RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Length = 307 Score = 26.4 bits (57), Expect = 1.7 Identities = 12/59 (20%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Query: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESS 59 MKL FS + A L SC + + + PA K+ + + Sbjct: 1 MKLWFSTLKLKKAAAVLLFSCVALA-GCANNQTNASQPAEKNEKTEMKDDFAKLEEQFD 58 >1v7r_A Hypothetical protein PH1917; ntpase, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; HET: CIT; 1.40A {Pyrococcus horikoshii OT3} SCOP: c.51.4.1 PDB: 2dvn_A* 2dvo_A* 2dvp_A 2ehk_A 2zti_A 2e5x_A* Length = 186 Score = 24.8 bits (53), Expect = 4.2 Identities = 6/27 (22%), Positives = 15/27 (55%) Query: 58 SSNKDKAKEITLDIIDLGIDLLTKEDK 84 +SN K +E+ + GI+++ + + Sbjct: 7 TSNPGKVREVANFLGTFGIEIVQLKHE 33 >2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Length = 219 Score = 24.6 bits (53), Expect = 5.6 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 54 PKTESSNKDKAKEITLDIIDLGIDLLTKED 83 S N KAKE DI++L +D + Sbjct: 9 DTNFSENLKKAKEKGADIVELRVDQFSDTS 38 >1vp2_A Putative xanthosine triphosphate pyrophosphatase/HAM1 protein homolog; TM0159; 1.78A {Thermotoga maritima} SCOP: c.51.4.1 Length = 208 Score = 24.0 bits (51), Expect = 7.9 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 58 SSNKDKAKEITLDIIDLGIDLLTKEDKKE 86 ++N K +EI I +++L +K E Sbjct: 22 TTNPHKVEEIK-MIAPEWMEILPSPEKIE 49 >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Score = 23.8 bits (51), Expect = 9.5 Identities = 9/49 (18%), Positives = 17/49 (34%) Query: 38 PAPVALAAPPKNKTEAPKTESSNKDKAKEITLDIIDLGIDLLTKEDKKE 86 P+ + + E P E + KE + D + K+ K + Sbjct: 208 NFPIYVWSSKTETVEEPMEEEEAAKEEKEDSDDEAAVXXXXXXKKPKTK 256 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.309 0.127 0.348 Gapped Lambda K H 0.267 0.0589 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 676,400 Number of extensions: 24934 Number of successful extensions: 66 Number of sequences better than 10.0: 1 Number of HSP's gapped: 66 Number of HSP's successfully gapped: 12 Length of query: 88 Length of database: 5,693,230 Length adjustment: 55 Effective length of query: 33 Effective length of database: 4,359,810 Effective search space: 143873730 Effective search space used: 143873730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 50 (23.3 bits)