RPSBLAST alignment for GI: 254780903 and conserved domain: COG4251

>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms]. Length = 750
 Score = 70.7 bits (173), Expect = 1e-12
 Identities = 50/224 (22%), Positives = 100/224 (44%), Gaps = 12/224 (5%)

Query: 537 ETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLL 596
           E +N     F    SH+L+ PL  I  +++++ +     L   +  E+   I      + 
Sbjct: 518 ERSNAELRAFAYVASHDLQEPLRQISNYAQLLSERYSDALDE-EAKEFITFISRLTSLMQ 576

Query: 597 NMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNA 656
            +I+++L  SK+   +  +  Q  D+  ++++ +  +         +I       +  +A
Sbjct: 577 QLIDDLLTYSKLGLTEAPL--QPTDVQKVVDKVLLELSQRIADTGAEIRIAPLPVVAADA 634

Query: 657 DKRIIKKILFPILSNSIKF-TNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQP 715
            +  + ++   +++N+IKF    N  + I   +       ++ D GIGI  +  E+I   
Sbjct: 635 TQ--LGQVFQNLIANAIKFGGPENPDIEISAERQEDEWTFSVRDNGIGIDPAYFERIFVI 692

Query: 716 FEPLH--NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKG 757
           F+ LH  ++Y     G GLGLAI   +   H GR+ + S  G+G
Sbjct: 693 FQRLHSRDEY----LGTGLGLAICKKIAERHQGRIWVESTPGEG 732