HHsearch results for GI: 254780911 and protein with PDBid: 3nrb_A

>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida}
Probab=100.00  E-value=0  Score=650.19  Aligned_cols=279  Identities=43%  Similarity=0.766  Sum_probs=271.4

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-CHHHHHHHHHHHHCCCCCCEECCCC
Q ss_conf             649999985998766888999998579818973444324368899999997288-5277798889874002320201244
Q gi|254780911|r    2 SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIADFQPIVQQFSLQYSIRNT   80 (288)
Q Consensus         2 ~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-~~~~l~~~f~~ia~~~~m~~~i~~~   80 (288)
                      ++||||++||||+||||+||++|+++||||++++||+|+++++||||++|+.+. +.++++++|++++++|+|+|++++.
T Consensus         6 ~~~ILt~~CpD~~GIVa~vs~~l~~~g~NI~~~~q~~D~~~~~FFmRi~f~~~~~~~~~l~~~~~~~a~~~~m~~~~~~~   85 (287)
T 3nrb_A            6 NQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVEIPVAGVNDFNSAFGKVVEKYNAEWWFRPR   85 (287)
T ss_dssp             TEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTTTEEEEEEEEECCC---CHHHHHHHHHHGGGTCEEEEEET
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEECCC
T ss_conf             76999998999886599999999978998827405348999808999999758899899999999988652200233364


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHH-HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             5655389997088679899998620467415899999773466-777886099747416873352776789999973339
Q gi|254780911|r   81 KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNN  159 (288)
Q Consensus        81 ~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~-~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~  159 (288)
                      ++|+|+||||||+||||++||+|++.|+|+++|++|||||+++ ..+|++++|||+++|.++.+|+++|+++++.+++++
T Consensus        86 ~~k~riaIlvS~~gh~L~~Ll~~~~~g~L~~eI~~VISN~~~~~~~~a~~~~ip~~~~~~~~~~~~~~e~~~~~~l~~~~  165 (287)
T 3nrb_A           86 TDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNHPREALSVSLVGDIPFHYLPVTPATKAAQESQIKNIVTQSQ  165 (287)
T ss_dssp             TCCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSCGGGCCCCCCTTSCEEECCCCGGGHHHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             56824899990897009999998774569904999982684067999987799989974898767899999987875268


Q ss_pred             CEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
Q ss_conf             40999827675488778632778479613366767899995899974268376225775305568883444446651888
Q gi|254780911|r  160 VELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA  239 (288)
Q Consensus       160 ~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~  239 (288)
                      +||||||||||||+++|++.|+++|||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|+.++|+++
T Consensus       166 ~Dlivlag~~~il~~~~l~~~~~~iiNiHpslLP~~rG~~~~~~a~~~g~k~~G~TvH~v~~~lD~G~II~Q~~~~I~~~  245 (287)
T 3nrb_A          166 ADLIVLARYMQILSDDLSAFLSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHR  245 (287)
T ss_dssp             CSEEEESSCCSCCCHHHHHHHTTSEEEEESSCTTTTCSSCHHHHHHHHTCSEEEEEEEECCSSSSCCCEEEEEEEECCTT
T ss_pred             CEEEEEECCCCCCCHHHHHHHHCCCCEECCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
T ss_conf             76999870065233568888748831779885868889665678997699634248999607875898489999875999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             89999999999999999999999987691788688579808
Q gi|254780911|r  240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       240 dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ||+++|.+|++++|+++|++||++++++|++++||||+||-
T Consensus       246 dt~~~L~~k~~~~e~~~l~~ai~~~~~~ri~~~~~ktvvf~  286 (287)
T 3nrb_A          246 DSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVFA  286 (287)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEC
T ss_conf             99999999999999999999999998399898899999926