSLIHES 287

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
           G  LL+++N++L +SK+E  K+ +  +  DL  ++   +RL+   A ++   +   +P  
Sbjct: 288 GNTLLDLVNDLLNLSKVEVAKLHVTPEEVDLGAVMAAALRLVRQRADARGQILRVDLPGP 347

Query: 652 L-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
                AD R +  +L  +L+N++KFT + G + +    +     +T+ADTG GIP   L 
Sbjct: 348 PPACRADARALHHMLVNLLTNALKFTPDGGSVTLSALAVPGGASVTVADTGPGIPADQLP 407

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
           ++ QPFE L N Y +S  G GLGLA+ DAL  LHGG L + S+ G+GT  TI +P
Sbjct: 408 RLLQPFERLDNSYARSGEGTGLGLALVDALARLHGGHLTLDSRPGQGTTATIFLP 462


>gi|182678851|ref|YP_001832997.1| response regulator receiver sensor signal transduction histidine
           kinase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634734|gb|ACB95508.1| response regulator receiver sensor signal transduction histidine
           kinase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 389

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 138/242 (57%), Gaps = 10/242 (4%)

Query: 530 QVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIH 589
           ++ KE AE AN+ KS FLA +SHELRTPLNAI+GFS +I  E+ G L + +Y EY +DI+
Sbjct: 139 RLAKEGAEAANQAKSNFLATISHELRTPLNAIIGFSNLILMELMGPLSNERYREYLRDIN 198

Query: 590 YSGQHLLNMINNILEMSKIETEKI----SIDKQNADLIPIINEGIRLIGSSAQSKNIKIE 645
            SG+HLL++IN+IL+++K E  +     S+      +IP+     RL+   A+   + + 
Sbjct: 199 ASGEHLLSIINDILDLTKAEAGQTELFESVIHPRDAIIPV----ERLLMPKAREAGLTLT 254

Query: 646 KKIPSEL-FFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC-VIITIADTGIG 703
             I   L    AD+R  K+I   +LSN++KFT   G + I      +  + I +ADTGIG
Sbjct: 255 SNITEHLPLLRADERKAKQIFLNLLSNAVKFTPPGGSIEIDAHLTHKGDLAIAVADTGIG 314

Query: 704 IPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTIC 763
           I    ++++ +PF  + +   +   G GLGL +  +   LH G L + S+ G GT   + 
Sbjct: 315 IAPEHIDRVCEPFVQIDSSLSRRHDGTGLGLPLVKSFMELHEGSLHLRSKSGIGTCAIVT 374

Query: 764 MP 765
            P
Sbjct: 375 FP 376


>gi|167033148|ref|YP_001668379.1| multi-sensor hybrid histidine kinase [Pseudomonas putida GB-1]
 gi|166859636|gb|ABY98043.1| multi-sensor hybrid histidine kinase [Pseudomonas putida GB-1]
          Length = 1149

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 167/287 (58%), Gaps = 11/287 (3%)

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
           +LK +QA L   +  L+ T   LS   + L+R+  EL  A  + Q   +  + ++K KSE
Sbjct: 424 VLKESQAHLETQQAELEQTNEQLSERTEALDRKNDELVQAQEELQARADELQRSSKYKSE 483

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FLA MSHELRTPLN+ L  ++++ +   G L S +  ++A+ I+ +G  LLN+IN+IL++
Sbjct: 484 FLANMSHELRTPLNSSLILAKLLAENAEGNL-SDEQVKFAESIYSAGNDLLNLINDILDI 542

Query: 606 SKIETEKISIDKQNADLIPIINEGIR-----LIGSSAQSKNIKIEKKIPSELFFNADKRI 660
           +K+E  K+ +  ++  +  ++ EG+R     L G    +  +  E ++P+ LF   D++ 
Sbjct: 543 AKVEAGKLEVRPESTQVERLV-EGLRGMFEPLAGHKGLAFEVTAEAQVPATLF--TDRQR 599

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTS-KIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
           +++IL  +LSN+IKFT   GK+ +    + G  ++  + DTGIGI     + I   F  +
Sbjct: 600 LEQILKNLLSNAIKFTER-GKVSLNIGYQPGTGIVFAVRDTGIGIAADQQQAIFGAFHQV 658

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
               ++  GG GLGL+IS  L +L GG++ + S  G+G++ ++ +P+
Sbjct: 659 DGTSNRRYGGTGLGLSISRDLAHLLGGQINVDSSPGQGSVFSLILPE 705


>gi|209966483|ref|YP_002299398.1| bacteriophytochrome Ppr (contains PYP domain) [Rhodospirillum
           centenum SW]
 gi|209959949|gb|ACJ00586.1| bacteriophytochrome Ppr (contains PYP domain) [Rhodospirillum
           centenum SW]
          Length = 883

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 135/227 (59%), Gaps = 5/227 (2%)

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            +N+ KS FLA MSHELRTPLNAI+GFS+++   + G L   +  +Y Q IH SG+HLL 
Sbjct: 656 ASNEAKSRFLANMSHELRTPLNAIIGFSDLMMSGMAGTL-PPRIQDYVQSIHASGEHLLR 714

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNAD 657
           M+N++L++S+IE  ++ +  ++ D   +  E + ++   A    + +E +  S L   AD
Sbjct: 715 MVNDVLDLSRIEAGRMELSPESLDAGILAAECVGMLLPRAVRGEVLLEVQAESPLPLTAD 774

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKI-GQCVIITIADTGIGI-PKSALEKIGQP 715
              +++IL  I+ N++KFT   G++ +R   + G   + T+ DTG G+ P+  L  + +P
Sbjct: 775 ALRLRQILLNIIGNAVKFTPPGGRVDVRARALAGGGAVFTVRDTGPGMTPEEVLTAM-EP 833

Query: 716 FEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTI 762
           F  +  Q   ++ G GLGL I+ +L +LH G L I +  G GT VTI
Sbjct: 834 FRQV-AQTRAAVEGTGLGLPIAKSLVDLHAGNLAIETAPGLGTTVTI 879


>gi|66044351|ref|YP_234192.1| PAS [Pseudomonas syringae pv. syringae B728a]
 gi|63255058|gb|AAY36154.1| PAS [Pseudomonas syringae pv. syringae B728a]
          Length = 576

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 173/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE ++  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKR 659
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I+++ +  +E      D+R
Sbjct: 373 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLETEAEFGELELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCVII 695
             K+I++ +L+N++KF+   G +     ++  S+ G                   Q + +
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPTYGFALASGDCEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|330969226|gb|EGH69292.1| PAS protein [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 576

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 173/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE ++  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKR 659
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I+++ +  +E      D+R
Sbjct: 373 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLETEAEFGELELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCVII 695
             K+I++ +L+N++KF+   G +     ++  S+ G                   Q + +
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPTYGFALPSGDCEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|330967781|gb|EGH68041.1| sensory box histidine kinase/response regulator [Pseudomonas
           syringae pv. actinidiae str. M302091]
          Length = 775

 Score =  153 bits (386), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 151/258 (58%), Gaps = 16/258 (6%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
           +R I +R+  E+++  A+     E AE A++ KSEFL++MSHELRTPLN+ILGF++++  
Sbjct: 378 TRDISDRRVAEIALGTAR-----EEAERASRAKSEFLSRMSHELRTPLNSILGFAQLLDM 432

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           +                I  +GQHLL +IN +L++++IE   +S+  +   L  ++ E +
Sbjct: 433 D-----SPASQRPQVGHILRAGQHLLKLINEVLDIARIEAGHVSLSLEPVSLSSVLKETL 487

Query: 631 RLIGSSAQSKNIKIEK--KIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSK 688
            L+   A   NI++E+   +P EL   AD++ + ++L  +LSN+IK+   +G++ I   +
Sbjct: 488 VLVSPMAADGNIELEELPHLPDELGVIADRQRLVQVLLNLLSNAIKYNRPDGQVRIEVDR 547

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHN-QYDQSIGGFGLGLAISDALTNLHGGR 747
             + V +++ DTG GI   A E++GQ F+P      + S+ G GLGLA+S ++  +  G 
Sbjct: 548 SAERVTVSVVDTGYGI---APERLGQLFKPFERLDANPSVEGTGLGLALSKSMLEMMNGT 604

Query: 748 LKIISQEGKGTIVTICMP 765
           L + + + +G   T+ +P
Sbjct: 605 LSVQTTQNEGCRFTLALP 622


>gi|330975736|gb|EGH75802.1| PAS protein [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 576

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 173/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE ++  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKR 659
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I+++ +  +E      D+R
Sbjct: 373 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLETEAEFGELELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCVII 695
             K+I++ +L+N++KF+   G +     ++  S+ G                   Q + +
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPAYGFALPSGNCEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|330938948|gb|EGH42439.1| PAS protein [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 576

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/310 (30%), Positives = 173/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE ++  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALRDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELF-FNADKR 659
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I+++ +  +E      D+R
Sbjct: 373 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQLKLETEAEFGELELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCVII 695
             K+I++ +L+N++KF+   G +     ++  S+ G                   Q + +
Sbjct: 433 KTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPTYGFALPSGNCEQFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            G    + +P
Sbjct: 553 LGARFVVWLP 562


>gi|167625908|ref|YP_001676202.1| histidine kinase [Shewanella halifaxensis HAW-EB4]
 gi|167355930|gb|ABZ78543.1| histidine kinase [Shewanella halifaxensis HAW-EB4]
          Length = 885

 Score =  152 bits (385), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/252 (36%), Positives = 147/252 (58%), Gaps = 14/252 (5%)

Query: 516 ERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGE 575
           ER +  L I  AK + EK     AN+ KS FLA MSHE+RTPLN I+G S+++     G 
Sbjct: 361 ERHQNVLKILQAKQEAEK-----ANQAKSSFLANMSHEIRTPLNGIIGMSDIMA----GT 411

Query: 576 LGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGS 635
             +    EY Q I  S Q LL +IN+IL++SKIE+  +SI   +AD+  ++ + + ++ +
Sbjct: 412 KLTATQNEYLQTIETSSQTLLILINDILDLSKIESGNLSITNTDADITEVVYDTLTIVLA 471

Query: 636 SAQSKNIKIEKKIPSE--LFFNADKRIIKKILFPILSNSIKFTNNNG-KMMIRTSKIGQ- 691
               KN+ +E +I ++     + D+  ++++L  +LSN++KFT+  G K++I  S     
Sbjct: 472 KIAEKNLTLEVEIDNDTPYLISLDEHRMRQVLVNLLSNAVKFTHEGGVKVVISCSNTADY 531

Query: 692 C-VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
           C ++I+I D+GIGI K   + I  PF    +   +  GG GLGLAI   L  L GG + +
Sbjct: 532 CDLLISIHDSGIGIAKEKQQHIFSPFTQEDDTTTREFGGTGLGLAICKQLITLMGGEISL 591

Query: 751 ISQEGKGTIVTI 762
           IS++G+G   +I
Sbjct: 592 ISEKGEGCCFSI 603


>gi|307300057|ref|ZP_07579842.1| integral membrane sensor hybrid histidine kinase [Sinorhizobium
           meliloti BL225C]
 gi|306904946|gb|EFN35529.1| integral membrane sensor hybrid histidine kinase [Sinorhizobium
           meliloti BL225C]
          Length = 917

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 205/419 (48%), Gaps = 65/419 (15%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH---VLVPG 425
           EK  LE       + ++ A+E  S+  VL+D  DR+++ N+ Y + +  P H    L   
Sbjct: 271 EKKKLEDEAERQRRTIAAALEVISDGFVLYDSEDRILVANSKYCEIF--PSHKPNTLRGR 328

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQD-----------MSKEIKLADSRWLQINEWCTHD 474
           + R I++       ++     P+   D           +  E +  D +W++I++    D
Sbjct: 329 SFREIVEQNLEMGQVDLEGKSPQEWVDERVRLHRDPAGLVDEKRFGD-KWVRISKRKIPD 387

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GGT++V TDIT LK  Q +L                     ER K+              
Sbjct: 388 GGTVAVYTDITELKQRQVEL---------------------ERAKSH------------- 413

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD---IHYS 591
            AE+AN+ KS FLA MSHELRTPLNAI+G+SE++ +E        +  E   D   I  +
Sbjct: 414 -AESANEAKSRFLASMSHELRTPLNAIIGYSEMLIEEARDH----EDEELVPDLDKIASA 468

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
           G+HLL++IN+IL++SKIE  K+ +  +   +  ++ +    +         +  +   ++
Sbjct: 469 GRHLLSLINDILDLSKIEANKMEVFLETFSVADLLRDVAATVAPLMARNGNEFTQDFETD 528

Query: 652 LF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPK 706
           L   ++D+  +++ LF +LSN+ KFT N G++ +R  +  +     ++  + DTGIG+  
Sbjct: 529 LGEMHSDQTKLRQNLFNLLSNAAKFT-NGGRVTLRVRREQRADRDWLVFQVTDTGIGMSP 587

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              E++   F        ++ GG GLGL+I+ +   + GG + + S+ GKG++ T+ +P
Sbjct: 588 EQQERLFNAFTQADASTTRNYGGTGLGLSITRSFCRMIGGVVTVESEVGKGSVFTMEVP 646


>gi|294494798|ref|YP_003541291.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
 gi|292665797|gb|ADE35646.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanohalophilus mahii DSM 5219]
          Length = 599

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 147/264 (55%), Gaps = 21/264 (7%)

Query: 509 STSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVI 568
            T   I +R+  E +I  +K       AE AN+TKSEFLA MSHELRTPLN+I+G+S+++
Sbjct: 342 GTHIDITDRKMAENAIIQSKV-----LAEQANRTKSEFLANMSHELRTPLNSIIGYSQIL 396

Query: 569 KKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINE 628
            +   G L   K  +Y+ +I  SG+HLL +IN+IL++SK+E  K+  + +  +L   I++
Sbjct: 397 NQNPSGNLDE-KELKYSHNILNSGEHLLELINSILDISKVEAGKMEYEPERVNLPETIDD 455

Query: 629 GIRLIGSSAQSKNIKIEKKIPSELFFN--------ADKRIIKKILFPILSNSIKFTNNNG 680
            I L+   A  K+I I        F N         D+   K+IL  +LSN+IKFT   G
Sbjct: 456 IIGLVKPLAMKKSIDIR-------FINNSAIAKVWVDRVKFKQILHNLLSNAIKFTPEKG 508

Query: 681 KMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
           ++ I  S       I++ADTGIGIP   +E I  PF+ +++   +   G GLGLA+    
Sbjct: 509 EVKIYLSTDDGTAQISVADTGIGIPAEKIEDIFDPFKQVNSSSSREYEGTGLGLALVKKY 568

Query: 741 TNLHGGRLKIISQEGKGTIVTICM 764
             +H G + + S+ G G+  T  +
Sbjct: 569 VEMHDGEIWVESEVGAGSTFTFTL 592



 Score = 37.7 bits (86), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 64/152 (42%), Gaps = 6/152 (3%)

Query: 225 ISALLLFILFSYYRQAK---KNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLS 281
           ISAL    +  Y    +   K K+ +  + ++   +E AL   R G+W+++    K +  
Sbjct: 199 ISALCTDCIDGYLVHVQDITKRKQAEEKVRQSEERLELALKGTRAGIWDWDVQTGKTYFD 258

Query: 282 RSMYEIMGIPYENKTLSFRAIARLIH-YDNKKICEIARSVTGKHVKQLDQIFHMRHASGA 340
               EI+G   +      +    L H  D K+  E+         +  +    M+H +G 
Sbjct: 259 ERWAEIVGYNPDELKPDIQTWIDLTHPKDYKRAEELLNKHFAGETENYECQLRMKHKNGH 318

Query: 341 DIWIQVRAQMMRTISGG--MNIIGIAMDLTEK 370
            +WI+ R +++     G    + G  +D+T++
Sbjct: 319 WVWIEDRGRVVEWSRDGKPKRMTGTHIDITDR 350


>gi|163794214|ref|ZP_02188186.1| hypothetical protein BAL199_21144 [alpha proteobacterium BAL199]
 gi|159180382|gb|EDP64903.1| hypothetical protein BAL199_21144 [alpha proteobacterium BAL199]
          Length = 517

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 154/280 (55%), Gaps = 21/280 (7%)

Query: 507 DLSTSRQILERQKTELSIANAKYQVE-----------KERAETANKTKSEFLAKMSHELR 555
           DL+ + + L R + +LS  N   +             K RAE AN +K++FL  MSHELR
Sbjct: 221 DLTAANERLTRSEADLSALNRDLEARVLDRTRDLERAKLRAELANTSKTQFLRSMSHELR 280

Query: 556 TPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISI 615
           TPLNAI+GF+++++  I G +   +Y E+  DIH SG+HLL +I+++L++++IE  + ++
Sbjct: 281 TPLNAIIGFADLMRTGILGPMEHPRYLEFTHDIHDSGRHLLKIIDDLLDIARIEVGQETL 340

Query: 616 DKQNADLIPIINEGIRLIGSSAQSKNIK--IEKKIPSELFFNADKRIIKKILFPILSNSI 673
            ++  DL  ++++  R +G  A  + +   I+   P  L    D+  IK++L  +LSN+I
Sbjct: 341 REEAVDLDALVSDCHRTVGPMAIERGLSLHIDATAPG-LVLRIDRTKIKQVLLNLLSNAI 399

Query: 674 KFTNNNGKM---MIRTSKIGQC----VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQS 726
           K T   G++   + R+   G      V + + DTG G+    +      F  L +     
Sbjct: 400 KNTPRGGRVSSAVERSPTDGAGSTGDVELRVTDTGRGMTAEQIPMALTAFTRLDDDPMLP 459

Query: 727 IGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
             G GLGL +S  +  LHGG L + S+ G+GT VT+ +PQ
Sbjct: 460 QKGTGLGLPLSRMMVELHGGALTLESEIGRGTQVTVRLPQ 499


>gi|294054185|ref|YP_003547843.1| histidine kinase [Coraliomargarita akajimensis DSM 45221]
 gi|293613518|gb|ADE53673.1| histidine kinase [Coraliomargarita akajimensis DSM 45221]
          Length = 1191

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 166/289 (57%), Gaps = 29/289 (10%)

Query: 490  NQAQLRESK---RRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEF 546
            N  +LR S+   +RL+  +   +   Q L+RQ  EL IA       KE AE+AN+ KSEF
Sbjct: 788  NYLRLRASRLHHQRLEELVGQRT---QELQRQSEELVIA-------KEHAESANRIKSEF 837

Query: 547  LAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMS 606
             A +SHE+RTP+N+I+GF+++++ E      +  +  Y   +  SG  LL+MI+++L+MS
Sbjct: 838  TANISHEIRTPMNSIMGFADILRDETV----NPTHQHYLDAVLKSGDTLLHMIDDLLDMS 893

Query: 607  KIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADKRIIK 662
            K+E +K+S+  +  +L     + +R+       K + +E      IPS L  +A +   +
Sbjct: 894  KLEADKLSLHPRPTNLSSETRDTLRMFQPKLSEKALDLEFLSDPNIPSSLLIDATR--YR 951

Query: 663  KILFPILSNSIKFTNNNGKMMIRTSKIGQCVI-----ITIADTGIGIPKSALEKIGQPFE 717
            ++L  I+ N+IKFT ++GK+ IR   + Q  +       I+DTG GIP++ L++I   FE
Sbjct: 952  QVLLNIVGNAIKFT-DSGKISIRLELVRQYALHAHVRCAISDTGEGIPENQLQRIFNAFE 1010

Query: 718  PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
                 + +S  G GLGLAIS  L  +  G+++++S+ G+G+  T+  P+
Sbjct: 1011 QASRDFTRSEMGSGLGLAISKRLVEMMDGQIRVVSRVGRGSTFTVDFPK 1059


>gi|58584388|ref|YP_197961.1| membrane associated signal transduction histidine kinase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|58418704|gb|AAW70719.1| Membrane associated signal transduction histidine kinase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 475

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/258 (35%), Positives = 149/258 (57%), Gaps = 10/258 (3%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
            S ++ ++++ KT     N + Q  KE  E  N  K +F A ++HELRTPLNAI+GF+E+
Sbjct: 210 FSNTQMLVKQHKT-----NIELQQMKEALEQENTNKLKFFASVTHELRTPLNAIIGFAEL 264

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           IK E  G + + +Y EY  DI+ +G HLL +IN++L+ SK E+  ++++K   +L  II+
Sbjct: 265 IKNETLGSMDNYQYKEYVDDIYNAGTHLLALINDVLDFSKAESSSLTVEKVKFNLNKIID 324

Query: 628 EGIRLIGSSAQSKNIKIEKKIPS-ELFFNADKRIIKKILFPILSNSIKFTNNNG--KMMI 684
             + ++    +   I +EK+IP+ +L   AD + +K+++  +LSNSIKFT  +G  +M+I
Sbjct: 325 SCLNMLSPKLKETGISLEKEIPNRQLLVIADPKRMKQVIINLLSNSIKFTPKDGLIRMVI 384

Query: 685 RTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLH 744
           + +     + I   D GIGI +  + K+   F    + Y     G G+GL +S  L  L 
Sbjct: 385 KENIEKNLLTIEFHDNGIGIMQQDIYKVMSVFGQADSGYRNE--GTGIGLPLSKKLVELM 442

Query: 745 GGRLKIISQEGKGTIVTI 762
           GG   I S+   GT +T+
Sbjct: 443 GGTFNIKSEAKLGTTITL 460


>gi|268316575|ref|YP_003290294.1| multi-sensor signal transduction histidine kinase [Rhodothermus
            marinus DSM 4252]
 gi|262334109|gb|ACY47906.1| multi-sensor signal transduction histidine kinase [Rhodothermus
            marinus DSM 4252]
          Length = 1029

 Score =  152 bits (385), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 138/246 (56%), Gaps = 2/246 (0%)

Query: 520  TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
            TEL  A  + +  KERAE A++ KS FLA MSHE+RTPL  ILGF+E++ +E+       
Sbjct: 777  TELVEAERQLKAAKERAEEASRLKSAFLANMSHEIRTPLTGILGFAELLDEELETRQQE- 835

Query: 580  KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
               E+   I  S + LL ++N+IL++SKIE  ++ +  Q  D++ +  + ++L+   A+ 
Sbjct: 836  DLREFTHIIDRSARRLLTLLNDILDLSKIEANRLELKLQPTDVVDVARQAVQLMQPLAEE 895

Query: 640  KNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIAD 699
            K +K+E      L   AD   + ++L  +LSN+IKFT + G + +   +    V++ + D
Sbjct: 896  KGLKLELHAEENLTARADPNRLHQVLVNLLSNAIKFT-DEGHVRVELGQKKGWVLLAVED 954

Query: 700  TGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI 759
            TG GI    L  + +PF   H    Q   G GLGLAI   L +L  G++ + S+ G+GT 
Sbjct: 955  TGCGISPEFLPHLFEPFRQEHEGLTQKHQGVGLGLAIVKRLIDLMSGQITVQSEVGRGTR 1014

Query: 760  VTICMP 765
              I +P
Sbjct: 1015 FEILLP 1020


>gi|256828233|ref|YP_003156961.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577409|gb|ACU88545.1| multi-sensor hybrid histidine kinase [Desulfomicrobium baculatum
           DSM 4028]
          Length = 1260

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 90/267 (33%), Positives = 152/267 (56%), Gaps = 17/267 (6%)

Query: 505 INDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGF 564
           I+D   + ++L +   +L +A       K++A+ A ++KSEFLA+MSHE+RTP+NAILG 
Sbjct: 361 ISDRKKASELLRQHAEDLRVA-------KDQADKATRSKSEFLARMSHEIRTPMNAILGM 413

Query: 565 SEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIP 624
           +E++++    E       EY +    +G+ LL +IN+IL+ SKIE  +I ++    +L  
Sbjct: 414 AEMLQETSLNE----DQQEYVKTFSSAGELLLGIINDILDFSKIEVGQIKLESIPFNLRE 469

Query: 625 IINEGIRLIGSSAQSKNIKIEKKIPSELF--FNADKRIIKKILFPILSNSIKFTNNNGKM 682
           ++++  +L    A+ K +++EKK+   L   +  D   I++I+  ++ N++KFT+  G  
Sbjct: 470 LVDDVNKLFVYRAEEKALRLEKKVSEGLAQRYIGDPTRIRQIIINLVGNALKFTSVGGVT 529

Query: 683 MIRTSKI----GQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
           M  T  +      C +  + DTGIGIPKS L  + + F    +   +  GG GLGLAIS 
Sbjct: 530 MSVTESVMDDGAPCCLFAVKDTGIGIPKSKLGTVFESFAQADSSTTREFGGTGLGLAISK 589

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
            L  L GG++ + S+ G+GT     +P
Sbjct: 590 KLVELMGGQIWVESEPGQGTTFFFKLP 616


>gi|224370417|ref|YP_002604581.1| multidomain fusion protein (N:DNA-binding domain/C:signal
           transduction histidine kinase) [Desulfobacterium
           autotrophicum HRM2]
 gi|223693134|gb|ACN16417.1| multidomain fusion protein (N:DNA-binding domain/C:signal
           transduction histidine kinase) [Desulfobacterium
           autotrophicum HRM2]
          Length = 772

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 131/428 (30%), Positives = 208/428 (48%), Gaps = 59/428 (13%)

Query: 368 TEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNA 427
           T  + +  R  E  ++L +A+E +  ++V+ D    +   N  + +  G     ++  N 
Sbjct: 218 TPPFFMNGRPEEEIRKLLRAVEESPSSVVITDAFGAIEYVNTKFCEVTGYTVSEVLGQNP 277

Query: 428 RSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTH--DGGTISVGTDIT 485
           R +  D Q++    YR    E  + +S+        W    E+C    DG        I+
Sbjct: 278 RVLNSDIQSKAF--YR----EMWETLSQ-----GQEWR--GEFCNKKKDGTLYWEHASIS 324

Query: 486 LLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSE 545
            L       R +     A   D++ +++IL+    EL  A       +E AE +N  KS+
Sbjct: 325 PL----CDARGNITHYVAVKEDVTETKRILQ----ELEKA-------REAAEVSNIAKSD 369

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEM 605
           FL  MSHELRTPLNAI+GFSEV++   FG L + K  EY  DI  +GQHLL++IN+IL++
Sbjct: 370 FLTSMSHELRTPLNAIIGFSEVLQDRFFGPL-TDKQSEYLDDILGAGQHLLSLINDILDL 428

Query: 606 SKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE---KKIPSELFFNADKRIIK 662
           SK+E  K+ ++ ++  +   I  G+ ++        I ++   K+   +L   AD+R +K
Sbjct: 429 SKVEAGKMMLEIKSVKVSDAIETGLVMLKEKIACHGITVKTDFKETCHKLTLAADERKLK 488

Query: 663 KILFPILSNSIKFTNNNGKMMIR----------------------TSKIGQ--CVIITIA 698
           +I+F ILSN++KFT + G + I                       T ++G+   +II+IA
Sbjct: 489 QIIFNILSNAVKFTPDGGTITIEMMVLDPDPIPGTDILPDWMQKATGQVGKQPHLIISIA 548

Query: 699 DTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ-EGKG 757
           DTGIGI    L  I + F         S  G GLGL +S  +  LHGG +   S+   KG
Sbjct: 549 DTGIGISSEDLPHIFEEFYQTLAGIRASTPGTGLGLPLSKRMAELHGGTIMAHSEGPDKG 608

Query: 758 TIVTICMP 765
           +  T+ MP
Sbjct: 609 SRFTLLMP 616


>gi|302188804|ref|ZP_07265477.1| PAS [Pseudomonas syringae pv. syringae 642]
          Length = 576

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 173/312 (55%), Gaps = 39/312 (12%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE +K  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALKDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA---D 657
           +IL++SK+E   ++++ ++ DL  +++  + ++   A  ++I++  K+ +E  F     D
Sbjct: 373 DILDLSKVEAGMMTLELESVDLDELLSNSLLIVREQAALQHIQL--KLETEADFGVLELD 430

Query: 658 KRIIKKILFPILSNSIKFTNNNGKM-----MIRTSKIG-------------------QCV 693
           +R  K+I++ +L+N++KF+   G +     ++  S+ G                   Q +
Sbjct: 431 RRKTKQIVYNLLANAVKFSEPGGWVTLAVRLVPASQAGLIDGDWPTYGFALPSGDCEQFL 490

Query: 694 IITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            ++++DTGIGI +S + K+ + F  + +   +   G GLGLA+   L  LHGG + + S 
Sbjct: 491 ELSVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLAELHGGCVAVASV 550

Query: 754 EGKGTIVTICMP 765
           +  G    + +P
Sbjct: 551 KDLGARFVVWLP 562


>gi|149174262|ref|ZP_01852889.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
 gi|148846807|gb|EDL61143.1| probable sensor/response regulator hybrid [Planctomyces maris DSM
            8797]
          Length = 2453

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 130/519 (25%), Positives = 244/519 (47%), Gaps = 48/519 (9%)

Query: 260  ALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARS 319
            A+      LW ++ D  K + S   +E+  +         +    L+H ++++  E +  
Sbjct: 1809 AMQAANLSLWQWDIDKDKIYWSHDSHELSSMEPRQAVGGLQHFLNLVHRNDREAVEHSLR 1868

Query: 320  VTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI-IGIAMDLTEKYHLEKRYA 378
                + K     F  R +     W+   A +    +    + +G+ +D+TE+   E    
Sbjct: 1869 SCLSNGKPFQAEFRTRKSENTYAWVLSTAYLTTDSTDNSTVMVGVNLDITERKKSELEIK 1928

Query: 379  EADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHV---LVPGNARSIIQD-- 433
             +++RL  A E     ++  D  +     +   ++  GLPD+    L  G     I    
Sbjct: 1929 LSEERLRNAAESAGFGMLHIDLLEETTAFSPEMKRMLGLPDNAENNLKFGEVPDWIHPKD 1988

Query: 434  -AQTRPIIEYRTSDPE-RSQDMSKEIKLAD--SRWLQINEWCTHDGGTISVGTDITLLKH 489
             +  R  ++   + PE ++Q +   I   D  +RW++++      G     G+       
Sbjct: 1989 RSAYRKHLQESAALPEGKNQSLDHRIIRPDGETRWVRLHARPVFTGK----GS------- 2037

Query: 490  NQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAK 549
                 R    +L  T+ D+++ RQ       E S+  A+     + AE AN++KS FLA 
Sbjct: 2038 -----RRKATQLIGTLLDITSQRQF------EQSLKEAR-----QMAEAANESKSAFLAN 2081

Query: 550  MSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIE 609
            MSHE+RTP+ AI+G+ ++I + I  ++ +     Y   +  +G+ LL++IN+IL++SKIE
Sbjct: 2082 MSHEIRTPMTAIMGYIDLIDELIDHKIATA----YLSTVRRNGEFLLDIINDILDLSKIE 2137

Query: 610  TEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADKRIIKKIL 665
              K+ I ++      ++ +   ++   A    ++++     KIP+E+   +D + +K+IL
Sbjct: 2138 AGKLDIIRERFSPHQLLEDVCSIMDVRAAENRLELDIFYYGKIPAEI--ESDPKRLKQIL 2195

Query: 666  FPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQ 725
              ++ N+IKFT   G + I  S   Q +   I DTGIGI     +++ +PF    +  ++
Sbjct: 2196 INLVGNAIKFTMK-GSVKIFVSCNDQQLQFIIVDTGIGITTRQQKRLFRPFSQGDHTVNR 2254

Query: 726  SIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICM 764
              GG GLGLAIS  L N+ GG + + S++ KG+  T+ +
Sbjct: 2255 EFGGTGLGLAISQRLANMLGGEICVESEKDKGSKFTVTI 2293


>gi|284052794|ref|ZP_06383004.1| two-component hybrid sensor and regulator [Arthrospira platensis
           str. Paraca]
          Length = 549

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 148/264 (56%), Gaps = 18/264 (6%)

Query: 514 ILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF 573
           I ER+  E+ +     ++++     A + K EFLA MSHELRTPLN ILG SE +K+ I 
Sbjct: 142 ISERKLMEIELQKTVAELDR-----ATRLKDEFLANMSHELRTPLNGILGMSEALKEGIL 196

Query: 574 GELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLI 633
           G L S +++  A  I  SG+HLL +I++IL++SKIE  K+ +      +  +    + L+
Sbjct: 197 GALNSNQHHAIAM-IEKSGKHLLELISDILDISKIEAGKLELYLTEVRVQELCTSSLTLV 255

Query: 634 GSSAQSKNIKIEKKIPSEL---FFNADKRIIKKILFPILSNSIKFTNNNGKM----MIRT 686
              A +K I IE  IP  L       D R ++++L  +LSN++KFT+ +GK+     I+T
Sbjct: 256 NHLAFTKQINIEINIPQALEKTLIKVDNRRLRQVLINLLSNALKFTHKSGKINLNVGIKT 315

Query: 687 S-----KIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALT 741
           S        Q +  ++ D GIGI    L K+  PF  + +  ++   G GLGLA+   + 
Sbjct: 316 SPNAAISTPQSIYFSVIDNGIGIAPDDLNKLFLPFTQIDSSLNRQYSGTGLGLALVKQII 375

Query: 742 NLHGGRLKIISQEGKGTIVTICMP 765
            LHGG +++ SQ GKG+  T+ +P
Sbjct: 376 ELHGGCVEVSSQLGKGSCFTVYLP 399


>gi|254444627|ref|ZP_05058103.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
 gi|198258935|gb|EDY83243.1| ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain
           protein [Verrucomicrobiae bacterium DG1235]
          Length = 561

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 152/252 (60%), Gaps = 16/252 (6%)

Query: 523 SIANAKYQVE----KERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEI----FG 574
           S++N +Y+ E    KE AE  N  KSEFLA MSHELR+PLN ++GFS++I++++    F 
Sbjct: 171 SLSNERYREELISAKEMAERTNAYKSEFLANMSHELRSPLNCVIGFSDLIEQDVEEKCFE 230

Query: 575 ELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIG 634
            +G     EYA  I  +G+HLL MI  IL++++I+T K+ ++K+   L  ++     ++ 
Sbjct: 231 RIG-----EYAGLIKAAGKHLLGMITEILDLARIDTGKMRLEKREVHLDELLELIASMLK 285

Query: 635 SSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI 694
             A+ K + IE      + F AD+R + ++L  +LSN+IKF++   ++ +     G+ V 
Sbjct: 286 LPAREKRLSIELDC-DPIRFEADERRLHQVLHNLLSNAIKFSSEGSRIGVSAQGQGEIVE 344

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKIISQ 753
           I + D G GI    L++I +PFE + +  D  +G G GLGLAI   + +LHGG++ + S+
Sbjct: 345 IVVWDEGRGIAPDWLDRIFEPFEQVESG-DSELGEGAGLGLAIVKRIVDLHGGQVSVESE 403

Query: 754 EGKGTIVTICMP 765
            G G+  ++ +P
Sbjct: 404 LGVGSRFSVRLP 415


>gi|16264090|ref|NP_436882.1| putative sensory histidine kinase protein [Sinorhizobium meliloti
           1021]
 gi|15140215|emb|CAC48742.1| putative two-component sensor histidine kinase [Sinorhizobium
           meliloti 1021]
          Length = 917

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/419 (27%), Positives = 205/419 (48%), Gaps = 65/419 (15%)

Query: 369 EKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH---VLVPG 425
           EK  LE       + ++ A+E  S+  VL+D  DR+++ N+ Y + +  P H    L   
Sbjct: 271 EKKKLEDEAERQRRTIAAALEVISDGFVLYDSEDRILVANSKYCEIF--PSHKPNTLRGR 328

Query: 426 NARSIIQDAQTRPIIEYRTSDPERSQD-----------MSKEIKLADSRWLQINEWCTHD 474
           + R I++       ++     P+   D           +  E +  D +W++I++    D
Sbjct: 329 SFREIVEQNLEMGQVDLEGKSPQEWVDERVRLHRDPAGLVDEKRFGD-KWVRISKRKIPD 387

Query: 475 GGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKE 534
           GGT++V TDIT LK  Q +L                     ER K+              
Sbjct: 388 GGTVAVYTDITQLKQRQVEL---------------------ERAKSH------------- 413

Query: 535 RAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD---IHYS 591
            AE+AN+ KS FLA MSHELRTPLNAI+G+SE++ +E        +  E   D   I  +
Sbjct: 414 -AESANEAKSRFLASMSHELRTPLNAIIGYSEMLIEEARDH----EDEELVPDLDKIASA 468

Query: 592 GQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSE 651
           G+HLL++IN+IL++SKIE  K+ +  +   +  ++ +    +         +  +   ++
Sbjct: 469 GRHLLSLINDILDLSKIEANKMEVFLETFSVADLLRDVAATVAPLMARNGNEFTQDFEAD 528

Query: 652 LF-FNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQ----CVIITIADTGIGIPK 706
           L   ++D+  +++ LF +LSN+ KFT N G++ +R  +  +     ++  + DTGIG+  
Sbjct: 529 LGEMHSDQTKLRQNLFNLLSNAAKFT-NGGRVTLRVRREQRPDRDWLVFQVTDTGIGMSP 587

Query: 707 SALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
              E++   F        ++ GG GLGL+I+ +   + GG + + S+ GKG++ T+ +P
Sbjct: 588 EQQERLFNAFTQADASTTRNYGGTGLGLSITRSFCRMIGGVVTVESEVGKGSVFTMEVP 646


>gi|85860639|ref|YP_462841.1| sensor proteinluxq [Syntrophus aciditrophicus SB]
 gi|85723730|gb|ABC78673.1| sensor proteinLuxQ [Syntrophus aciditrophicus SB]
          Length = 955

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 211/409 (51%), Gaps = 27/409 (6%)

Query: 366 DLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLP-DHVLVP 424
           D++++   E+  AE+ +R    I+   +A++  D   R+V  N   ++  G+P + +L  
Sbjct: 277 DISDRRLAERALAESQRRFKDIIDFFPDAILAVDIEGRVVTWNHAMEQMTGIPAEEMLGK 336

Query: 425 GNARSIIQDAQTR-PI-IEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGT 482
           GN    +    TR PI I+      E  +     I    +R L         GG I    
Sbjct: 337 GNYEYALPFYGTRRPILIDLAMRPQEEIEHHYVSIHREGNRLLGETYIANLHGGNI---- 392

Query: 483 DITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKT 542
               L      L +SK R+   I  L   R I +R+ TE+++  AK     E A+ AN++
Sbjct: 393 ---FLSGTATALYDSKGRMIGAIESL---RDISDRKATEVALQQAK-----EAADAANRS 441

Query: 543 KSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD-IHYSGQHLLNMINN 601
           KS FLA MSHELRTPLNAI+G+SE++++E   E   V ++  A D IH +G+HLL +IN+
Sbjct: 442 KSAFLANMSHELRTPLNAIIGYSELLQEEA--EEAGVNHFISALDRIHSAGKHLLGLIND 499

Query: 602 ILEMSKIETEKISIDKQNADLIPIINEGIRLIGS-SAQSKNIKIEKKIPSELFFNADKRI 660
           IL++SKIE  KI +  +   +  +I   +++      ++ NI I K   +    +AD   
Sbjct: 500 ILDLSKIEASKIELYPETFSVSEMIESIVKIADPLVKKNGNILIVKGCETGGEMHADLTR 559

Query: 661 IKKILFPILSNSIKFTNNNGKMMIRTSKIGQC----VIITIADTGIGIPKSALEKIGQPF 716
           +++ LF +LSN+ KFT  +G + +  S+  +     +  ++ DTGIG+    +E++ Q F
Sbjct: 560 LRQCLFNLLSNAAKFT-TSGVITLTVSRTQEAEQEWMNFSLHDTGIGMTPQQMERLFQTF 618

Query: 717 EPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
               +   +  GG GLGL I+     L GG + + S+ GKG++ TI +P
Sbjct: 619 TQADSSTTRKFGGTGLGLTITRNFCRLMGGDITVESEYGKGSLFTIRIP 667


>gi|331015224|gb|EGH95280.1| two-component sensor/regulator [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
          Length = 576

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/312 (29%), Positives = 169/312 (54%), Gaps = 39/312 (12%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE +K  + G++   +   Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALKDGMVGDMTDAQ-RRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA---D 657
           +IL++SK+E   + ++ +  DL  +++  + ++   A  + I++  K+ +E  F     D
Sbjct: 373 DILDLSKVEAGMMLLELEAVDLDELLSNSLLIVREQAALQRIQL--KLETEADFGVLELD 430

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI----------------------- 694
           +R  K+I++ +L+N++KF+   G + +   ++ +  +                       
Sbjct: 431 RRKTKQIVYNLLANAVKFSEPGGWVTLAVRQVSRAQVGILDGDWPVHSFSLPPSDYEHFL 490

Query: 695 -ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQ 753
            ++++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S 
Sbjct: 491 QVSVSDTGIGIAQSDMNKLFKAFSQIDSSLARKFEGTGLGLAMVKQLTELHGGCVAVASV 550

Query: 754 EGKGTIVTICMP 765
           +  G    + +P
Sbjct: 551 KDLGARFVVWLP 562


>gi|254417240|ref|ZP_05030985.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
 gi|196176046|gb|EDX71065.1| PAS fold family [Microcoleus chthonoplastes PCC 7420]
          Length = 1359

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 125/438 (28%), Positives = 214/438 (48%), Gaps = 71/438 (16%)

Query: 344 IQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDR 403
           +Q R Q +  I+  +     A+++ E+  +E    E ++R   A+  T++ +  WD    
Sbjct: 556 VQERTQKLSIINNEL-----AIEIKERKRIESLLREREERYELAVSGTNDGIWDWDILTN 610

Query: 404 LVMCNANYQKAYG------------LPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQ 451
            V  +  + +  G              DHV  P +   +I+D      I +  +   +  
Sbjct: 611 EVYYSPVWMRILGYEENPLLNRLSSWSDHV-YPDDLHQVIED------INHHLAGQTQIY 663

Query: 452 DMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTS 511
           +    IK  D  +L    W    G  I                  +  RL  TI D+   
Sbjct: 664 ENIHRIKHRDGHYL----WIATKGRCIR-------------DRDGNPYRLVGTITDI--- 703

Query: 512 RQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSE-VIKK 570
                   T+  IA  + +  KE AETAN+TKS+FLA MSHE+RTP+NA++G +  ++  
Sbjct: 704 --------TDKKIAQEQLKAAKEEAETANRTKSDFLAMMSHEIRTPMNAVIGMTSLLLDT 755

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
           ++  + G     E+   I  S   LL +IN+IL+ SKIE+ K+++++Q  DL   I E +
Sbjct: 756 QLTAQQG-----EFVDIIRNSSDALLTIINDILDFSKIESGKLNLEEQPFDLRACIEESL 810

Query: 631 RLIGSSAQSKNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR- 685
            L+ S A+ K I++    + +IP  +    D   +++IL  ++SN++KFT   G ++I  
Sbjct: 811 ELLSSKARDKGIELAYLMDSQIPESIV--GDVTRLRQILVNLVSNAVKFT-ETGDVVISV 867

Query: 686 --TSKIGQCVI---ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDAL 740
             T++I +  I     + DTGIGI ++ ++++ +PF  +     +  GG GLGLAIS  L
Sbjct: 868 TPTAEISEEQIRLQFAVRDTGIGISRTRMDRLFKPFSQVDASTTRQYGGTGLGLAISQRL 927

Query: 741 TNLHGGRLKIISQEGKGT 758
           + L GG++ + S+EG G+
Sbjct: 928 SELMGGKMWVESEEGVGS 945


>gi|237799882|ref|ZP_04588343.1| PAS protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022737|gb|EGI02794.1| PAS protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 576

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 171/310 (55%), Gaps = 35/310 (11%)

Query: 481 GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN 540
           GT+ T++ +N A   +  R+LK      + +R + ER++ E ++     ++E      A+
Sbjct: 263 GTE-TVVSYNAATFHDRDRKLKGV---FAAARDVTERKRFERTLEEKNIELEH-----AS 313

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
             KSEFLA MSHELRTPLNA++GFSE +K  + G++ +     Y  DI  SGQHLL++IN
Sbjct: 314 HMKSEFLATMSHELRTPLNAVIGFSEALKDGMVGDM-TDDQRRYIGDIFNSGQHLLSLIN 372

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           +IL++SK+E   ++++ +  DL  +++  + ++   A  + I+++ +  ++      D+R
Sbjct: 373 DILDLSKVEAGMMTLELEPVDLDELLSNSLLIVREQAALQRIQLKLETDADFGLLELDRR 432

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQC------------------------VII 695
             K+I++ +L+N++KF+   G +++   ++ +                         + +
Sbjct: 433 KTKQIVYNLLANAVKFSQPGGWVILAVRQVPRSQAGVLEGDWPTYGFELPSSDNEHFLEL 492

Query: 696 TIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEG 755
           +++DTGIGI +S + K+ + F  + +   +   G GLGLA+   LT LHGG + + S + 
Sbjct: 493 SVSDTGIGIAQSDMNKLFKAFSQIDSGLARKFEGTGLGLAMVKQLTELHGGCVAVASVKD 552

Query: 756 KGTIVTICMP 765
            GT   + +P
Sbjct: 553 LGTRFVVWLP 562


>gi|220908073|ref|YP_002483384.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864684|gb|ACL45023.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 1305

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 164/636 (25%), Positives = 286/636 (44%), Gaps = 112/636 (17%)

Query: 199 LIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVE 258
           L++N  + L    R+   LE  +  I+     +     YR     K+ +  +  +   ++
Sbjct: 242 LVVNEELQL----RDGRVLERDYVPIVGDGNFYGHLWQYRDVTARKQAENAVKASEQRLK 297

Query: 259 TALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIAR--LIHYDNKKICEI 316
            AL     GLW++N    + + S   YE++G  Y  + L+ R   R  L+H D+      
Sbjct: 298 LALDAVEEGLWDWNLVTGEIYRSDRWYEMLG--YCARDLADRNQLREQLVHPDD---LAA 352

Query: 317 ARSVTGKHVKQLDQIFH----MRHASGADIWIQVRAQMMRTISGG--MNIIGIAMDLTEK 370
            +++   H+     ++     MR  SG  +WI  R +++     G  + ++G  +D+TE+
Sbjct: 353 MKNLLSAHLNNQTPLYECEARMRTRSGGWLWILDRGRVVSRDREGNPLRMVGTHLDITER 412

Query: 371 YHLEKRYAEADQRL----------------SKAIECTSEALVLWDKNDRLVMCNANYQKA 414
              E+   +  +R+                 + ++ T + +    + DR+++   +   +
Sbjct: 413 KQAEEALQQQYKRVVLLKQLTEKVRQSLQPEEILKTTVQEVQQLLQCDRVLIFQLDADGS 472

Query: 415 YGLPDHVLVPGNARSIIQDAQTRPIIE------YRT------SDPERS--QDMSKE---- 456
             +    +VPG   ++ QD    P +       YR+      +D E++  Q   +E    
Sbjct: 473 GTVVQEAVVPGWTITLGQDIND-PCLRMGYLDYYRSGRITAIADLEQANFQPCHREFLQQ 531

Query: 457 ----------IKLADSRW-LQINEWCTHDGGTISVGTDITLLKH---------NQAQLRE 496
                     I +    W L I   C+       +  D  LLKH          QA L E
Sbjct: 532 FQVRANLVVPILVRQELWGLLIVHQCSQPRQWTELELD--LLKHLADQMGVALTQAHLLE 589

Query: 497 SKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRT 556
            + R          +  +L RQ  EL+ A       K  AE AN  KS FLA +SHE+RT
Sbjct: 590 QETR----------NAYLLTRQNEELTAA-------KHAAEVANAAKSNFLAIVSHEIRT 632

Query: 557 PLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISID 616
           P+NA++G S ++         + + ++Y + I  S   LL +IN+IL+ SKIE+ K+ ++
Sbjct: 633 PMNAVIGMSGLLLDTCL----TPEQFDYVETIRNSSDTLLTIINDILDFSKIESGKLELE 688

Query: 617 KQNADLIPIINEGIRLIGSSAQSKNIK----IEKKIPSELFFNADKRIIKKILFPILSNS 672
           +Q  DL   I E + L+   A SK +     I+  +P+++    D   +++IL+ +LSN+
Sbjct: 689 EQPFDLRICIEEALDLLAPQAASKGLDLVYFIDPHLPTQII--GDITRLRQILWNLLSNA 746

Query: 673 IKFTNNNGKMMI----RTSKIGQCVIIT------IADTGIGIPKSALEKIGQPFEPLHNQ 722
           +KFT   G+++I    R  +     I T      + DTG+GI +  +E++ +PF      
Sbjct: 747 VKFTAM-GEVVISVQGRELEFYPPFISTYEIQFAVQDTGVGIAREQMERLFKPFSQGDAS 805

Query: 723 YDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGT 758
             +  GG GLGLAIS  L+ L  GR+ + SQEGKG+
Sbjct: 806 MTRRYGGTGLGLAISKRLSELMRGRMWVASQEGKGS 841


>gi|254227606|ref|ZP_04921037.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262395654|ref|YP_003287507.1| sensor histidine kinase [Vibrio sp. Ex25]
 gi|151939648|gb|EDN58475.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|262339248|gb|ACY53042.1| sensor histidine kinase [Vibrio sp. Ex25]
          Length = 785

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 88/244 (36%), Positives = 139/244 (56%), Gaps = 9/244 (3%)

Query: 526 NAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYA 585
           N + +  + +AE A K KS FLA MSHELRTP+N +LG S++I +E           EY 
Sbjct: 253 NLEIEEARNKAERAAKAKSSFLAAMSHELRTPMNGVLGLSQMIAEET----NEPTTKEYV 308

Query: 586 QDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK-- 643
           + I  SGQHL+ ++N+IL+ SK+E  K+  ++   +L  +I+     I      KNI+  
Sbjct: 309 KVILDSGQHLMTILNDILDFSKVEENKLEFEQAKFNLDQVISPVCSAIKPLIDEKNIELI 368

Query: 644 IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT--SKIGQCVIITIADTG 701
           +E ++P  + F  D   +++ILF +  N++KFT+  G ++IRT   K+  C+++ ++DTG
Sbjct: 369 VENEVPEYVEFTGDCARLRQILFNLAGNAVKFTSE-GHVLIRTELDKVNHCLVMIVSDTG 427

Query: 702 IGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVT 761
           IGI     E +   FE   +   +  GG GLGLAI   LT L  G++ + S EG G+   
Sbjct: 428 IGIALDKQEHVFNSFEQADSSTTRKFGGTGLGLAIVKKLTGLMDGKITLKSVEGVGSQFI 487

Query: 762 ICMP 765
           + +P
Sbjct: 488 VELP 491


>gi|148251757|ref|YP_001236342.1| PAS/PAC sensor hybrid histidine kinase [Bradyrhizobium sp. BTAi1]
 gi|146403930|gb|ABQ32436.1| PAS/PAC sensor hybrid histidine kinase [Bradyrhizobium sp. BTAi1]
          Length = 745

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 145/260 (55%), Gaps = 16/260 (6%)

Query: 511 SRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKK 570
            R + +R +TE ++A A+ Q     A  AN+ KS FLA  SHE+RTPLN ILG S ++ +
Sbjct: 207 GRDVTDRTETERALAEARDQ-----ANAANRAKSRFLAMASHEIRTPLNGILGMSGLLLE 261

Query: 571 EIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGI 630
                  + +   YA+ +  SG+ L+++IN +L+ SKIE  K++++ Q   L  +I E  
Sbjct: 262 TQL----TPEQTTYAKAVRSSGEALMSLINELLDYSKIEAGKLALEAQPFALTALIEEIT 317

Query: 631 RLIGSSAQSKNIKI----EKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRT 686
            L+   AQ K ++I    ++++P+  +   D   ++++L  +  N+IKFT+  G  +I  
Sbjct: 318 ELLAPRAQGKQLEIAAYLDERLPT--WVTGDAARLRQVLLNLAGNAIKFTSKGGVALIAE 375

Query: 687 SKIGQCVI-ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHG 745
             I    I   + DTGIGI   A E+I + FE   +   +S GG GLGLAISD +    G
Sbjct: 376 PGIWPNEISFQVRDTGIGIAADAQERIFREFEQADDSVARSFGGTGLGLAISDRIVKRMG 435

Query: 746 GRLKIISQEGKGTIVTICMP 765
           GR+ + SQ G G+   + +P
Sbjct: 436 GRIALQSQPGAGSTFEVSVP 455


>gi|300867388|ref|ZP_07112044.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
 gi|300334639|emb|CBN57212.1| putative Histidine kinase [Oscillatoria sp. PCC 6506]
          Length = 1120

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 137/557 (24%), Positives = 247/557 (44%), Gaps = 88/557 (15%)

Query: 237 YRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKT 296
           YR   K  +    L E+       L     G+W+++    + + +  + EI+G+      
Sbjct: 141 YRAETKATQASQKLKESEERYRLVLEGANDGIWDWDLSKNEVYWNDRLLEIVGLSRSEFG 200

Query: 297 LSFRAIARLIHYDNKKICEIARSVTGKHVK---QLDQIFHMRHASGADIWIQVRAQMMRT 353
            +  A    +H ++    E  R     H++   + +  F + H+S    +   R +  R 
Sbjct: 201 SAIEAFFDRLHPED---YESTRKALEAHLETGTEYNVEFRLLHSSDVYRYCTGRGKAQRN 257

Query: 354 ISG-GMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQ 412
             G  + + GI  D++++   E       Q+L + I C    + ++DK  R    +  + 
Sbjct: 258 QQGKALRMAGIISDISDRKLAEAALERERQQLRQIIACVPVPMAMFDKEMRYQAHSQRWL 317

Query: 413 KAYGL--------------PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIK 458
             Y L              PD   +P   R + + + T  ++   + D  + +D S    
Sbjct: 318 TQYNLEGQSILNRSYYEVLPD---IPDRWRKMHERSLTGEVVSV-SEDAWKREDGSTVFL 373

Query: 459 LADSRWLQINEWCTHDG--GTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILE 516
               RW  I+ W   DG  G I + +D                     IN+L  +R    
Sbjct: 374 ----RW-AIHPWYAPDGEVGGIVLVSD--------------------RINELVEAR---- 404

Query: 517 RQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGEL 576
                            E A  A++ KS+FLA MSHE+RTP+N +LG ++++ +      
Sbjct: 405 -----------------EAAIEASRVKSQFLANMSHEIRTPMNGVLGMAQLLLRLSL--- 444

Query: 577 GSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSS 636
              K  EYAQ I+ S +HLL++IN+IL+ SKIE  ++ ++  + DL   I   + ++ ++
Sbjct: 445 -EAKPREYAQTIYRSAEHLLSVINDILDFSKIEAGEMRLETLDFDLDVCIESMVEMVVAT 503

Query: 637 AQSK----NIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR----TSK 688
           A+ K    N+ IE  +P +L    D   +K+IL  +++N+IKFT + G++++R    +S 
Sbjct: 504 AEEKGLELNVLIESSVPRQL--QGDPGRLKQILLNLVNNAIKFT-DRGQVLVRVSLKSST 560

Query: 689 IGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
           + + +I ++ D+GIGI     +K+ Q F  +     +  GG GLGL I   L  + GG +
Sbjct: 561 VDRKLIFSVRDSGIGISPEGQKKLFQSFSQVDGSPTRQYGGTGLGLVICKQLVEMMGGEI 620

Query: 749 KIISQEGKGTIVTICMP 765
            + +  GKG+     +P
Sbjct: 621 GVRTSVGKGSNFWFTIP 637


>gi|156743538|ref|YP_001433667.1| histidine kinase [Roseiflexus castenholzii DSM 13941]
 gi|156234866|gb|ABU59649.1| histidine kinase [Roseiflexus castenholzii DSM 13941]
          Length = 548

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 89/263 (33%), Positives = 148/263 (56%), Gaps = 11/263 (4%)

Query: 506 NDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFS 565
           N+LS  +  L RQ  EL+  NA+ +        AN+ K EFLA +SHE+RTPL+AILG +
Sbjct: 136 NELSLLKDRLSRQNVELARTNAELR-------RANRLKDEFLAGISHEVRTPLSAILGLA 188

Query: 566 EVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPI 625
           E+++ +I G L   +  E    I  SG+HLL +IN++L+++KIE  +  ++ +      +
Sbjct: 189 ELLRAKIVGPLND-EQVEMLSRIEASGRHLLAVINDLLDLAKIEAGRFELEPRLVAAHQV 247

Query: 626 INEGIRLIGSSAQSKNIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGK--M 682
               + ++   A  K+ ++   + P     +AD+R +++ L  +LSN++KFT   G   +
Sbjct: 248 CRSSLLMVKELALRKHQRVHINLDPKVEVLHADERRLRQALINLLSNAVKFTPPGGDVGL 307

Query: 683 MIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTN 742
            +      + V IT+ DTGIGI    + ++ QPF  + N+Y     G GLGL +   L  
Sbjct: 308 DLEGDPEQEIVRITVWDTGIGIAAEDIPRLFQPFSQIQNKYQHDQAGSGLGLVMVARLAE 367

Query: 743 LHGGRLKIISQEGKGTIVTICMP 765
           LHGG + ++S+ GKG+  T+ +P
Sbjct: 368 LHGGGVSLVSEPGKGSRFTMTLP 390


>gi|297568711|ref|YP_003690055.1| histidine kinase [Desulfurivibrio alkaliphilus AHT2]
 gi|296924626|gb|ADH85436.1| histidine kinase [Desulfurivibrio alkaliphilus AHT2]
          Length = 510

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 146/255 (57%), Gaps = 17/255 (6%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL   +   Q  KE AE+AN+ KS FLA MSHELRTPLNAI+G+SE++ ++   E G  +
Sbjct: 247 ELEAQSRLLQQAKETAESANRAKSRFLANMSHELRTPLNAIIGYSELLLEDA-SEWGEWE 305

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
             E  + I  +GQHLL +I++IL++SKIE  ++ +  +     P++N+ +  I       
Sbjct: 306 ISEDLEKIKSAGQHLLMLISDILDISKIEAGRLDLHLEEVQWEPLLNDVVNTIRPLVVKN 365

Query: 641 NIKIEKKIPSE---LFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVI--- 694
           N +++   P E   LF +A K  ++++L+ +LSN+ KFT  +G++M++ S    C +   
Sbjct: 366 NNRLQVDTPPEEITLFTDATK--LRQVLYNLLSNATKFT-TDGEIMLKASL---CRLRRQ 419

Query: 695 ----ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKI 750
                 ++D+GIG+ +  L KI QPF    +   +  GG GLGL IS     + GG +K 
Sbjct: 420 PRLEFAVSDSGIGMSEEQLAKIFQPFTQADSSTTRKYGGTGLGLVISRYFCRMMGGDIKA 479

Query: 751 ISQEGKGTIVTICMP 765
            S+ G G   T+ +P
Sbjct: 480 TSRPGAGATFTVSLP 494


>gi|260778949|ref|ZP_05887841.1| sensor histidine kinase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260605113|gb|EEX31408.1| sensor histidine kinase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 786

 Score =  152 bits (383), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 145/251 (57%), Gaps = 10/251 (3%)

Query: 520 TELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSV 579
           +EL   N  YQV  E AE AN+ KS FLA MSHELRTP+N +LG +++IK E   EL + 
Sbjct: 243 SELKRNNLAYQVATENAEKANEAKSIFLATMSHELRTPMNGVLGIAQIIKDE-SQELETK 301

Query: 580 KYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQS 639
           K    AQ +  SGQHL+ ++N+IL+ SK+E  K+ ++     +  ++    + +G  A +
Sbjct: 302 K---QAQILIDSGQHLMTILNDILDFSKVEQGKLELEIHPFSIGELVLSLEKTLGPQAAN 358

Query: 640 KNIK--IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVI 694
           K +K  I+ K+P+ +  + D    ++ILF ++ N+IKFT   GK+ +     + I   V 
Sbjct: 359 KGLKFVIQNKVPANIELHGDPARTRQILFNLVGNAIKFT-QTGKIEVEFALDTSIPPNVC 417

Query: 695 ITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQE 754
           +++ D+GIGI +  L+ I  PFE       +  GG GLGL+I   L  + GG++ + SQ 
Sbjct: 418 MSVTDSGIGIEREKLDTIFTPFEQAELSTTRKFGGTGLGLSIVKRLVEMMGGKVSVFSQP 477

Query: 755 GKGTIVTICMP 765
             GT  T+ +P
Sbjct: 478 NVGTQFTLTIP 488


>gi|91772668|ref|YP_565360.1| PAS/PAC sensor signal transduction histidine kinase
           [Methanococcoides burtonii DSM 6242]
 gi|91711683|gb|ABE51610.1| pleC (non-motile and phage-resistance protein) -like multisensor
           signal transduction histidine kinase [Methanococcoides
           burtonii DSM 6242]
          Length = 456

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 148/262 (56%), Gaps = 13/262 (4%)

Query: 508 LSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEV 567
           LS +R I ER+K E +I  AK +     AE+AN+ KSEFLA MSHELRTPLN+I+GFS+V
Sbjct: 196 LSIARDITERKKAEEAILEAKIE-----AESANRAKSEFLANMSHELRTPLNSIIGFSDV 250

Query: 568 IKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIIN 627
           +  E  G L   +  +Y  ++  +G+HLL++IN+IL +S IET  + +      +   I+
Sbjct: 251 LYNESHGPLNEYQK-KYTSNVLRNGKHLLDIINDILSISNIETGTMELHINEFIVSDAID 309

Query: 628 EGIRLIGSSAQSKNIK----IEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMM 683
           E   L+   A  K+I     I+  +P+      D    K+IL+ ++ N+IKFT+  G + 
Sbjct: 310 EVESLMILIASEKDIDLTCNIDIGMPT---IKTDMIKFKQILYNLVHNAIKFTDQGGSVT 366

Query: 684 IRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNL 743
           I        V I++ D+GIG+     +K+  PF  L +   +  GG GLGLA+      +
Sbjct: 367 IGGKISDDLVHISVKDSGIGVSPEDQDKLFNPFFQLDSSNARKYGGTGLGLALVKKFVEM 426

Query: 744 HGGRLKIISQEGKGTIVTICMP 765
           HGG + + S+ GKG+  T  +P
Sbjct: 427 HGGEIWVESEVGKGSTFTFIIP 448


>gi|330508806|ref|YP_004385234.1| two-component hybrid sensor and regulator [Methanosaeta concilii
           GP-6]
 gi|328929614|gb|AEB69416.1| two-component hybrid sensor and regulator [Methanosaeta concilii
           GP-6]
          Length = 1026

 Score =  151 bits (382), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 127/458 (27%), Positives = 222/458 (48%), Gaps = 30/458 (6%)

Query: 314 CEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGM-NIIGIAMDLTEKYH 372
           C +AR++     ++ D I           WI  R+  ++   G +  ++ + +D++ +  
Sbjct: 427 CTVARAINMGASQEGDLI-----TPDGRTWIS-R