BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] (88 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780907|ref|YP_003065320.1| hypothetical protein CLIBASIA_04030 [Candidatus Liberibacter asiaticus str. psy62] Length = 88 Score = 169 bits (428), Expect = 8e-45, Method: Compositional matrix adjust. Identities = 88/88 (100%), Positives = 88/88 (100%) Query: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN 60 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN Sbjct: 1 MKLLFSKIAPVFAMGTALISCDSASDPAKKSNITPIPPAPVALAAPPKNKTEAPKTESSN 60 Query: 61 KDKAKEITLDIIDLGIDLLTKEDKKEGA 88 KDKAKEITLDIIDLGIDLLTKEDKKEGA Sbjct: 61 KDKAKEITLDIIDLGIDLLTKEDKKEGA 88 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 21.9 bits (45), Expect = 2.3, Method: Compositional matrix adjust. Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 45 APPKNKTEAPKTESSNKDKAKEITLDIIDLGIDLLT 80 A KN T P +S ++ KE+ + ++D + +T Sbjct: 497 ATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCIT 532 >gi|254780742|ref|YP_003065155.1| hypothetical protein CLIBASIA_03145 [Candidatus Liberibacter asiaticus str. psy62] Length = 419 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 13/27 (48%) Query: 14 MGTALISCDSASDPAKKSNITPIPPAP 40 + TA++ D K NI +PP P Sbjct: 361 VATAILIAQGIWDIGKMVNIEELPPKP 387 >gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 15 GTALISCDSASDPAKKSNITPIPPAPVALAAPP 47 GT+L S S+ D K+ +P+ PA + + P Sbjct: 106 GTSLFSIISSLDQLKQFITSPVLPALLDILFTP 138 >gi|254780690|ref|YP_003065103.1| flagellar biosynthesis protein FlhB [Candidatus Liberibacter asiaticus str. psy62] Length = 354 Score = 20.4 bits (41), Expect = 5.9, Method: Composition-based stats. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 47 PKNKTEAPKTE 57 P NKTEAP ++ Sbjct: 7 PDNKTEAPSSK 17 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.309 0.127 0.348 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,421 Number of Sequences: 1233 Number of extensions: 1551 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 88 length of database: 328,796 effective HSP length: 56 effective length of query: 32 effective length of database: 259,748 effective search space: 8311936 effective search space used: 8311936 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (20.8 bits) S2: 31 (16.5 bits)