HHsearch alignment for GI: 254780911 and conserved domain: cd02116

>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. Members of this CD belong to the superfamily of ACT regulatory domains. Pairs of ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain has been detected in a number of diverse proteins; some of these proteins are involved in amino acid and purine biosynthesis, phenylalanine hydroxylation, regulation of bacterial metabolism and transcription, and many remain to be characterized. ACT domain-containing enzymes involved in amino acid and purine synthesis are in many cases allosteric enzymes with complex regulation enforced by the binding of ligands. The ACT domain is commonly involved in the binding of a small regulatory molecule, such as the amino acids L-Ser and L-Phe in the case of D-3-phosphoglycerate dehydrogenase and the bifunctional chorismate mutase-p
Probab=97.07  E-value=0.0018  Score=45.01  Aligned_cols=56  Identities=18%  Similarity=0.239  Sum_probs=42.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECC--CCCEEEEEEEEECCCCHHHHHHH
Q ss_conf             99985998766888999998579818973444324--36889999999728852777988
Q gi|254780911|r    6 LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL--DTSKLFMRISFVFNTCMKLFIAD   63 (288)
Q Consensus         6 Lti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~--~~~~FFmRi~f~~~~~~~~l~~~   63 (288)
T Consensus         1 i~i~~~d~~g~l~~i~~~l~~~~~nI~~~~~~~~~~~~~~~~~~~v~~~~--~~~~~~~~   58 (60)
T cd02116           1 LTVSGPDRPGLLAKVLSVLAEAGINITSIEQRTSGDGGEADIFIVVDGDG--DLEKLLEA   58 (60)
T ss_pred             CEECCCCCCCHHHHHHHHHHHCCCCHHEEEEEECCCCCCEEEEEEECCCC--CHHHHHHH
T ss_conf             93377998866999999999869895306840368897178999953777--39999885