HHsearch results for GI: 254780911 and protein with PDBid: 2c82_A

>2c82_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870C, DOXP/MEP pathway, oxidoreductase, isoprene biosynthesis, metal-binding; 1.9A {Mycobacterium tuberculosis} PDB: 2jd1_A* 2jcv_A* 2jcz_A* 2jd2_A 2jcx_A* 2jcy_A 2jd0_A*
Probab=90.31  E-value=0.51  Score=26.45  Aligned_cols=155  Identities=13%  Similarity=0.177  Sum_probs=90.7

Q ss_pred             CCCCCCCEEEEECCC--CCCHHHHHHHHCCCCCEEEEEEEEECCHHHH---HHHHHCCCCEEECCCCCCCHHH-------
Q ss_conf             445655389997088--6798999986204674158999997734667---7788609974741687335277-------
Q gi|254780911|r   79 NTKEATKTLILVSQP--DHCLNDLLYRWNIGTLALNIVGVVSNHTTHK---KLVENYQLPFYYLPMTEQNKIE-------  146 (288)
Q Consensus        79 ~~~~~~riailvSg~--gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i~~~~~~k~~-------  146 (288)
                      -.+.|+|++||.|.+  |.+--+++.+..+   ..+|.++.+|+.+..   ..+.+++.++.++.... ....       
T Consensus         8 ~~~~kkkI~IlGsTGSIG~~tL~Vi~~~~~---~f~v~~lsa~~~n~~~L~~q~~~f~p~~v~i~d~~-~~~~~~~~~~~   83 (413)
T 2c82_A            8 RADGRLRVVVLGSTGSIGTQALQVIADNPD---RFEVVGLAAGGAHLDTLLRQRAQTGVTNIAVADEH-AAQRVGDIPYH   83 (413)
T ss_dssp             ---CCEEEEEESTTSHHHHHHHHHHHHCTT---TEEEEEEEECSSCHHHHHHHHHHHCCCCEEESCHH-HHHHHCCCSEE
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCC---CEEEEEEEECCCCHHHHHHHHHHHCCCEEEECCHH-HHHHHCCCEEC
T ss_conf             547997899989798999999999983946---60899999688419999999999699989987989-99883045313


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC--CC
Q ss_conf             6789999973339409998276754887786327784796133667678999958999742683762257753055--68
Q gi|254780911|r  147 SEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE--LD  224 (288)
Q Consensus       147 ~e~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~--lD  224 (288)
                      -+..+.+.+...++|++|.|                         +..|-|..|-..|++.|-++.     +.|-|  +=
T Consensus        84 g~~~l~~~~~~~~~D~vv~a-------------------------i~G~aGL~pt~~ai~~gk~ia-----LANKEslV~  133 (413)
T 2c82_A           84 GSDAATRLVEQTEADVVLNA-------------------------LVGALGLRPTLAALKTGARLA-----LANKESLVA  133 (413)
T ss_dssp             STTHHHHHHHHCCCSEEEEC-------------------------CCSGGGHHHHHHHHHTTCEEE-----ECCHHHHHT
T ss_pred             CHHHHHHHHHCCCCCEEEEE-------------------------CCCCCCHHHHHHHHHCCCCEE-----EECCCEEEE
T ss_conf             84789999715777899980-------------------------362121999999997699089-----843770998


Q ss_pred             CCCEEEEE-----EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             88344444-----665188889999999999999999999999987691788688579808886763
Q gi|254780911|r  225 AGPIIEQD-----VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       225 ~GpII~Q~-----~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                      +|++|...     ..||+              =||-.+-+.++-  +.+=.+   +.++.+|+-|-.
T Consensus       134 aG~li~~~~~k~~iiPvD--------------SEH~Ai~q~l~~--~~~~~v---~kI~lTASGGPF  181 (413)
T 2c82_A          134 GGSLVLRAARPGQIVPVD--------------SEHSALAQCLRG--GTPDEV---AKLVLTASGGPF  181 (413)
T ss_dssp             THHHHHHHCCTTCEEECS--------------HHHHHHHHHGGG--SCGGGE---EEEEEEECCCTT
T ss_pred             CCHHHHHHHHCCCCCCCC--------------CHHHHHHHHHHH--CCHHHE---EEEEEECCCCCH
T ss_conf             748899765305321368--------------048999998642--252220---078994588656