RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780909|ref|YP_003065322.1| hypothetical protein CLIBASIA_04040 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >gnl|CDD|38173 KOG2962, KOG2962, KOG2962, Prohibitin-related membrane protease subunits [General function prediction only]. Length = 322 Score = 33.5 bits (76), Expect = 0.030 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Query: 36 AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE-VNEVP 94 AE+ K L+ QK EK AE RK A AE + A KI+ + K KE ++ ++E+ Sbjct: 188 AEKTKLLIAAEKQKVVEKEAETERKKAVIEAEKNAQVA-KILMQQKLMEKETEKRISEIE 246 Query: 95 VAANIEPE 102 AA + E Sbjct: 247 DAAFLARE 254 >gnl|CDD|48218 cd03406, Band_7_3, A subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin. Many of these band 7 domain-containing proteins are lipid raft-associated. Individual proteins of this band 7 domain family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. Microdomains formed from flotillin proteins may in addition be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and are known to interact with a variety of proteins. Stomatin interacts with and regulates members of the degenerin/epithelia Na+ channel family in mechanosensory cells of Caenorhabditis elegans and vertebrate neurons and participates in trafficking of Glut1 glucose transporters. Prohibitin may act as a chaperone for the stabilization of mitochondrial proteins. Prokaryotic HflK/C plays a role in the decision between lysogenic and lytic cycle growth during lambda phage infection. Flotillins have been implicated in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and, in cancer invasion and metastasis. Mutations in the podicin gene give rise to autosomal recessive steroid resistant nephritic syndrome.. Length = 280 Score = 31.5 bits (71), Expect = 0.096 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Query: 36 AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95 AE+ K L+ QK EK AE RK A AE + A+ + + + + + ++E+ Sbjct: 170 AEKTKLLIAIQKQKVVEKEAETERKKAVIEAEKVAQVAKILFGQKVMEKETEKRISEIED 229 Query: 96 AANIEPESQETQQQVINKTTTSQTDAEK 123 A + E + + T + +A K Sbjct: 230 EAFLAREKAKADAEYY--TAQKEAEANK 255 >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.. Length = 401 Score = 30.0 bits (68), Expect = 0.32 Identities = 13/53 (24%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Query: 27 VAPPPPQTLAER-GKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIH 78 A P + AER AL + +AA R+ E+ +A +I Sbjct: 350 PALDPRELTAERLAAALRRLLDPPSRRRAAALLRRIREEDGVP---SAADVIE 399 >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein. This family consists of several Borrelia P83/P100 antigen proteins. Length = 489 Score = 28.4 bits (63), Expect = 0.86 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 10/90 (11%) Query: 43 LDEATQKA--AEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100 D+A QKA A+ A+ R Q + AK + D PKE+++V E N + Sbjct: 229 ADKAQQKADFAQDNADKQRDEVRQKQQEAKNLPKP---ADTSSPKEDKQVAE-----NQK 280 Query: 101 PESQETQQQVINKTTTSQTDAEKTPNEKRQ 130 E ++ Q ++ + + + +Q Sbjct: 281 REIEKAQIEIKKNDEEALKAKDHKAFDLKQ 310 Score = 26.5 bits (58), Expect = 3.5 Identities = 16/67 (23%), Positives = 28/67 (41%) Query: 23 QADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKK 82 Q P P T + + + E ++ EKA +K E+A +A A + + K Sbjct: 255 QEAKNLPKPADTSSPKEDKQVAENQKREIEKAQIEIKKNDEEALKAKDHKAFDLKQESKA 314 Query: 83 KPKENQE 89 KE ++ Sbjct: 315 SEKEAED 321 >gnl|CDD|34937 COG5373, COG5373, Predicted membrane protein [Function unknown]. Length = 931 Score = 27.6 bits (61), Expect = 1.8 Identities = 15/54 (27%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Query: 24 ADPVAPPPPQ-TLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKI 76 A P PPP A+ G+A E +A A + + AA A I Sbjct: 73 ASPEVPPPVPPAPAQEGEAPAAEQPSAVPAPSAAPAPAEPVEPSLAANPFAAAI 126 >gnl|CDD|37551 KOG2340, KOG2340, KOG2340, Uncharacterized conserved protein [Function unknown]. Length = 698 Score = 27.3 bits (60), Expect = 1.8 Identities = 24/118 (20%), Positives = 45/118 (38%), Gaps = 7/118 (5%) Query: 37 ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA 96 E K +D+ + + EK E RKA E A + E D+K+ E + E+P Sbjct: 55 EGKKEKVDDKSDHSEEK--ERRRKAIESVNNAPAEVGE-----DEKENTEEDDQLEIPKR 107 Query: 97 ANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKIAE 154 ES + + +I K ++++ + + + I + T +K Sbjct: 108 KLKNHESTDDDETLIEKKNDNESEDPFWSHFDDELGSKHIADLIARTKTTVKLEKSIL 165 >gnl|CDD|35434 KOG0213, KOG0213, KOG0213, Splicing factor 3b, subunit 1 [RNA processing and modification]. Length = 1172 Score = 27.3 bits (60), Expect = 2.0 Identities = 26/143 (18%), Positives = 51/143 (35%), Gaps = 7/143 (4%) Query: 12 SLLSTTMASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKK 71 SLL+ + DP+A +T+A+R DE ++ ++ R A + Sbjct: 74 SLLNEVARIEEEYDPMAEKRTKTIADRE----DEYHKRRRDRQISPDRVDAFADKTPDGR 129 Query: 72 AAEKII---HKDKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEK 128 ++ +K++ + +E+ E SQ ++ N T ++ T +E Sbjct: 130 TYTDVMREQMLEKEEREVRRELAEKAKEGEEHSTSQPKKRLEANNTASAATPRRNRWDET 189 Query: 129 RQGTTDGINNQSNATNDPSSKDK 151 G T + D K Sbjct: 190 PPGVTPVATRMEDKGEDTPRSTK 212 >gnl|CDD|30678 COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones]. Length = 291 Score = 27.4 bits (60), Expect = 2.1 Identities = 16/65 (24%), Positives = 23/65 (35%) Query: 36 AERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95 +R + L E +AA AE +AA AEA +A + + E P Sbjct: 188 DKRAEILEAEGEAQAAILRAEGEAEAAIILAEAEAEAEVIARAEADAAKIIAAALREAPA 247 Query: 96 AANIE 100 A Sbjct: 248 APQAL 252 >gnl|CDD|29417 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl carrier protein (ACP) with acyl-ACP. KASIII initiates this process by specifically using acetyl-CoA over acyl-CoA.. Length = 320 Score = 27.1 bits (60), Expect = 2.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 52 EKAAEAARKAAEQAAEAAKKAAEKI 76 E ++ A +AA++A E A A+ I Sbjct: 48 ETTSDLAVEAAKKALEDAGIDADDI 72 >gnl|CDD|147333 pfam05103, DivIVA, DivIVA protein. The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate mini-cells. Inactivation of divIVA produces a mini-cell phenotype, whereas overproduction of DivIVA results in a filamentation phenotype. These proteins appear to contain coiled-coils. Length = 131 Score = 27.2 bits (61), Expect = 2.3 Identities = 12/41 (29%), Positives = 23/41 (56%) Query: 46 ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86 Q+ AE+ A+K AE + A+ AE+I++ ++ K+ Sbjct: 71 VAQETAEEVKANAQKEAELIIKEAEAKAERIVNDANEEAKK 111 >gnl|CDD|173868 cd08503, PBP2_NikA_DppA_OppA_like_17, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 460 Score = 26.8 bits (60), Expect = 2.6 Identities = 24/61 (39%), Positives = 28/61 (45%), Gaps = 18/61 (29%) Query: 26 PVAPPPPQTLA--------ERGKALLDEA----------TQKAAEKAAEAARKAAEQAAE 67 PVAP PP ++ KALL EA T AA A +AA AEQAA+ Sbjct: 289 PVAPIPPYYADLPQREYDPDKAKALLAEAGLPDLEVELVTSDAAPGAVDAAVLFAEQAAQ 348 Query: 68 A 68 A Sbjct: 349 A 349 >gnl|CDD|144933 pfam01523, PmbA_TldD, Putative modulator of DNA gyrase. tldD and pmbA were found to suppress mutations in letD and inhibitor of DNA gyrase. Therefore it has been hypothesized that the TldD and PmbA proteins modulate the activity of DNA gyrase. It has also been suggested that PmbA may be involved in secretion. Length = 289 Score = 26.5 bits (59), Expect = 3.5 Identities = 14/45 (31%), Positives = 19/45 (42%) Query: 56 EAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAANIE 100 EA KA E+A AK + E P V+E P ++E Sbjct: 54 EALEKAVERALALAKLSPEDPAGLPDPSPLPPVPVDEDPADLSLE 98 Score = 25.7 bits (57), Expect = 5.7 Identities = 11/46 (23%), Positives = 20/46 (43%) Query: 44 DEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQE 89 +EA +KA E+A A+ + E A + + D+ + E Sbjct: 53 EEALEKAVERALALAKLSPEDPAGLPDPSPLPPVPVDEDPADLSLE 98 >gnl|CDD|35385 KOG0163, KOG0163, KOG0163, Myosin class VI heavy chain [Cytoskeleton]. Length = 1259 Score = 26.5 bits (58), Expect = 3.6 Identities = 23/116 (19%), Positives = 42/116 (36%), Gaps = 5/116 (4%) Query: 33 QTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNE 92 Q LAE + + ++ E E +K A+ E +KA E+ + ++ +E + E Sbjct: 930 QELAEAERKRREAEEKRRRE---EEEKKRAKAEMETKRKAEEE--QRKAQEEEERRLALE 984 Query: 93 VPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSS 148 + E E + +Q + + A + N D ND S Sbjct: 985 LQEQLAKEAEEEAKRQNQLEQERRDHELALRLANSDGGQVEDSPPVIRALVNDASP 1040 >gnl|CDD|34036 COG4314, NosL, Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]. Length = 176 Score = 26.1 bits (57), Expect = 4.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Query: 1 MKRLKYQIILLSLLSTTMASCGQADPVAPPPPQTLAER 38 MKR I+ ++ L A C QA+ APP P+ + +R Sbjct: 1 MKRTLLAILAVTALL---AGCRQAEDGAPPLPRQITDR 35 >gnl|CDD|145732 pfam02734, Dak2, DAK2 domain. This domain is the predicted phosphatase domain of the dihydroxyacetone kinase family. Length = 175 Score = 26.4 bits (59), Expect = 4.1 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 11/54 (20%) Query: 33 QTLAERGKA------LLD--EATQKAAEKAAEA---ARKAAEQAAEAAKKAAEK 75 + + RGKA +LD +A E AAEA +A E A +AA+K AE Sbjct: 84 EAIQARGKAKPGDKTMLDVLRPAAEALEAAAEAGKDLAEALEAAVKAAEKGAES 137 >gnl|CDD|32267 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]. Length = 286 Score = 26.3 bits (58), Expect = 4.2 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Query: 33 QTLAERGKALL--DEATQKAAEKAAEAARKAAEQAAEAAKKA 72 L + G + + +KAAE A A A AEAA +A Sbjct: 17 ANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEA 58 >gnl|CDD|34211 COG4573, GatZ, Predicted tagatose 6-phosphate kinase [Carbohydrate transport and metabolism]. Length = 426 Score = 26.1 bits (57), Expect = 4.9 Identities = 13/38 (34%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Query: 19 ASCGQADPVAPPPPQTLAERGKALLDEATQKAAEKAAE 56 AS A P +T+AER L AE AA Sbjct: 128 ASMSCAGDPIPLDDETVAERAARLA-----AVAEAAAT 160 >gnl|CDD|32431 COG2250, COG2250, Uncharacterized conserved protein related to C-terminal domain of eukaryotic chaperone, SACSIN [Function unknown]. Length = 132 Score = 26.1 bits (57), Expect = 5.0 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Query: 37 ERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86 R + L A + + A A+QA E A KA +I + PK Sbjct: 11 RRAERDLKLAKRDLELGDYDLACFHAQQAVELALKAL--LIRLGGEPPKT 58 >gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde. Length = 482 Score = 25.7 bits (57), Expect = 5.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Query: 41 ALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEK 75 A + E T + A++A AAR+A + A E+ Sbjct: 27 ATVPEGTAEDAKRAIAAARRAFDSGEWPHLPAQER 61 >gnl|CDD|145614 pfam02569, Pantoate_ligase, Pantoate-beta-alanine ligase. Pantoate-beta-alanine ligase, also know as pantothenate synthase, (EC:6.3.2.1) catalyses the formation of pantothenate from pantoate and alanine. Length = 280 Score = 25.8 bits (57), Expect = 6.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 46 ATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK 79 Q+ A A KAA A +A ++ AE+II Sbjct: 194 PEQRKIALALYKALKAAANAIQAGERDAEEIIDA 227 >gnl|CDD|36144 KOG0926, KOG0926, KOG0926, DEAH-box RNA helicase [RNA processing and modification, Translation, ribosomal structure and biogenesis]. Length = 1172 Score = 25.8 bits (56), Expect = 6.0 Identities = 26/144 (18%), Positives = 49/144 (34%), Gaps = 14/144 (9%) Query: 29 PPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHK--------- 79 PP K D K E E ++K+ ++ + K E + K Sbjct: 16 PPREDENKGEVKINPDGMNAKILENNNEESKKSRKRKLNSLVKEKECKLSKKKKKKLDAD 75 Query: 80 -DKKKPKENQEVNEVPVAANIEPESQETQQQVINKTTTSQTDAEKTPNEKRQG----TTD 134 +KK KE + +A + S + +V+ K+ T ++ ++ G T+ Sbjct: 76 IEKKLKKEERAELLAKLAESQIDTSLLSSSKVLGKSATKLEKLKEALQLEKAGVETETSA 135 Query: 135 GINNQSNATNDPSSKDKIAENTKE 158 +Q + D T+E Sbjct: 136 ESTSQDDNPEDAIKSSMEEPETEE 159 >gnl|CDD|153388 cd07951, ED_3B_N_AMMECR1, The N-terminal domain, an extradiol dioxygenase class III subunit B-like domain, of unknown proteins containing a C-terminal AMMECR1 domain. This subfamily is composed of uncharacterized proteins containing an N-terminal domain with similarity to the catalytic B subunit of class III extradiol dioxygenases and a C-terminal AMMECR1-like domain. This model represents the N-terminal domain. Class III extradiol dioxygenases use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon, however, proteins in this subfamily do not contain a potential metal binding site and may not exhibit class III extradiol dioxygenase-like activity. The AMMECR1 protein was proposed to be a regulatory factor that is potentially involved in the development of AMME contiguous gene deletion syndrome. Length = 256 Score = 25.7 bits (57), Expect = 6.5 Identities = 9/30 (30%), Positives = 11/30 (36%), Gaps = 1/30 (3%) Query: 49 KAAEKAAEAARKAAEQAA-EAAKKAAEKII 77 E A R A E AA A + I+ Sbjct: 14 GGEEAEIAATRAACEAAARRLAAARPDTIV 43 >gnl|CDD|37283 KOG2072, KOG2072, KOG2072, Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis]. Length = 988 Score = 25.7 bits (56), Expect = 6.5 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Query: 37 ERGKALLDEATQKAAEKAAE-AARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPV 95 ER +A E ++ A + E A + E+AAE AK+ E+ +++ KE Q E Sbjct: 798 ERKQAYYREIEEERARREEEEANAERQEEAAERAKRTEEEREIENRVAKKEKQRQRETEE 857 Query: 96 AANIEPE 102 E Sbjct: 858 RERRINE 864 >gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA. Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), RocA: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. The proline catabolic enzymes, proline dehydrogenase and Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), catalyze the two-step oxidation of proline to glutamate; P5CDH catalyzes the oxidation of glutamate semialdehyde, utilizing NAD+ as the electron acceptor. In some bacteria, the two enzymes are fused into the bifunctional flavoenzyme, proline utilization A (PutA). In this CD, monofunctional enzyme sequences such as seen in the Bacillus subtilis RocA P5CDH are also present. These enzymes play important roles in cellular redox control, superoxide generation, and apoptosis. Length = 512 Score = 25.6 bits (57), Expect = 6.6 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 8/39 (20%) Query: 46 ATQKAAEKAAEAARKA--------AEQAAEAAKKAAEKI 76 AT++ AE A +AAR A E+ A +AA + Sbjct: 66 ATKEEAEAAVQAARAAFPTWRRTPPEERARLLLRAAALL 104 >gnl|CDD|37633 KOG2422, KOG2422, KOG2422, Uncharacterized conserved protein [Function unknown]. Length = 665 Score = 25.4 bits (55), Expect = 6.6 Identities = 21/125 (16%), Positives = 50/125 (40%), Gaps = 4/125 (3%) Query: 39 GKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVAAN 98 + L + Q++ + A +++ E + + E I++ K+ ++NE A Sbjct: 6 LRRLRKDQRQESLLSLSNANDMESDEDTEESGQKRENIVNMFNNLRKDGGQMNEEDEEAA 65 Query: 99 IEPESQET---QQQVINKTTTSQTDAEKTPNEKRQGTTDGINNQSNATNDPSSKDKI-AE 154 I E E Q+ I + S + +K ++++ + ++ ++D + Sbjct: 66 IAEERDEPSVGQESRITLASKSSKNKKKKKKKRKKKKSTAEVDKDEGSDDEQKLAILKYG 125 Query: 155 NTKED 159 TK D Sbjct: 126 KTKND 130 >gnl|CDD|31386 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair]. Length = 753 Score = 25.3 bits (55), Expect = 7.5 Identities = 9/26 (34%), Positives = 10/26 (38%) Query: 58 ARKAAEQAAEAAKKAAEKIIHKDKKK 83 A AE AK A + KKK Sbjct: 559 AHMGLPVPAEEAKVEAVDEVKFLKKK 584 >gnl|CDD|37249 KOG2038, KOG2038, KOG2038, CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis, Transcription]. Length = 988 Score = 25.4 bits (55), Expect = 7.6 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Query: 60 KAAEQAAEAAKKAAEKIIHKDKKKPKENQEVNEVPVA----ANIEPESQETQQQVINKTT 115 K +Q + AKK K + + K +EN+ ++ +A AN + + +T + Sbjct: 49 KLKKQPMKLAKKDKPKQPEEKEGKAQENKLKEDLKIAKKIMANFDSGAVQTNNKKQAANL 108 Query: 116 TSQTDAEKTPNEKR 129 S+ E N+K+ Sbjct: 109 ASKPVDESPGNKKK 122 >gnl|CDD|31216 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion]. Length = 472 Score = 25.3 bits (55), Expect = 7.8 Identities = 10/57 (17%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Query: 25 DPVAPPPPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKII-HKD 80 +P T+ +D A A +R +AE+ A ++ A+ + + Sbjct: 20 NPATGEVIATVPAATAEDVDAAVAAARAAFEAWSRLSAEERAAILRRIADLLEARAE 76 >gnl|CDD|153369 cd07685, F-BAR_Fes, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase. F-BAR domains are dimerization modules that bind and bend membranes and are found in proteins involved in membrane dynamics and actin reorganization. Fes (feline sarcoma), also called Fps (Fujinami poultry sarcoma), is a cytoplasmic (or nonreceptor) tyrosine kinase whose gene was first isolated from tumor-causing retroviruses. It is expressed in myeloid, vascular endothelial, epithelial, and neuronal cells, and plays important roles in cell growth and differentiation, angiogenesis, inflammation and immunity, and cytoskeletal regulation. Fes kinase has also been implicated as a tumor suppressor in colorectal cancer. It contains an N-terminal F-BAR domain, an SH2 domain, and a C-terminal catalytic kinase domain. F-BAR domains form banana-shaped dimers with a positively-charged concave surface that binds to negatively-charged lipid membranes. They can induce membrane deformation in the form of long tubules. The F-BAR domain of Fes is critical in its role in microtubule nucleation and bundling. Length = 237 Score = 24.9 bits (54), Expect = 9.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Query: 47 TQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKE 86 TQ+ EK R A+ +A+A +K E KD+ K KE Sbjct: 129 TQQDIEKLKSQYRSLAKDSAQAKRKYQEASKDKDRDKAKE 168 >gnl|CDD|29677 cd01915, CODH, Carbon monoxide dehydrogenase (CODH) is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA, respectively. CODH has two types of metal clusters, a cubane [Fe4-S4] center (B-cluster) similar to that of hybrid cluster protein (HCP) and a Ni-Fe-S center (C-cluster) where carbon monoxide oxidation occurs. Bifunctional CODH forms a heterotetramer with acetyl-CoA synthase (ACS) consisting of two CODH and two ACS subunits while monofunctional CODH forms a homodimer. Bifunctional CODH reduces carbon dioxide to carbon monoxide and ACS then synthesizes acetyl-CoA from carbon monoxide, CoA, and a methyl group donated by another protein (CoFeSP), while monofunctional CODH oxidizes carbon monoxide to carbon dioxide. CODH and ACS each have a metal cluster referred to as the C- and A-clusters, respectively.. Length = 613 Score = 25.2 bits (55), Expect = 9.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Query: 52 EKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPK 85 E+A E+A++ A EA K+ + ++ + K K Sbjct: 362 EEADESAKEIIRMAIEAFKRRKKSKVYIPQHKSK 395 >gnl|CDD|38799 KOG3592, KOG3592, KOG3592, Microtubule-associated proteins [Cytoskeleton]. Length = 934 Score = 25.1 bits (54), Expect = 9.6 Identities = 17/75 (22%), Positives = 26/75 (34%) Query: 31 PPQTLAERGKALLDEATQKAAEKAAEAARKAAEQAAEAAKKAAEKIIHKDKKKPKENQEV 90 P T K + AEK ++ A+ A K A K K + K + V Sbjct: 331 EPATRTAVPKKAPKPSKAAVAEKQPTEVKRPAKSAPALKKGAPAKPEDKKAEAIKPKKAV 390 Query: 91 NEVPVAANIEPESQE 105 + A +PE + Sbjct: 391 GKKQDGAPSKPEVKV 405 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.299 0.115 0.295 Gapped Lambda K H 0.267 0.0533 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,576,410 Number of extensions: 68178 Number of successful extensions: 776 Number of sequences better than 10.0: 1 Number of HSP's gapped: 672 Number of HSP's successfully gapped: 233 Length of query: 159 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 73 Effective length of database: 4,405,363 Effective search space: 321591499 Effective search space used: 321591499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 17 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.7 bits) S2: 53 (24.6 bits)