HHsearch results for GI: 254780911 and protein with PDBid: 3o1l_A

>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV}
Probab=100.00  E-value=0  Score=662.47  Aligned_cols=280  Identities=38%  Similarity=0.712  Sum_probs=275.5

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC---CCHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             964999998599876688899999857981897344432436889999999728---85277798889874002320201
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~---~~~~~l~~~f~~ia~~~~m~~~i   77 (288)
                      |++||||++||||+||||+||++|+++||||++++||+|.++++||||++|+.+   .+.+.++++|++++++|+|+|++
T Consensus        20 m~~~iL~i~CpD~~GIVa~Vs~~L~~~g~NI~e~~qf~D~~~~~FFmR~~f~~~~~~~~~~~l~~~f~~la~~~~m~~~i   99 (302)
T 3o1l_A           20 MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDLDGFREAFTPIAEEFSMDWRI   99 (302)
T ss_dssp             CCEEEEEEEEECCTTHHHHHHHHHHHTTCCEEEEEEEEETTTTEEEEEEEEEGGGSSSCHHHHHHHHHHHHHHHTCEEEE
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             62699999999998739999999997899882733544899992899999970898779999999876665430401443


Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      ++.++|+|+||||||+||||++||+|+++|+|+++|++|||||++++++|+.++|||+++++++.++.++|+++++++++
T Consensus       100 ~~~~~~~riaIlvS~~g~~l~~ll~~~~~g~L~~~i~~ViSN~~d~~~la~~~~ip~~~~~~~~~~~~~~e~~~~~~l~~  179 (302)
T 3o1l_A          100 TDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVISNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGH  179 (302)
T ss_dssp             EETTSCCEEEEEECSCCHHHHHHHHHHHTTCSCSEEEEEEESSSTTHHHHHTTTCCEEECCCCSSCCHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             25566836999981898439999999877998726889825855378889986399599937843358889999999873


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +++|||||||||||||++|++.|+++|||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|..++|.
T Consensus       180 ~~~Dlivlagy~~il~~~~l~~~~~~iiNiHpSlLP~~rG~~p~~~ai~~g~k~~G~TvH~v~~~lD~GpII~Q~~v~I~  259 (302)
T 3o1l_A          180 HQADVVVLARYMQILPPQLCREYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS  259 (302)
T ss_dssp             TTCSEEEESSCCSCCCTTHHHHTTTCEEEEESSCTTSSCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECC
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
T ss_conf             59839997313543787898632124400578768412585826999984992896899998489747874899998739


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ++||+++|.+|++++|+++|++||++++++|+++++||||||-
T Consensus       260 ~~dt~~~L~~k~~~~e~~ll~~ai~~~~e~ri~~~~~ktvvfd  302 (302)
T 3o1l_A          260 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD  302 (302)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCEEEEEC
T ss_conf             9999999999999999999999999998199799399579839