BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780906|ref|YP_003065319.1| hypothetical protein CLIBASIA_04025 [Candidatus Liberibacter asiaticus str. psy62] Length = 96 Score = 199 bits (506), Expect = 8e-54, Method: Compositional matrix adjust. Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 1 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP Sbjct: 1 MTISKNQAILFFITGMILSSCGDTLSDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKP 60 Query: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER Sbjct: 61 NTSSIKIKNNIIEPQPGPSRWEGGWNGERYVREWER 96 >gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 23.5 bits (49), Expect = 0.67, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 11/45 (24%) Query: 11 FFITGMILSSCGDTLSDSKQ-----------HNKINNTKNHLDLL 44 F I G++L+S T S + NKI + +N++DLL Sbjct: 7 FIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLL 51 >gi|254780425|ref|YP_003064838.1| apolipoprotein N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 518 Score = 23.5 bits (49), Expect = 0.81, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 25 LSDSKQHNKINNTKNHLDLLFPIDDS 50 SD+ H INN +N +L IDDS Sbjct: 403 FSDALFHQDINNLENVSAILNIIDDS 428 >gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 494 Score = 22.7 bits (47), Expect = 1.1, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 32 NKINNTKNHLDLLFPID 48 N I +K+HL++L P+D Sbjct: 49 NFIGESKSHLNILAPVD 65 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 22.3 bits (46), Expect = 1.8, Method: Composition-based stats. Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 9 ILFFITGMILSSCGDTLSD 27 +L I +ILS CG T SD Sbjct: 372 VLKHIVSLILSLCGGTASD 390 >gi|254780605|ref|YP_003065018.1| putative aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 609 Score = 20.4 bits (41), Expect = 6.8, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 57 EKKPNTSSIKIKNNIIEP 74 EK+ +T+ IKN IEP Sbjct: 86 EKEVDTALFTIKNIAIEP 103 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 20.0 bits (40), Expect = 8.3, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 19/41 (46%) Query: 26 SDSKQHNKINNTKNHLDLLFPIDDSHNQKPTEKKPNTSSIK 66 + S ++ N L++ +P DD + KK + SIK Sbjct: 424 TKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIK 464 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.132 0.406 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,171 Number of Sequences: 1233 Number of extensions: 2575 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 96 length of database: 328,796 effective HSP length: 61 effective length of query: 35 effective length of database: 253,583 effective search space: 8875405 effective search space used: 8875405 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)