RPSBLAST alignment for GI: 254780903 and conserved domain: PRK10755

>gnl|CDD|182702 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional. Length = 356
 Score = 46.5 bits (111), Expect = 2e-05
 Identities = 28/119 (23%), Positives = 60/119 (50%), Gaps = 5/119 (4%)

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSA 708
            +++    D  +++ +L  ++ N+ +++     + I+ S+     ++ + D G GI +S 
Sbjct: 236 AADITVQGDATLLRLLLRNLVENAHRYSPEGSTITIKLSQEDGGAVLAVEDEGPGIDESK 295

Query: 709 LEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIIS-QEGKGTIVTICMPQ 766
             ++ + F  +    D   GG GLGL+I   +T LH G+  + + QE  GT   + +P+
Sbjct: 296 CGELSKAFVRM----DSRYGGIGLGLSIVSRITQLHHGQFFLQNRQERSGTRAWVWLPK 350