>gi|254780908|ref|YP_003065321.1| hypothetical protein CLIBASIA_04035 [Candidatus Liberibacter asiaticus str. psy62]
MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV