BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780906|ref|YP_003065319.1| hypothetical protein
CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62]
         (96 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 96

 Score =  199 bits (506), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%)

Query: 1  MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60
          MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP
Sbjct: 1  MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60

Query: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96
          NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER
Sbjct: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96


>gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 125

 Score = 23.5 bits (49), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 11/45 (24%)

Query: 11 FFITGMILSSCGDTLSDSKQ-----------HNKINNTKNHLDLL 44
          F I G++L+S   T S   +            NKI + +N++DLL
Sbjct: 7  FIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLL 51


>gi|254780425|ref|YP_003064838.1| apolipoprotein N-acyltransferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 518

 Score = 23.5 bits (49), Expect = 0.81,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 25  LSDSKQHNKINNTKNHLDLLFPIDDS 50
            SD+  H  INN +N   +L  IDDS
Sbjct: 403 FSDALFHQDINNLENVSAILNIIDDS 428


>gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 494

 Score = 22.7 bits (47), Expect = 1.1,   Method: Composition-based stats.
 Identities = 8/17 (47%), Positives = 13/17 (76%)

Query: 32 NKINNTKNHLDLLFPID 48
          N I  +K+HL++L P+D
Sbjct: 49 NFIGESKSHLNILAPVD 65


>gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 805

 Score = 22.3 bits (46), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/19 (52%), Positives = 12/19 (63%)

Query: 9   ILFFITGMILSSCGDTLSD 27
           +L  I  +ILS CG T SD
Sbjct: 372 VLKHIVSLILSLCGGTASD 390


>gi|254780605|ref|YP_003065018.1| putative aminopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 609

 Score = 20.4 bits (41), Expect = 6.8,   Method: Composition-based stats.
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 57  EKKPNTSSIKIKNNIIEP 74
           EK+ +T+   IKN  IEP
Sbjct: 86  EKEVDTALFTIKNIAIEP 103


>gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 492

 Score = 20.0 bits (40), Expect = 8.3,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 19/41 (46%)

Query: 26  SDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKPNTSSIK 66
           + S ++    N    L++ +P DD  +     KK +  SIK
Sbjct: 424 TKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIK 464


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in datab