HHsearch alignment for GI: 254780911 and conserved domain: cd01994

>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus.
Probab=92.09  E-value=1.2  Score=25.41  Aligned_cols=121  Identities=14%  Similarity=0.286  Sum_probs=65.1

Q ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHH-----------HHHHHHCCCCEEECCCCCCCHHHHHHH---
Q ss_conf             389997088679899998620467415899999773466-----------777886099747416873352776789---
Q gi|254780911|r   85 KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH-----------KKLVENYQLPFYYLPMTEQNKIESEQK---  150 (288)
Q Consensus        85 riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~-----------~~lA~~~gIP~~~i~~~~~~k~~~e~~---  150 (288)
T Consensus         1 Kv~~l~SGGKDS~lAl~~a~~~g~~v~~L~~~~~~~~~~~~~H~~~~~l~~~qAealgiPl~~~~~~~-~~~~~~~~l~~   79 (194)
T cd01994           1 KVVALISGGKDSCYALYRALEEGHEVVALLNLTPEEGSSMMYHTVNHELLELQAEAMGIPLIRIEISG-EEEDEVEDLKE   79 (194)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEECCCCCEEECCCCCHHHHHHHHHHCCCCEEEEECCC-CCCHHHHHHHH
T ss_conf             98999778599999999999869925999999639988052505578999999998599669996689-87179999999


Q ss_pred             HHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCC--EEEECCCCCCCCCCCCHH---HHHHHCCCCE
Q ss_conf             999973339409998276754887786327784--796133667678999958---9997426837
Q gi|254780911|r  151 LINIIEKNNVELMILARYMQILSDHLCHKMTGR--IINIHHSFLPSFKGANPY---KQAYEYGVKI  211 (288)
Q Consensus       151 il~~l~~~~~DlivLAgymril~~~~~~~~~~~--iiNiHpslLP~f~G~~~y---~~A~~~Gvk~  211 (288)
T Consensus        80 ~L~~~k~~gi~~vv~Gd---I~s~~qr~~~e~~c~~lgl~-~~~PLW-~~~~~~ll~e~i~~Gf~a  140 (194)
T cd01994          80 LLRKLKEEGVDAVVFGA---ILSEYQRTRVERVCERLGLE-PLAPLW-GRDQEELLREMIEAGFKA  140 (194)
T ss_pred             HHHHHHHCCCCEEEECC---CCCHHHHHHHHHHHHHCCCE-EECHHC-CCCHHHHHHHHHHCCCEE
T ss_conf             99999975995999996---33288999999999973988-870010-799999999999879909