RPSBLAST alignment for GI: 254780903 and conserved domain: PRK13557

>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional. Length = 540
 Score = 45.8 bits (109), Expect = 4e-05
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 682 MMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDAL 740
            M      G+ V I + DTG G+P   L ++  PF     +     G G GLGL++    
Sbjct: 314 AMYHGLPPGRYVSIAVTDTGSGMPPEILARVMDPFFTTKEE-----GKGTGLGLSMVYGF 368

Query: 741 TNLHGGRLKIISQEGKGTIVTICMP 765
               GG ++I S+ G+GT V +  P
Sbjct: 369 AKQSGGAVRIYSEVGEGTTVRLYFP 393