HHsearch results for GI: 254780911 and protein with PDBid: 2bln_A

>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A
Probab=99.97  E-value=2.5e-29  Score=223.88  Aligned_cols=175  Identities=17%  Similarity=0.264  Sum_probs=153.5

Q ss_pred             CCEEEEEC-CCC-CCHHHHHHHHCCCCCEEEEEEEEECCHH---------HHHHHHHCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             53899970-886-7989999862046741589999977346---------677788609974741687335277678999
Q gi|254780911|r   84 TKTLILVS-QPD-HCLNDLLYRWNIGTLALNIVGVVSNHTT---------HKKLVENYQLPFYYLPMTEQNKIESEQKLI  152 (288)
Q Consensus        84 ~riailvS-g~g-snL~~Ll~~~~~g~L~~eI~~VISN~~d---------~~~lA~~~gIP~~~i~~~~~~k~~~e~~il  152 (288)
                      ||++||.| ..| .||++|+.+      ..+|++|+++.+.         ...+|+++|||++...  +.+    +.++.
T Consensus         1 Mkiv~~~~~~~~~~~l~~L~~~------~~~i~~V~t~~~~~~~~~~~~~v~~~a~~~~ip~~~~~--~~~----~~~~~   68 (305)
T 2bln_A            1 MKTVVFAYHDMGCLGIEALLAA------GYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPD--NVN----HPLWV   68 (305)
T ss_dssp             CEEEEEECHHHHHHHHHHHHHT------TCEEEEEECCCC------CCCCHHHHHHHHTCCEECCS--CCC----SHHHH
T ss_pred             CEEEEECCCHHHHHHHHHHHHC------CCCEEEEEECCCCCCCCCCCCHHHHHHHHCCCCEECCC--CCC----CHHHH
T ss_conf             9599992778999999999978------99889999089999887898989999998699898459--899----89999


Q ss_pred             HHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEE
Q ss_conf             99733394099982767548877863277847961336676789999589997426837622577530556888344444
Q gi|254780911|r  153 NIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD  232 (288)
Q Consensus       153 ~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~  232 (288)
                      +.+++.++|+++.++|++|+++++++.++..++|+|||+||.|+|..|+.+|+.+|.+.+|+|+|++++++|+||||.|.
T Consensus        69 ~~l~~~~~dl~i~~~~~~ii~~~il~~~~~~~lN~HpslLP~yRG~~p~~wai~~g~~~~g~tih~~~~~~D~G~Ii~q~  148 (305)
T 2bln_A           69 ERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQL  148 (305)
T ss_dssp             HHHHHTCCSEEEEESCCSCCCHHHHTTCTTCEEEEESSCTTTTEESCHHHHHHHTTCSEEEEEEEECCSSTTCSCEEEEE
T ss_pred             HHHHHCCCCEEEEEHHHHHCCHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEEE
T ss_conf             99983299999986321240499997321032032234377467852899999779886575222310466788710450


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             66518888999999999999999999999998769178
Q gi|254780911|r  233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       233 ~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      .+++.++||.++|..+...+...++.+.++.+.++...
T Consensus       149 ~~~i~~~~~~~~l~~k~~~~~~~ll~~~l~~l~~~~~~  186 (305)
T 2bln_A          149 RIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNIL  186 (305)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             34554323277889999888888789999999759976