RPSBLAST alignment of GI: 254780904 and MMDB domain: 1gz0_A_90-253

>1gz0_A (A:90-253) Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli}Length = 164
 Score = 83.3 bits (205), Expect = 3e-17
 Identities = 24/162 (14%), Positives = 55/162 (33%), Gaps = 11/162 (6%)

Query: 8   LQNSAKGPVIILVDPQLGENIGMVARAMWNFNLTQLRLVNPRDGWPSEKARSSSANADCV 67
           + +  +  ++IL       N+G   R+     +  + +   R    +  A+  +  A   
Sbjct: 10  IASLDQPFLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAES 69

Query: 68  IDSVRVFSNLKEAIADLHFIYATTARNRNNFKSVLAPKEAAIVLNERIFSGQNVGIIFGR 127
           +  +RV +           +  T    +     ++     A     +      + ++ G 
Sbjct: 70  VPLIRVTN-----------LARTXRXLQEENIWIVGTAGEADHTLYQSKXTGRLALVXGA 118

Query: 128 ERWGLTNEEIALSNAIISFPVNPLFPSLNISQAVLLMVWECM 169
           E  G         + +IS P      SLN+S A  + ++E +
Sbjct: 119 EGEGXRRLTREHCDELISIPXAGSVSSLNVSVATGICLFEAV 160