HHsearch alignment for GI: 254780911 and conserved domain: PRK11589

>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional.
Probab=98.62  E-value=1.9e-07  Score=72.85  Aligned_cols=153  Identities=18%  Similarity=0.195  Sum_probs=93.4

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             99999859987668889999985798189734443243688999999972885277798889874002320201244565
Q gi|254780911|r    4 YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEA   83 (288)
Q Consensus         4 ~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~~~~   83 (288)
T Consensus         9 lvit~~G~DrpGiv~~v~~~~~~~g~ni~dSrm~~lg~~f~~imlvSg~~~-ai~~lE~~Lp~~~~el~L~~~~~rt~~~   87 (183)
T PRK11589          9 LVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWN-AITLIESTLPLKGAELDLLIVMKRTTAR   87 (183)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCEEEEEEEECCCHH-HHHHHHHHCCHHCCCCCEEEEEECCCCC
T ss_conf             999997089873899999999976998726668874570699999408875-8899986160220557749999625666


Q ss_pred             ------CCEEEEECCCCC--CHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEE------CCCCCCCHHHHHH
Q ss_conf             ------538999708867--98999986204674158999997734667778860997474------1687335277678
Q gi|254780911|r   84 ------TKTLILVSQPDH--CLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYY------LPMTEQNKIESEQ  149 (288)
Q Consensus        84 ------~riailvSg~gs--nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~------i~~~~~~k~~~e~  149 (288)
T Consensus        88 ~~~~~~~~~~v~v~g~D~PGIV~~vt~~la~~~--InI~~L~T~t~~----A~~~~~~~f~~~~t~~iPa-~~~i~~L~~  160 (183)
T PRK11589         88 PRPAMPATVWVQVEVADSPHLIERFTALFDSHH--MNIAELVSRTQP----AEGERAAQLHIQITAHSPA-SQDAANIEQ  160 (183)
T ss_pred             CCCCCCCEEEEEEEECCCCCHHHHHHHHHHHCC--CCHHHHEEEEEC----CCCCCCCEEEEEEEECCCC-CCCHHHHHH
T ss_conf             676778159999997898988999999999869--987652221144----9999973699999980799-899999999


Q ss_pred             HHHHHHHHCCCEEEE
Q ss_conf             999997333940999
Q gi|254780911|r  150 KLINIIEKNNVELMI  164 (288)
Q Consensus       150 ~il~~l~~~~~Dliv  164 (288)
T Consensus       161 ~f~~lc~eLnld~~i  175 (183)
T PRK11589        161 AFKALCTELNAQGSI  175 (183)
T ss_pred             HHHHHHHHHCCEEEE
T ss_conf             999999982983899