HHsearch alignment for GI: 254780911 and conserved domain: COG0788

>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism].
Probab=100.00  E-value=0  Score=750.31  Aligned_cols=280  Identities=48%  Similarity=0.907  Sum_probs=275.1

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC---CHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             9649999985998766888999998579818973444324368899999997288---5277798889874002320201
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~---~~~~l~~~f~~ia~~~~m~~~i   77 (288)
T Consensus         5 ~~~~~Ltv~Cpd~~GiVaais~~l~~~g~NI~~~~qf~D~~~g~FFmR~~f~~~~~~~~~~~l~~~f~~~a~~f~m~~~~   84 (287)
T COG0788           5 PDTFILTVSCPDQPGIVAAISGFLAEHGCNIVDSDQFDDPETGRFFMRVEFEGEGGPLDREALRAAFAPLAEEFGMDWRL   84 (287)
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCEEEE
T ss_conf             65249999669988709999999998498664421256644780799999863888654999998899888862763888


Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
T Consensus        85 ~~~~~~~ri~i~VSK~~HCL~DLL~r~~~g~L~~eI~~VIsNH~dl~~~v~~~~IPfhhip~~~~~k~e~E~~~~~ll~~  164 (287)
T COG0788          85 HDAAQRKRIAILVSKEDHCLGDLLYRWRIGELPAEIVAVISNHDDLRPLVERFDIPFHHIPVTKENKAEAEARLLELLEE  164 (287)
T ss_pred             ECCCCCCEEEEEEECHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             12355755999981457779999999761886872589974877889999974998665467877534789999999998


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
T Consensus       165 ~~~DlvVLARYMqILSpd~~~~~~g~iINIHHSFLPaF~GA~PY~QA~eRGVKlIGATAHYVT~dLDeGPIIeQdv~rV~  244 (287)
T COG0788         165 YGADLVVLARYMQILSPDFVERFPGKIINIHHSFLPAFIGANPYHQAYERGVKLIGATAHYVTADLDEGPIIEQDVIRVD  244 (287)
T ss_pred             HCCCEEEEHHHHHHCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCEEEEEEEEECCCCCCCCCCEEEEEEEEC
T ss_conf             59987820466765789999865697788514445666898767999863771863210002677777886365446408


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
T Consensus       245 H~~s~ed~~~~GrDvE~~VLaRAv~~hle~Rv~v~gnkTVVf~  287 (287)
T COG0788         245 HAYSVEDLVRAGRDVEKLVLARAVKAHLEDRVFVNGNKTVVFP  287 (287)
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHHHHHHCCEEEEECCEEEECC
T ss_conf             6589999998387689999999999975242898088578359