RPSBLAST alignment for GI: 254780903 and conserved domain: PRK10549

>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional. Length = 466
 Score = 70.8 bits (174), Expect = 1e-12
 Identities = 56/218 (25%), Positives = 102/218 (46%), Gaps = 35/218 (16%)

Query: 546 FLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQD---------IHYSGQH-- 594
           F+A +SHELRTPL A+L           GEL      E  QD         +  S Q   
Sbjct: 243 FMADISHELRTPL-AVLR----------GEL------EAIQDGVRKFTPESVA-SLQAEV 284

Query: 595 --LLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL 652
             L  +++++ ++S  +   ++  K   DL+P++            S+ + ++  +P   
Sbjct: 285 GTLTKLVDDLHQLSLSDEGALAYRKTPVDLVPLLEVAGGAFRERFASRGLTLQLSLPDSA 344

Query: 653 FFNADK-RIIKKILFP-ILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALE 710
               D  R+++  LF  +L NS+++T++ G + I   +  + + +T AD+  G+    L+
Sbjct: 345 TVFGDPDRLMQ--LFNNLLENSLRYTDSGGSLHISAEQRDKTLRLTFADSAPGVSDEQLQ 402

Query: 711 KIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRL 748
           K+ + F       +++ GG GLGLAI   +   H GR+
Sbjct: 403 KLFERFYRTEGSRNRASGGSGLGLAICLNIVEAHNGRI 440