RPSBLAST alignment for GI: 254780903 and conserved domain: TIGR02956

>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). Length = 968
 Score =  164 bits (418), Expect = 6e-41
 Identities = 94/288 (32%), Positives = 152/288 (52%), Gaps = 22/288 (7%)

Query: 491 QAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVE-------KERAETANKTK 543
           QA  R+  + L+     L    Q++ ++  EL+  N +   E       +  AE AN+ K
Sbjct: 408 QADERQVAQELQEHKESLE---QLVAQRTQELAETNERLNAEVKNHAKARAEAEEANRAK 464

Query: 544 SEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNIL 603
           S FLA MSHE+RTPLN ILG  E++       L S +  +Y Q I+ SG+ LL+++N+IL
Sbjct: 465 SAFLATMSHEIRTPLNGILGTLELLGDT---GLTS-QQQQYLQVINRSGESLLDILNDIL 520

Query: 604 EMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL--FFNADKRII 661
           + SKIE   +SI  +  DL  ++++   L+ S AQ K I++   IP +L  ++  D   I
Sbjct: 521 DYSKIEAGHLSISPRPFDLNALLDDVHHLMVSRAQLKGIQLRLNIPEQLPNWWQGDGPRI 580

Query: 662 KKILFPILSNSIKFTNNNGKMMIRTSKIGQ-CVIITIADTGIGIPKSALEKIGQPFEPLH 720
           +++L  ++ N+IKFT + G +++R S      ++  + DTG GI +     +   F    
Sbjct: 581 RQVLINLVGNAIKFT-DRGSVVLRVSLNDDSSLLFEVEDTGCGIAEEEQATLFDAFTQAD 639

Query: 721 NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTI--VTICMPQ 766
            +  +  GG GLGLAIS  L     G L + S+ G G+    T+ + +
Sbjct: 640 GR--RRSGGTGLGLAISQRLVEAMDGELGVESELGVGSCFWFTLPLTR 685