RPSBLAST alignment of GI: 254780904 and MMDB domain: 1zjr_A_24-180

>1zjr_A (A:24-180) TRNA (guanosine-2'-O-)-methyltransferase; methylase, RNA modifying enzyme, topological knot; 1.85A {Aquifex aeolicus}Length = 157
 Score = 82.6 bits (203), Expect = 4e-17
 Identities = 18/157 (11%), Positives = 56/157 (35%), Gaps = 11/157 (7%)

Query: 13  KGPVIILVDPQLGENIGMVARAMWNFNLTQLRLVNPRDGWPSEKARSSSANADCVIDSVR 72
           K  ++   + +   N   + R      +  L   +      ++     +  +   +   +
Sbjct: 1   KDLIVFADNVKNEHNFSAIVRTCDAVGVLYLYYYHAEG-KKAKINEGITQGSHKWVFIEK 59

Query: 73  VFSNLKEAIADLHFIYATTARNRNNFKSVLAPKEAAIVLNERIFSGQNVGIIFGRERWGL 132
           V + +++ +   +  +   A   +         +            +   ++ G E  G+
Sbjct: 60  VDNPVQKLLEFKNRGFQIVATWLSKESVNFREVDY----------TKPTVLVVGNELQGV 109

Query: 133 TNEEIALSNAIISFPVNPLFPSLNISQAVLLMVWECM 169
           + E + +++  I  P+  +  SLN+S A  ++++E  
Sbjct: 110 SPEIVEIADKKIVIPMYGMAQSLNVSVATGIILYEAQ 146