BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780908|ref|YP_003065321.1| hypothetical protein
CLIBASIA_04035 [Candidatus Liberibacter asiaticus str. psy62]
         (35 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780908|ref|YP_003065321.1| hypothetical protein CLIBASIA_04035 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040585|gb|ACT57381.1| hypothetical protein CLIBASIA_04035 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 35

 Score = 60.9 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 35/35 (100%), Positives = 35/35 (100%)

Query: 1  MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV 35
          MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV
Sbjct: 1  MMLLFLAGSDAESQEMRAVPIANTGAILEKSNFIV 35


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.320    0.132    0.343 

Lambda     K      H
   0.267   0.0447    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 348,264,826
Number of Sequences: 14124377
Number of extensions: 6781250
Number of successful extensions: 9768
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 9767
Number of HSP's gapped (non-prelim): 1
length of query: 35
length of database: 4,842,793,630
effective HSP length: 9
effective length of query: 26
effective length of database: 4,715,674,237
effective search space: 122607530162
effective search space used: 122607530162
T: 11
A: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 76 (33.8 bits)