HHsearch alignment for GI: 254780911 and conserved domain: COG0223

>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis].
Probab=99.95  E-value=8.8e-26  Score=200.69  Aligned_cols=175  Identities=23%  Similarity=0.299  Sum_probs=150.4

Q ss_pred             CCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECCH------------HHHHHHHHCCCCEEECCCCCCCHHHHH
Q ss_conf             553899970886--798999986204674158999997734------------667778860997474168733527767
Q gi|254780911|r   83 ATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNHT------------THKKLVENYQLPFYYLPMTEQNKIESE  148 (288)
Q Consensus        83 ~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~~------------d~~~lA~~~gIP~~~i~~~~~~k~~~e  148 (288)
T Consensus         1 ~mkivF~GTp~fa~~~L~~L~~---~~---~eivaV~Tqpdkp~gR~~~l~~spVk~~A~~~~ipv~-qP~~-l~~~---   69 (307)
T COG0223           1 MMRIVFFGTPEFAVPSLEALIE---AG---HEIVAVVTQPDKPAGRGKKLTPSPVKRLALELGIPVF-QPEK-LNDP---   69 (307)
T ss_pred             CCEEEEECCCHHHHHHHHHHHH---CC---CCEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEE-CCCC-CCCH---
T ss_conf             9179997674454999999982---89---8048999489976678785888838999997499556-6444-7868---


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCE
Q ss_conf             89999973339409998276754887786327784796133667678999958999742683762257753055688834
Q gi|254780911|r  149 QKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI  228 (288)
Q Consensus       149 ~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpI  228 (288)
T Consensus        70 -e~~~~l~~l~~D~ivvvayG~ilp~~iL~~~~~G~iNvH~SLLPr~RGaAPIq~aI~~Gd~~TGvTim~M~~~lDaG~I  148 (307)
T COG0223          70 -EFLEELAALDPDLIVVVAYGQILPKEILDLPPYGCINLHPSLLPRYRGAAPIQWAILNGDTETGVTIMQMDEGLDAGDI  148 (307)
T ss_pred             -HHHHHHHCCCCCEEEEEEHHHHCCHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCEEEEECCCCCCCCCE
T ss_conf             -9999986039999999742223779998057677498667547111384478999975986012498882245787664


Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEE
Q ss_conf             44446651888899999999999999999999999876917
Q gi|254780911|r  229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRV  269 (288)
Q Consensus       229 I~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv  269 (288)
T Consensus       149 l~q~~~~I~~~dta~~L~~kLa~~ga~lL~~~L~~i~~g~~  189 (307)
T COG0223         149 LAQREVPIEPDDTAGSLHDKLAELGAELLLETLPQLEAGTL  189 (307)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             02677045774258899999999999999999999965998