HHsearch alignment for GI: 254780911 and conserved domain: PRK11895

>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed.
Probab=93.26  E-value=0.83  Score=26.45  Aligned_cols=66  Identities=15%  Similarity=0.237  Sum_probs=46.4

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC---CHHHHHHHHHHHHCC
Q ss_conf             49999985998766888999998579818973444324368899999997288---527779888987400
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLFIADFQPIVQQ   70 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~---~~~~l~~~f~~ia~~   70 (288)
T Consensus         2 r~tisvlveN~~GvL~RisglFsrRg~NI~SL~v~~te~--~~iSR~Tiv~~g~~~~i~QI~kQL~KLidV   70 (161)
T PRK11895          2 RHTLSVLVENEPGVLSRVAGLFSRRGYNIESLTVAPTED--PGLSRITIVTSGDERVLEQITKQLNKLIDV   70 (161)
T ss_pred             CEEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEECCCC--CCCEEEEEEEECCHHHHHHHHHHHHCCCCE
T ss_conf             459999997786799999999850686546666502479--981599999968999999999999632140