HHsearch results for GI: 254780911 and protein with PDBid: 2nyi_A

>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria}
Probab=99.71  E-value=5.4e-18  Score=144.82  Aligned_cols=184  Identities=10%  Similarity=0.030  Sum_probs=132.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEE----
Q ss_conf             9649999985998766888999998579818973444324368899999997288527779888987400232020----
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYS----   76 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~----   76 (288)
                      ++++++|+.|||||||+|+||++|+++|+||++++|++..+...+++++++..+. ...+++.+.....++.+.+.    
T Consensus         3 ~~~~vitv~g~DrpGlva~vt~~L~~~g~nI~ds~~~~~~~~~~~~~~v~~~~~~-~~~l~~~l~~~~~~l~~~~~~~~~   81 (195)
T 2nyi_A            3 TQSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLNAKD-GKLIQSALESALPGFQISTRRASS   81 (195)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEESSSS-SHHHHHHHHHHSTTCEEEEEECCC
T ss_pred             CEEEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCEEEEEEEECCCCC-HHHHHHHHHHHHHHHHEEEEECCC
T ss_conf             3499999992698878999999999879979985858824772899874013431-022577899987442043320454


Q ss_pred             CCCCCCCCCE-EEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEE----CCCCCCCHHHHHHHH
Q ss_conf             1244565538-99970886798999986204674158999997734667778860997474----168733527767899
Q gi|254780911|r   77 IRNTKEATKT-LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYY----LPMTEQNKIESEQKL  151 (288)
Q Consensus        77 i~~~~~~~ri-ailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~----i~~~~~~k~~~e~~i  151 (288)
                      ......+++. ...++-.|++...||+++ .+.|...-.-|.++|....+.+. .|.|+++    ++....++.+.++++
T Consensus        82 ~~~~~~~~~~~~~vv~v~~~DrpGLL~~i-t~~La~~~inI~~~~~~~~~~~~-~~~~~F~~~~~i~~p~~~~~~l~~~L  159 (195)
T 2nyi_A           82 VAERHVSPDTREYELYVEGPDSEGIVEAV-TAVLAKKGANIVELETETLPAPF-AGFTLFRMGSRVAFPFPLYQEVVTAL  159 (195)
T ss_dssp             C----CCTTEEEEEEEEEEECCTTHHHHH-HHHHHHTTCEEEEEEEEEEECSS-TTCEEEEEEEEEEEEGGGHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEEEEEECCCHHHHHHH-HHHHHHCCCEEEEEEEEEECCCC-CCCCCEEEEEEEECCCCCHHHHHHHH
T ss_conf             11113477741899999506887899999-99997669519980212661676-78852899999967967589999999


Q ss_pred             HHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEEC
Q ss_conf             9997333940999827675488778632778479613
Q gi|254780911|r  152 INIIEKNNVELMILARYMQILSDHLCHKMTGRIINIH  188 (288)
Q Consensus       152 l~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiH  188 (288)
                      .++.++.++|+- +-..++.-+.+=-+.+||++||+|
T Consensus       160 ~~l~~el~vdi~-v~~~~~~~~~~~~~~~~~~~~~~~  195 (195)
T 2nyi_A          160 SRVEEEFGVDID-LEEVVEGEDSEEDDDSPNSPVGRH  195 (195)
T ss_dssp             HHHHHHHTCEEE-EEECC-------------------
T ss_pred             HHHHHHHCCEEE-EEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             999999696899-998777788633445864312379