HHsearch alignment for GI: 254780911 and conserved domain: PRK08198

>PRK08198 threonine dehydratase; Provisional.
Probab=95.91  E-value=0.1  Score=32.88  Aligned_cols=120  Identities=14%  Similarity=0.207  Sum_probs=52.7

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEE---------------------EEEECCHHH----HHHHHHCCCCEE
Q ss_conf             5655389997088679899998620467415899---------------------999773466----777886099747
Q gi|254780911|r   81 KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV---------------------GVVSNHTTH----KKLVENYQLPFY  135 (288)
Q Consensus        81 ~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~---------------------~VISN~~d~----~~lA~~~gIP~~  135 (288)
T Consensus        69 e~~~~GVVaaSaGNHa-qgvA~aa~~~gi~a~IvmP~~ap~~Ki~~~r~~GA~Vil~G~~~~ea~~~A~~~a~e~g~~~i  147 (406)
T PRK08198         69 EERARGVVAASAGNHA-QGVAYAASLLGIKATIVMPETAPLSKVQATKSYGAEVVLHGDVYDEALAAALELAEETGATFV  147 (406)
T ss_pred             HHHCCCEEEECCCHHH-HHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             6606857997787699-999999998199889993677889999999847988999699868999999999974386753


Q ss_pred             ECCCCCCC-HHHH---HHHHHHHHHHCCCEEEEEC-CCCCCCC--HHHHHHC--CCCEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             41687335-2776---7899999733394099982-7675488--7786327--78479613366767899995899974
Q gi|254780911|r  136 YLPMTEQN-KIES---EQKLINIIEKNNVELMILA-RYMQILS--DHLCHKM--TGRIINIHHSFLPSFKGANPYKQAYE  206 (288)
Q Consensus       136 ~i~~~~~~-k~~~---e~~il~~l~~~~~DlivLA-gymril~--~~~~~~~--~~~iiNiHpslLP~f~G~~~y~~A~~  206 (288)
T Consensus       148 h-pfdd~~viaGqGTiglEileq~p--~~D~vvvpvGGGGLiaGia~a~K~~~P~ikViGVEpe------~a~~~~~Sl~  218 (406)
T PRK08198        148 H-PFDDPDVIAGQGTIGLEILEDLP--DVDTVVVPIGGGGLISGVATAVKALRPNVRVIGVQAE------GAPAMPLSLA  218 (406)
T ss_pred             C-CCCCHHHHCCHHHHHHHHHHHCC--CCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEEEC------CCHHHHHHHH
T ss_conf             8-98995466010149999998677--7787886378626889999999986899708999657------8768999998


Q ss_pred             CCCC
Q ss_conf             2683
Q gi|254780911|r  207 YGVK  210 (288)
Q Consensus       207 ~Gvk  210 (288)
T Consensus       219 ag~~  222 (406)
T PRK08198        219 AGRP  222 (406)
T ss_pred             CCCC
T ss_conf             4995