RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) >d1v7ra_ c.51.4.1 (A:) XTP pyrophosphatase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 186 Score = 24.8 bits (53), Expect = 2.1 Identities = 6/27 (22%), Positives = 15/27 (55%) Query: 58 SSNKDKAKEITLDIIDLGIDLLTKEDK 84 +SN K +E+ + GI+++ + + Sbjct: 7 TSNPGKVREVANFLGTFGIEIVQLKHE 33 >d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]} Length = 209 Score = 24.4 bits (52), Expect = 2.6 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 58 SSNKDKAKEITLDIIDLGIDLLTKED 83 + N K +E+ + D G+D++ + D Sbjct: 20 TGNVGKVRELASLLSDFGLDIVAQTD 45 >d1vp2a_ c.51.4.1 (A:) Putative inosine/xanthosine triphosphate pyrophosphatase TM0159 {Thermotoga maritima [TaxId: 2336]} Length = 189 Score = 23.7 bits (50), Expect = 4.0 Identities = 8/29 (27%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 58 SSNKDKAKEITLDIIDLGIDLLTKEDKKE 86 ++N K +EI I +++L +K E Sbjct: 8 TTNPHKVEEIK-MIAPEWMEILPSPEKIE 35 >d1dw0a_ a.3.1.1 (A:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]} Length = 112 Score = 22.9 bits (49), Expect = 8.0 Identities = 10/38 (26%), Positives = 16/38 (42%) Query: 20 SCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTE 57 +C A T AP+A +A P T++ + E Sbjct: 45 TCHGADVTRAGQTRTGKEIAPLAPSATPDRFTDSARVE 82 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.309 0.127 0.348 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 288,006 Number of extensions: 10449 Number of successful extensions: 15 Number of sequences better than 10.0: 1 Number of HSP's gapped: 15 Number of HSP's successfully gapped: 6 Length of query: 88 Length of database: 2,407,596 Length adjustment: 53 Effective length of query: 35 Effective length of database: 1,679,906 Effective search space: 58796710 Effective search space used: 58796710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 47 (22.2 bits)