HHsearch alignment for GI: 254780911 and conserved domain: COG0299

>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=464.93  Aligned_cols=195  Identities=30%  Similarity=0.441  Sum_probs=190.0

Q ss_pred             CCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCC
Q ss_conf             5389997088679899998620467415899999773466777--886099747416873-3527767899999733394
Q gi|254780911|r   84 TKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNV  160 (288)
Q Consensus        84 ~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~  160 (288)
T Consensus         1 ~ki~VlaSG~GSNlqaiida~~~~~~~a~i~~Visd~~~A~~lerA~~~gIpt~~~~~k~~~~r~~~d~~l~~~l~~~~~   80 (200)
T COG0299           1 KKIAVLASGNGSNLQAIIDAIKGGKLDAEIVAVISDKADAYALERAAKAGIPTVVLDRKEFPSREAFDRALVEALDEYGP   80 (200)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             94999994796559999998764898817999995797778999999849988974445678778999999999985299


Q ss_pred             EEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCC
Q ss_conf             09998276754887786327784796133667678999958999742683762257753055688834444466518888
Q gi|254780911|r  161 ELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ  240 (288)
Q Consensus       161 DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~d  240 (288)
T Consensus        81 dlvvLAGyMrIL~~~fl~~~~grIlNIHPSLLP~f~G~h~~~~A~~aG~k~sG~TVH~V~e~vD~GpII~Q~~Vpv~~~D  160 (200)
T COG0299          81 DLVVLAGYMRILGPEFLSRFEGRILNIHPSLLPAFPGLHAHEQALEAGVKVSGCTVHFVTEGVDTGPIIAQAAVPVLPGD  160 (200)
T ss_pred             CEEEECCHHHHCCHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHHHCCCCCCCCEEEEECCCCCCCCEEEEEEEEECCCC
T ss_conf             99998664777599999973265174175313589994599999984997347579997567778876898863016999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEE
Q ss_conf             99999999999999999999999876917886885798
Q gi|254780911|r  241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV  278 (288)
Q Consensus       241 t~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvv  278 (288)
T Consensus       161 t~etl~~RV~~~Eh~lyp~~v~~~~~g~~~~~~~~~~~  198 (200)
T COG0299         161 TAETLEARVLEQEHRLYPLAVKLLAEGRLKIEGGRVIL  198 (200)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCEEEE
T ss_conf             99999999999999999999999980742431763781