HHsearch alignment for GI: 254780911 and conserved domain: PRK00005

>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed.
Probab=99.96  E-value=4.4e-27  Score=209.73  Aligned_cols=175  Identities=21%  Similarity=0.280  Sum_probs=149.5

Q ss_pred             CCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECC------------HHHHHHHHHCCCCEEECCCCCCCHHHHHH
Q ss_conf             53899970886--79899998620467415899999773------------46677788609974741687335277678
Q gi|254780911|r   84 TKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNH------------TTHKKLVENYQLPFYYLPMTEQNKIESEQ  149 (288)
Q Consensus        84 ~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~------------~d~~~lA~~~gIP~~~i~~~~~~k~~~e~  149 (288)
T Consensus         1 mkI~f~Gt~~fs~~~L~~L~~------~~~~i~~Vvt~pdk~~gR~~k~~~~~v~~~a~~~~i~~~~-p~-~~~----~~   68 (309)
T PRK00005          1 MRIVFMGTPEFAVPSLKALLE------SGHEVVAVVTQPDRPAGRGKKLTPSPVKQLALEHGIPVLQ-PE-SLR----DP   68 (309)
T ss_pred             CEEEEECCCHHHHHHHHHHHH------CCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEEE-CC-CCC----CH
T ss_conf             989998898899999999997------8994799992999866899979899899999986993883-57-799----99


Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEE
Q ss_conf             99999733394099982767548877863277847961336676789999589997426837622577530556888344
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPII  229 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII  229 (288)
T Consensus        69 ~~~~~l~~~~~Dl~vv~~~g~iip~~~l~~~~~g~iN~H~SlLP~yRG~aPi~~ailnge~~tGvt~~~~~~~~D~G~Il  148 (309)
T PRK00005         69 EFLAELAALNADVIVVVAYGQILPKAVLDIPRLGCINLHASLLPRWRGAAPIQRAIIAGDAETGVTIMQMDEGLDTGDML  148 (309)
T ss_pred             HHHHHHHHCCCCEEEEEEHHHHCCHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEEEECCCCCEEEE
T ss_conf             99999984199999997523433499982788785983154475656757578998769962205999974367850367


Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             44466518888999999999999999999999998769178
Q gi|254780911|r  230 EQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       230 ~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
T Consensus       149 ~q~~~~I~~~dt~~~L~~kL~~~~~~~l~~~l~~i~~~~~~  189 (309)
T PRK00005        149 LKAEVPITPDDTAGELHDKLAELGADLLVKTLDGLEDGTLT  189 (309)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             89998327889799999999999999999999999869997