HHsearch alignment for GI: 254780911 and conserved domain: COG2716

>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism].
Probab=97.96  E-value=0.0002  Score=51.67  Aligned_cols=157  Identities=16%  Similarity=0.172  Sum_probs=97.3

Q ss_pred             CCE-EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCC
Q ss_conf             964-9999985998766888999998579818973444324368899999997288527779888987400232020124
Q gi|254780911|r    1 MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRN   79 (288)
Q Consensus         1 M~~-~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~   79 (288)
T Consensus         2 ~~~~LvItavg~d~pgl~~~lar~v~s~Gcn~leSRla~~g~~~a~i~lisgs~d-av~~le~~l~~l~~~~~L~v~m~r   80 (176)
T COG2716           2 MEHYLVITAVGADRPGLVNTLARAVASSGCNWLESRLAMLGEEFAGIMLISGSWD-AVTLLEATLPLLGAELDLLVVMKR   80 (176)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHCCEEEEEEEEECHH-HHHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             7638999996279827999999999855972059899875221348999950877-899999986412655774999960


Q ss_pred             CCCCC------CEEEEECCCCCC-----HHHHHHHHCCCCCEEEEEEEEECCHHHHH-HHHHCCCC-EEECCCCCCCHHH
Q ss_conf             45655------389997088679-----89999862046741589999977346677-78860997-4741687335277
Q gi|254780911|r   80 TKEAT------KTLILVSQPDHC-----LNDLLYRWNIGTLALNIVGVVSNHTTHKK-LVENYQLP-FYYLPMTEQNKIE  146 (288)
Q Consensus        80 ~~~~~------riailvSg~gsn-----L~~Ll~~~~~g~L~~eI~~VISN~~d~~~-lA~~~gIP-~~~i~~~~~~k~~  146 (288)
T Consensus        81 t~~~~~~~~~~~v~v~v~a~DrpgIv~~~T~lf~~~~-----inie~L~~~~~~a~~s~~~lfha~it~~lPa~~-~i~~  154 (176)
T COG2716          81 TGAHPTPANPAPVWVYVDANDRPGIVEEFTALFDGHG-----INIENLVSRTYPAPGSSAPLFHAQITARLPANL-SISA  154 (176)
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHCC-----CCHHHCEEEEEECCCCCCCCEEHHHHCCCCCCC-CHHH
T ss_conf             6876666788319999971688358999999986469-----865550455665799985414211212588767-5899


Q ss_pred             HHHHHHHHHHHCCCEEEE
Q ss_conf             678999997333940999
Q gi|254780911|r  147 SEQKLINIIEKNNVELMI  164 (288)
Q Consensus       147 ~e~~il~~l~~~~~Dliv  164 (288)
T Consensus       155 l~~~f~al~~~L~v~~~i  172 (176)
T COG2716         155 LRDAFEALCDELNVDGSI  172 (176)
T ss_pred             HHHHHHHHHHHHCCEEEE
T ss_conf             999999998753211560