>gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62]
MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKPNTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER