Query         gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 288
No_of_seqs    205 out of 2475
Neff          5.8 
Searched_HMMs 23785
Date          Tue May 31 22:28:41 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780911.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3lou_A Formyltetrahydrofolate  100.0       0       0  664.4  34.3  278    3-280    10-292 (292)
  2 3o1l_A Formyltetrahydrofolate  100.0       0       0  662.5  34.7  280    1-280    20-302 (302)
  3 3n0v_A Formyltetrahydrofolate  100.0       0       0  649.7  35.8  278    2-279     7-286 (286)
  4 3obi_A Formyltetrahydrofolate  100.0       0       0  651.3  33.9  279    2-280     5-287 (288)
  5 3nrb_A Formyltetrahydrofolate  100.0       0       0  650.2  32.3  279    2-280     6-286 (287)
  6 2ywr_A Phosphoribosylglycinami 100.0       0       0  368.2  25.7  203   84-286     2-207 (216)
  7 1jkx_A GART;, phosphoribosylgl 100.0       0       0  356.6  25.3  203   84-286     1-208 (212)
  8 3kcq_A Phosphoribosylglycinami 100.0       0       0  356.9  24.0  203   78-284     3-207 (215)
  9 3da8_A Probable 5'-phosphoribo 100.0       0       0  354.2  23.9  200   79-279     8-209 (215)
 10 1meo_A Phosophoribosylglycinam 100.0 1.4E-45       0  338.8  24.8  202   85-286     2-206 (209)
 11 1z7e_A Protein aRNA; rossmann  100.0 1.4E-29 5.9E-34  225.6  19.3  174   84-269     1-185 (660)
 12 2bln_A Protein YFBG; transfera 100.0 2.5E-29 1.1E-33  223.9  18.7  175   84-270     1-186 (305)
 13 1fmt_A Methionyl-tRNA FMet for 100.0 3.2E-28 1.3E-32  216.2  20.1  178   81-270     1-192 (314)
 14 2bw0_A 10-FTHFDH, 10-formyltet 100.0 1.2E-28 5.1E-33  219.1  17.4  191   72-269    10-210 (329)
 15 1zgh_A Methionyl-tRNA formyltr  99.9 6.8E-22 2.9E-26  172.0  12.2  160   92-268    16-179 (260)
 16 2nyi_A Unknown protein; protei  99.7 5.4E-18 2.3E-22  144.8   5.0  184    1-188     3-195 (195)
 17 1zpv_A ACT domain protein; str  99.6 9.5E-16   4E-20  129.2   8.7   80    1-81      4-83  (91)
 18 1u8s_A Glycine cleavage system  99.5 1.6E-12 6.7E-17  106.7  14.7  157    1-164     3-175 (192)
 19 3p96_A Phosphoserine phosphata  99.0 2.6E-08 1.1E-12   77.3  13.7  115    3-119    12-138 (415)
 20 1u8s_A Glycine cleavage system  98.9 1.5E-08 6.3E-13   78.9  10.1   83    3-85     93-183 (192)
 21 2nyi_A Unknown protein; protei  98.5 5.6E-07 2.3E-11   68.0   9.2   80    3-82     93-177 (195)
 22 1y7p_A Hypothetical protein AF  98.0 3.4E-05 1.4E-09   55.6   8.6  138    4-169     5-155 (223)
 23 2ko1_A CTR148A, GTP pyrophosph  97.8 3.2E-05 1.3E-09   55.8   5.7   64    1-67      1-66  (88)
 24 3p96_A Phosphoserine phosphata  97.7 0.00036 1.5E-08   48.4   9.4   86    2-89    100-190 (415)
 25 2fgc_A Acetolactate synthase,   96.8   0.027 1.1E-06   35.3  11.6   67    1-69     27-96  (193)
 26 2f1f_A Acetolactate synthase i  96.7  0.0056 2.4E-07   40.1   7.3   70    1-72      1-73  (164)
 27 3mtj_A Homoserine dehydrogenas  95.8   0.037 1.6E-06   34.4   7.6   50   82-136    77-134 (444)
 28 1ygy_A PGDH, D-3-phosphoglycer  95.8    0.06 2.5E-06   32.9   8.4  105  152-271   191-310 (529)
 29 2pc6_A Probable acetolactate s  95.4   0.036 1.5E-06   34.5   6.4   69    1-72      3-74  (165)
 30 2f06_A Conserved hypothetical   94.4    0.16 6.7E-06   30.0   7.3   43    1-43      4-46  (144)
 31 1wy5_A TILS, hypothetical UPF0  93.9    0.25   1E-05   28.6   7.5   87   81-168    22-134 (317)
 32 1f0k_A MURG, UDP-N-acetylgluco  93.6    0.29 1.2E-05   28.1   7.4   15   19-33     25-39  (364)
 33 1ni5_A Putative cell cycle pro  93.2    0.43 1.8E-05   26.9   7.8   59   82-140    12-82  (433)
 34 2yut_A Putative short-chain ox  92.0    0.28 1.2E-05   28.3   5.5   74  176-250   108-193 (207)
 35 3luy_A Probable chorismate mut  91.5    0.82 3.5E-05   25.0   8.8   12  151-162   225-236 (329)
 36 2qmx_A Prephenate dehydratase;  91.4    0.83 3.5E-05   24.9   9.4   14   15-28     60-73  (283)
 37 3a2k_A TRNA(Ile)-lysidine synt  91.3     0.4 1.7E-05   27.2   5.7   86   81-167    16-127 (464)
 38 2f06_A Conserved hypothetical   90.5    0.47   2E-05   26.7   5.5   34    8-41     77-110 (144)
 39 2c82_A 1-deoxy-D-xylulose 5-ph  90.3    0.51 2.1E-05   26.5   5.5  155   79-286     8-181 (413)
 40 2der_A TRNA-specific 2-thiouri  90.3       1 4.3E-05   24.3   7.0   56   81-140    15-87  (380)
 41 2d13_A Hypothetical protein PH  89.3     1.1 4.7E-05   24.0   6.6  120   83-212     4-143 (227)
 42 2qmw_A PDT, prephenate dehydra  89.2     1.3 5.4E-05   23.6   7.4   11  259-269   205-215 (267)
 43 1nvm_B Acetaldehyde dehydrogen  88.8    0.73 3.1E-05   25.3   5.4   75   81-166     2-78  (312)
 44 3mwb_A Prephenate dehydratase;  87.1     1.7 7.2E-05   22.8   9.2   20  146-165   214-233 (313)
 45 3m1a_A Putative dehydrogenase;  87.1     1.7 7.2E-05   22.8   9.4   60  171-231   120-191 (281)
 46 3a06_A 1-deoxy-D-xylulose 5-ph  87.0       1 4.4E-05   24.2   5.3  116   82-231     2-129 (376)
 47 1sc6_A PGDH, D-3-phosphoglycer  87.0     1.3 5.4E-05   23.7   5.7  148  108-270   142-315 (404)
 48 2dtj_A Aspartokinase; protein-  86.1     1.9   8E-05   22.4   7.6  105    4-110    16-125 (178)
 49 1ydw_A AX110P-like protein; st  85.0     2.1   9E-05   22.1   6.0   74   95-178    61-139 (362)
 50 3gvc_A Oxidoreductase, probabl  84.5     2.2 9.4E-05   21.9   8.4  138   87-228    31-212 (277)
 51 2hma_A Probable tRNA (5-methyl  84.0     1.5 6.2E-05   23.2   4.8   18  122-139    61-78  (376)
 52 1r0k_A 1-deoxy-D-xylulose 5-ph  83.5     2.5  0.0001   21.6   6.1  165   81-286     2-180 (388)
 53 3k32_A Uncharacterized protein  81.5     2.9 0.00012   21.2   5.7   57   80-141     3-67  (203)
 54 2o4u_X Dimeric dihydrodiol deh  80.9       3 0.00013   21.0   6.2   82   96-188    57-151 (334)
 55 1g8l_A Molybdopterin biosynthe  80.3     2.3 9.7E-05   21.8   4.7   82   79-170   173-254 (411)
 56 2p2s_A Putative oxidoreductase  80.3     3.2 0.00013   20.9   6.0   33    1-34      2-34  (336)
 57 3evn_A Oxidoreductase, GFO/IDH  80.2     2.8 0.00012   21.3   5.1   85   95-188    57-152 (329)
 58 2nvw_A Galactose/lactose metab  79.7     3.3 0.00014   20.7   6.3   56   79-134    35-93  (479)
 59 2gdz_A NAD+-dependent 15-hydro  79.0     3.5 0.00015   20.6   7.4  106  182-288   133-267 (267)
 60 3moi_A Probable dehydrogenase;  79.0     3.5 0.00015   20.6   6.6   72   96-178    55-132 (387)
 61 2q8n_A Glucose-6-phosphate iso  78.5     3.6 0.00015   20.5   6.8   57   83-139   140-205 (460)
 62 3b9q_A Chloroplast SRP recepto  78.1     3.7 0.00016   20.4   8.2  163   60-228    76-265 (302)
 63 2ehd_A Oxidoreductase, oxidore  77.3     3.9 0.00016   20.3   9.6  101  169-284   117-230 (234)
 64 3ngw_A Molybdopterin-guanine d  77.2     3.9 0.00016   20.3   5.4   89   84-180     1-104 (208)
 65 1uz5_A MOEA protein, 402AA lon  77.2     2.4  0.0001   21.7   4.1   83   79-171   176-258 (402)
 66 1ozh_A ALS, acetolactate synth  76.5       2 8.4E-05   22.3   3.5   75   92-168   192-283 (566)
 67 2hig_A 6-phospho-1-fructokinas  75.9     2.3 9.8E-05   21.8   3.7   95   72-167    86-197 (487)
 68 3k5p_A D-3-phosphoglycerate de  75.7     4.3 0.00018   20.0   5.8  147  109-270   154-326 (416)
 69 2og2_A Putative signal recogni  75.3     4.4 0.00018   19.9   8.5  146   77-228   150-322 (359)
 70 3e9m_A Oxidoreductase, GFO/IDH  74.8     4.5 0.00019   19.8   7.0   84   95-188    57-152 (330)
 71 3ec7_A Putative dehydrogenase;  74.7     4.5 0.00019   19.8   7.4   98   96-201    78-191 (357)
 72 1zxx_A 6-phosphofructokinase;   74.3     4.4 0.00019   19.9   4.8   24    1-24      1-24  (319)
 73 2dt9_A Aspartokinase; protein-  73.5     4.9  0.0002   19.6  11.6  112    5-119    18-142 (167)
 74 3oqb_A Oxidoreductase; structu  73.3     4.9 0.00021   19.6   8.4   26  150-177   125-150 (383)
 75 3ezy_A Dehydrogenase; structur  73.2     4.9 0.00021   19.6   5.8   46  127-177    84-131 (344)
 76 2fts_A Gephyrin; gephyrin, neu  73.2     2.8 0.00012   21.3   3.5   89   78-176   176-264 (419)
 77 1ybh_A Acetolactate synthase,   73.0     2.6 0.00011   21.5   3.3   67   97-168   204-287 (590)
 78 3dm5_A SRP54, signal recogniti  72.7       5 0.00021   19.5   6.3  157   66-226    82-256 (443)
 79 3beo_A UDP-N-acetylglucosamine  72.7       5 0.00021   19.5   7.8   15  153-167    89-103 (375)
 80 1jyk_A LICC protein, CTP:phosp  71.7     5.3 0.00022   19.3   5.7   85   80-167    22-127 (254)
 81 3hww_A 2-succinyl-5-enolpyruvy  69.3     2.8 0.00012   21.3   2.8   46  122-169   236-288 (556)
 82 2bgk_A Rhizome secoisolaricire  69.1       6 0.00025   18.9   7.5  106  174-284   138-271 (278)
 83 3nkl_A UDP-D-quinovosamine 4-d  69.1       6 0.00025   18.9   6.1   72   81-167     2-73  (141)
 84 2c31_A Oxalyl-COA decarboxylas  69.1       6 0.00025   18.9   5.1   68   97-169   203-282 (568)
 85 1t9b_A Acetolactate synthase,   68.9     3.3 0.00014   20.8   3.1   44  123-168   310-365 (677)
 86 1zhv_A Hypothetical protein AT  67.9     4.7  0.0002   19.7   3.7   26   12-37     74-99  (134)
 87 3btv_A Galactose/lactose metab  67.7     6.4 0.00027   18.8   5.1   37  150-188   137-180 (438)
 88 2j37_W Signal recognition part  67.4     6.5 0.00027   18.7   6.6  206   19-229    34-260 (504)
 89 2iht_A Carboxyethylarginine sy  67.3     2.5  0.0001   21.6   2.2   93   96-190   205-321 (573)
 90 3l76_A Aspartokinase; alloster  67.0     6.6 0.00028   18.7   7.5  156    8-166   276-479 (600)
 91 3nbm_A PTS system, lactose-spe  66.2     6.8 0.00029   18.6   4.7   38   79-116     2-42  (108)
 92 1wu2_A MOEA protein, molybdopt  65.9     4.3 0.00018   20.0   3.2   79   79-168   178-259 (396)
 93 1b73_A Glutamate racemase; iso  64.1     4.8  0.0002   19.7   3.2   28  110-137    62-92  (254)
 94 2pan_A Glyoxylate carboligase;  63.2     4.8  0.0002   19.6   3.0   45  122-168   245-302 (616)
 95 1q0q_A 1-deoxy-D-xylulose 5-ph  63.2     7.7 0.00033   18.2   5.9  128   81-231     7-145 (406)
 96 1xw8_A UPF0271 protein YBGL; N  62.7     7.4 0.00031   18.3   3.9  125   56-198    36-179 (252)
 97 2jhe_A Transcription regulator  62.6     7.9 0.00033   18.1   5.8  106    5-122     2-109 (190)
 98 2re1_A Aspartokinase, alpha an  62.1     8.1 0.00034   18.1   7.5  102    5-110    27-133 (167)
 99 1tdj_A Biosynthetic threonine   61.9     8.1 0.00034   18.0   7.1  135   82-226    77-245 (514)
100 3m2t_A Probable dehydrogenase;  61.9     8.1 0.00034   18.0   6.1   87   95-190    58-155 (359)
101 2pn1_A Carbamoylphosphate synt  61.2     8.4 0.00035   17.9   7.2   72    1-75      2-75  (331)
102 1phz_A Protein (phenylalanine   60.7       5 0.00021   19.5   2.7   66    3-71     34-102 (429)
103 3opy_A 6-phosphofructo-1-kinas  60.0     8.8 0.00037   17.8   6.1   88   77-167   204-313 (989)
104 2jfz_A Glutamate racemase; cel  59.9     4.4 0.00019   19.9   2.4   10   85-94      2-11  (255)
105 3euw_A MYO-inositol dehydrogen  59.5     8.9 0.00038   17.8   6.7   85   96-189    56-151 (344)
106 2yrx_A Phosphoribosylglycinami  58.9     9.1 0.00038   17.7   5.1   20  115-134   142-161 (451)
107 1v5o_A 1700011N24RIK protein;   57.0     1.6 6.8E-05   22.9  -0.3   57  215-276    11-67  (102)
108 1q6z_A BFD, BFDC, benzoylforma  56.8     3.2 0.00013   20.9   1.2   72   96-169   189-276 (528)
109 3db2_A Putative NADPH-dependen  56.8     9.9 0.00042   17.4   5.3   74   95-177    56-133 (354)
110 2v3c_C SRP54, signal recogniti  55.6      10 0.00043   17.3   5.4  207   16-226    29-255 (432)
111 1xea_A Oxidoreductase, GFO/IDH  55.2      10 0.00044   17.3   4.0   25  150-176   105-129 (323)
112 2uz1_A Benzaldehyde lyase; thi  54.9     4.8  0.0002   19.7   1.9   70   96-170   193-280 (563)
113 2prs_A High-affinity zinc upta  54.9      11 0.00045   17.2   6.0  109   97-205   158-270 (284)
114 2yw2_A Phosphoribosylamine--gl  54.6      11 0.00045   17.2   3.7   28  109-136   115-142 (424)
115 3cea_A MYO-inositol 2-dehydrog  53.4      11 0.00047   17.1   9.0   26  150-176   113-138 (346)
116 3e70_C DPA, signal recognition  53.2      11 0.00047   17.1   5.3  144   80-227   125-286 (328)
117 2wje_A CPS4B, tyrosine-protein  52.7      11 0.00048   17.0   4.1   38  184-221   165-209 (247)
118 1v2y_A 3300001G02RIK protein;   52.7     7.4 0.00031   18.3   2.5   48  225-276    16-78  (105)
119 2q28_A Oxalyl-COA decarboxylas  52.5     5.4 0.00023   19.3   1.8   13  124-136   232-244 (564)
120 3ot5_A UDP-N-acetylglucosamine  52.2      12 0.00049   16.9   6.8   29  110-138   114-145 (403)
121 2ffh_A Protein (FFH); SRP54, s  51.7      12  0.0005   16.9   6.4  157   67-228    82-256 (425)
122 1wia_A Hypothetical ubiquitin-  51.5    0.76 3.2E-05   25.2  -2.7   42  231-276    19-60  (95)
123 3e18_A Oxidoreductase; dehydro  51.5      12  0.0005   16.9   5.6   84   95-188    55-150 (359)
124 1wz3_A Autophagy 12B, ATG12B,   51.4     9.8 0.00041   17.5   3.0   60  212-286    12-71  (96)
125 2nxw_A Phenyl-3-pyruvate decar  50.7     7.8 0.00033   18.2   2.4   16  123-138   242-257 (565)
126 2jfn_A Glutamate racemase; cel  50.5     8.2 0.00035   18.0   2.5   96   78-193    16-120 (285)
127 1zvp_A Hypothetical protein VC  50.1      12 0.00051   16.8   3.3   23  147-169    87-109 (133)
128 3pfk_A Phosphofructokinase; tr  49.3      13 0.00054   16.6   4.5   25    1-25      1-25  (319)
129 3eya_A Pyruvate dehydrogenase   49.3     8.6 0.00036   17.9   2.4   96   91-190   185-294 (549)
130 3dty_A Oxidoreductase, GFO/IDH  49.2      13 0.00054   16.6   6.9   26  150-177   127-152 (398)
131 3geb_A EYES absent homolog 2;   48.4      13 0.00056   16.6   3.5   44   92-139   215-258 (274)
132 2x7j_A 2-succinyl-5-enolpyruvy  48.3     1.5 6.4E-05   23.1  -1.5   76   95-170   231-320 (604)
133 1v8b_A Adenosylhomocysteinase;  47.9      14 0.00057   16.5   3.8   58  108-167    68-135 (479)
134 2pgn_A Cyclohexane-1,2-dione h  47.9     8.5 0.00036   17.9   2.2   68  121-190   223-304 (589)
135 3c1a_A Putative oxidoreductase  47.8      14 0.00057   16.5   4.4   74   95-178    59-137 (315)
136 1pq4_A Periplasmic binding pro  47.8      14 0.00057   16.5   5.5   51  115-165   192-243 (291)
137 3cx3_A Lipoprotein; zinc-bindi  47.8      14 0.00057   16.5   4.0   50  116-165   180-232 (284)
138 2yvt_A Hypothetical protein AQ  47.7      13 0.00053   16.7   3.1   16  127-142    85-100 (260)
139 2vbf_A Branched-chain alpha-ke  47.7     5.5 0.00023   19.2   1.2   47  122-170   247-306 (570)
140 3grp_A 3-oxoacyl-(acyl carrier  47.0      14 0.00058   16.4   7.1  140   87-228    29-210 (266)
141 1tzy_A Histone H2A-IV; histone  46.5     4.2 0.00018   20.0   0.5   18  181-198   106-123 (129)
142 1v5e_A Pyruvate oxidase; oxido  46.4      14 0.00058   16.5   3.1   42   96-137   194-237 (590)
143 3lq1_A 2-succinyl-5-enolpyruvy  46.3      10 0.00042   17.4   2.4   75  122-198   241-329 (578)
144 1pqw_A Polyketide synthase; ro  46.2      14  0.0006   16.3   8.5   94   86-187    40-136 (198)
145 2bkw_A Alanine-glyoxylate amin  45.9      14 0.00061   16.3   7.9   81   86-166    60-144 (385)
146 2is8_A Molybdopterin biosynthe  45.3      15 0.00062   16.2   3.1   68  121-188    24-95  (164)
147 1yxm_A Pecra, peroxisomal tran  45.1      15 0.00062   16.2   9.8   50  174-223   144-203 (303)
148 2f8n_G Core histone macro-H2A.  44.1     5.1 0.00021   19.5   0.6   17  181-197   103-119 (120)
149 1h6d_A Precursor form of gluco  44.0      15 0.00065   16.1   5.6   53   79-134    79-133 (433)
150 1pfk_A Phosphofructokinase; tr  43.6      16 0.00066   16.1   4.7   31    1-31      2-35  (320)
151 1y5e_A Molybdenum cofactor bio  43.5      16 0.00066   16.0   3.5   67  118-184    31-101 (169)
152 2f48_A Diphosphate--fructose-6  42.0      16 0.00069   15.9   7.9  112   56-167    41-174 (555)
153 3i4f_A 3-oxoacyl-[acyl-carrier  42.0      16 0.00069   15.9   8.6   98  174-285   131-261 (264)
154 2kk8_A Uncharacterized protein  42.0     1.8 7.7E-05   22.6  -1.9   43  233-276    24-66  (84)
155 2l2q_A PTS system, cellobiose-  42.0      16 0.00069   15.9   6.7   14   82-95      3-16  (109)
156 3kts_A Glycerol uptake operon   41.9      17 0.00069   15.9   5.5  108   90-215    64-177 (192)
157 1z2m_A ISG15, interferon, alph  41.6      17  0.0007   15.8   4.8   43  212-254    67-116 (155)
158 3mt0_A Uncharacterized protein  41.0      17 0.00072   15.8   3.2   82   82-166     6-96  (290)
159 1toa_A Tromp-1, protein (perip  40.9      17 0.00072   15.8   3.1   20  116-135   200-219 (313)
160 2nqb_C Histone H2A; nucleosome  40.6     6.3 0.00026   18.8   0.6   18  181-198   104-121 (123)
161 2oho_A Glutamate racemase; iso  40.5      17 0.00073   15.7   3.3   40  148-187    63-104 (273)
162 2ez9_A Pyruvate oxidase; TPP e  40.3      17 0.00073   15.7   2.9   37   97-136   202-243 (603)
163 2ixa_A Alpha-N-acetylgalactosa  39.9      18 0.00075   15.7   5.8   37  150-188   133-176 (444)
164 3gi1_A LBP, laminin-binding pr  39.2      18 0.00076   15.6   5.1   70   97-166   163-235 (286)
165 3nyw_A Putative oxidoreductase  39.2      18 0.00076   15.6   9.7   78  170-247   126-216 (250)
166 2dwu_A Glutamate racemase; iso  39.0      18 0.00077   15.6   3.0   15  153-167   174-188 (276)
167 2f8n_K Histone H2A type 1; nuc  38.8     6.6 0.00028   18.7   0.5   17  181-197   125-141 (149)
168 1b0z_A Protein (phosphoglucose  38.2      19 0.00079   15.5   6.9   56   83-138   130-196 (445)
169 1f66_C Histone H2A.Z; nucleoso  37.5     6.4 0.00027   18.8   0.3   13  182-194   109-121 (128)
170 2o1e_A YCDH; alpha-beta protei  37.4      19 0.00081   15.4   4.8   14  211-224   237-250 (312)
171 3opy_B 6-phosphofructo-1-kinas  37.4      19 0.00081   15.4   5.8   84   81-167   179-284 (941)
172 3ist_A Glutamate racemase; str  36.6      20 0.00083   15.3   2.9   10  157-166   176-185 (269)
173 3ia7_A CALG4; glycosysltransfe  36.4      20 0.00084   15.3   6.5  106  144-252   245-363 (402)
174 1ovm_A Indole-3-pyruvate decar  36.0     7.2  0.0003   18.4   0.3   46  121-168   227-285 (552)
175 1id3_C Histone H2A.1; nucleoso  35.7      10 0.00042   17.4   1.0   19  181-199   106-124 (131)
176 2wsb_A Galactitol dehydrogenas  35.3      21 0.00087   15.2   7.8   56  170-227   125-195 (254)
177 2ho3_A Oxidoreductase, GFO/IDH  35.0      21 0.00088   15.2   5.1   83   95-187    53-143 (325)
178 3out_A Glutamate racemase; str  34.7      21 0.00089   15.1   3.2   14  153-166   172-185 (268)
179 1mkz_A Molybdenum cofactor bio  34.0      22 0.00091   15.1   3.7   85   82-183     9-97  (172)
180 1ls1_A Signal recognition part  33.7      22 0.00092   15.0   8.8  149   79-229    93-257 (295)
181 3hh8_A Metal ABC transporter s  32.9      23 0.00095   14.9   6.3   56  110-165   180-238 (294)
182 3op4_A 3-oxoacyl-[acyl-carrier  32.3      23 0.00097   14.9   6.3   58  169-227   122-191 (248)
183 2dq4_A L-threonine 3-dehydroge  32.2      20 0.00085   15.3   2.1  121   82-216   164-288 (343)
184 2axq_A Saccharopine dehydrogen  32.1      23 0.00098   14.8   7.5   24    1-28     22-46  (467)
185 3ceu_A Thiamine phosphate pyro  31.7      24 0.00099   14.8   6.9   13  158-170   106-118 (210)
186 3h9u_A Adenosylhomocysteinase;  31.2      24   0.001   14.8   4.5   56  109-167    66-130 (436)
187 1qzu_A Hypothetical protein MD  30.8      24   0.001   14.7   2.8   97   79-184    15-117 (206)
188 2gzm_A Glutamate racemase; enz  30.4      25   0.001   14.7   3.2   15  152-166   169-183 (267)
189 2pfs_A USP, universal stress p  30.2      25   0.001   14.6   5.3   41  124-167    77-117 (150)
190 2pjk_A 178AA long hypothetical  30.1      25  0.0011   14.6   3.7   95   80-184    12-110 (178)
191 1w2i_A Acylphosphatase; hydrol  30.1      25  0.0011   14.6   3.9   70   49-119     8-77  (91)
192 2oyc_A PLP phosphatase, pyrido  30.0      25  0.0011   14.6   4.4   16   20-35     14-29  (306)
193 1jlj_A Gephyrin; globular alph  29.9      25  0.0011   14.6   5.7   44  141-184    60-107 (189)
194 3f0h_A Aminotransferase; RER07  29.9      25  0.0011   14.6   4.8   54   85-141    71-128 (376)
195 1q5x_A Regulator of RNAse E ac  29.6      13 0.00056   16.5   0.8   30   87-119    36-65  (161)
196 3olq_A Universal stress protei  29.4      26  0.0011   14.5   3.5   18  149-166   101-118 (319)
197 1t9k_A Probable methylthioribo  29.1      26  0.0011   14.5   6.5   64   91-166   164-234 (347)
198 1vj0_A Alcohol dehydrogenase,   28.9      26  0.0011   14.5   7.9   79   83-166   196-274 (380)
199 3guy_A Short-chain dehydrogena  28.9      26  0.0011   14.5   8.9   32    1-35      1-32  (230)
200 1ii7_A MRE11 nuclease; RAD50,   28.8      18 0.00076   15.6   1.4   15  108-122    73-87  (333)
201 3l6e_A Oxidoreductase, short-c  28.3      27  0.0011   14.4   6.4   27    7-34      7-33  (235)
202 1o4w_A PIN (PILT N-terminus) d  28.0      27  0.0011   14.4   4.4   45   91-140    94-138 (147)
203 1uf3_A Hypothetical protein TT  27.8      27  0.0012   14.4   2.3   13  109-121    62-74  (228)
204 3mjf_A Phosphoribosylamine--gl  27.3      28  0.0012   14.3   6.6   98   93-197    52-157 (431)
205 2ip4_A PURD, phosphoribosylami  27.0      28  0.0012   14.3   4.6   20  115-134   120-139 (417)
206 3mz0_A Inositol 2-dehydrogenas  26.6      29  0.0012   14.2   8.0   85   96-188    57-152 (344)
207 1gtf_A Trp RNA-binding attenua  26.2      17 0.00069   15.9   0.8   30  203-232    11-46  (74)
208 3mah_A Aspartokinase; aspartat  26.0      29  0.0012   14.1   2.1   35    4-38     19-56  (157)
209 3ffy_A Putative tetrapyrrole (  25.9      29  0.0012   14.2   2.0   26   97-122    90-115 (115)
210 2ph5_A Homospermidine synthase  25.9      30  0.0012   14.1   3.9   60   78-140     8-69  (480)
211 1oya_A OLD yellow enzyme; oxid  25.8      25  0.0011   14.6   1.7   25  113-137   167-191 (400)
212 1ulr_A Putative acylphosphatas  25.7      30  0.0013   14.1   4.5   60   59-119    16-75  (88)
213 2wjg_A FEOB, ferrous iron tran  25.5      30  0.0013   14.1   3.8  146    1-159     5-171 (188)
214 1gud_A ALBP, D-allose-binding   25.0      31  0.0013   14.0   6.7   19   58-76     17-35  (288)
215 1zzg_A Glucose-6-phosphate iso  24.8      31  0.0013   14.0   8.3   80   47-139    93-182 (415)
216 2kan_A Uncharacterized protein  24.7     3.8 0.00016   20.4  -2.7   39  232-271    27-65  (94)
217 3eod_A Protein HNR; response r  24.2      32  0.0013   13.9   3.2   85  113-210     9-103 (130)
218 1mio_B Nitrogenase molybdenum   24.2      32  0.0013   13.9   5.3   44   90-138   219-265 (458)
219 2gm3_A Unknown protein; AT3G01  24.2      32  0.0013   13.9   3.8   38  126-167    95-132 (175)
220 1wdu_A TRAS1 ORF2P; four-layer  24.2      32  0.0013   13.9   3.3   32    5-36     22-53  (245)
221 3i1m_F 30S ribosomal protein S  23.9      32  0.0013   13.9   5.1   65    1-65      1-79  (135)
222 3hgm_A Universal stress protei  23.7      32  0.0014   13.9   2.9   42  125-167    77-118 (147)
223 3d5n_A Q97W15_sulso; NESG, SSR  23.7      32  0.0014   13.8   3.4   18  162-179    90-107 (197)
224 2dfa_A Hypothetical UPF0271 pr  23.4      33  0.0014   13.8   7.5  125   56-198    41-184 (250)
225 3mc1_A Predicted phosphatase,   23.1      33  0.0014   13.8   4.7   51  195-253   164-218 (226)
226 1vkf_A Glycerol uptake operon   22.7      34  0.0014   13.7   6.8   85   89-183    65-150 (188)
227 2fhm_A Probable acylphosphatas  22.6      34  0.0014   13.7   4.3   58   60-118    17-74  (91)
228 3ip3_A Oxidoreductase, putativ  22.2      35  0.0015   13.7   8.2   87   95-189    57-155 (337)
229 3oby_A Protein pelota homolog;  22.2      25  0.0011   14.6   1.1   82   85-167   104-192 (352)
230 1tlt_A Putative oxidoreductase  21.9      35  0.0015   13.6   6.4   72   95-178    57-133 (319)
231 2bjd_A Acylphosphatase; hypert  21.9      35  0.0015   13.6   4.1   60   59-119    28-87  (101)
232 1ff9_A Saccharopine reductase;  21.6      35  0.0015   13.6   8.3   30    1-32      1-30  (450)
233 1gu7_A 2,4-dienoyl-COA reducta  21.4      36  0.0015   13.5   5.3  125   82-214   166-299 (364)
234 1sny_A Sniffer CG10964-PA; alp  21.3      36  0.0015   13.5   8.5   90   80-170    17-114 (267)
235 3fpc_A NADP-dependent alcohol   21.1      36  0.0015   13.5   5.5   81   80-168   164-245 (352)
236 1q7s_A BIT1, protein CGI-147;   21.1      36  0.0015   13.5   4.1   39   99-138    41-82  (117)
237 2j28_9 Signal recognition part  21.0      36  0.0015   13.5   6.9  208   18-229    31-259 (430)
238 2pbz_A Hypothetical protein; N  20.8      37  0.0015   13.5   2.9   15  120-134    99-113 (320)
239 3bfj_A 1,3-propanediol oxidore  20.8      37  0.0015   13.5   7.1   40  128-167    60-100 (387)
240 2klc_A Ubiquilin-1; ubiquitin-  20.7      11 0.00045   17.2  -1.0   39  231-270    36-74  (101)
241 1jmv_A USPA, universal stress   20.5      37  0.0016   13.4   6.0   40  125-167    71-110 (141)
242 2cdq_A Aspartokinase; aspartat  20.4      37  0.0016   13.4   8.0   17   85-101    58-74  (510)
243 1ka9_H Imidazole glycerol phos  20.3      38  0.0016   13.4   5.3  100   83-193     2-117 (200)
244 1yzq_A Small GTP binding prote  20.2      38  0.0016   13.4   9.6   27    1-27      4-30  (170)
245 2jya_A AGR_C_3324P, uncharacte  20.0      38  0.0016   13.4   4.1   42   98-139    39-80  (106)

No 1  
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia mallei}
Probab=100.00  E-value=0  Score=664.41  Aligned_cols=278  Identities=41%  Similarity=0.765  Sum_probs=272.5

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-----CHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             49999985998766888999998579818973444324368899999997288-----5277798889874002320201
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-----CMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-----~~~~l~~~f~~ia~~~~m~~~i   77 (288)
                      +||||++||||+||||+||+||+++||||++++||+|.++++||||++|+...     ..+.++++|.+++++|+|+|++
T Consensus        10 ~~iL~i~CpD~~GiVa~vs~~l~~~g~nI~~~~qf~D~~~~~FFmR~~f~~~~~~~~~~~~~l~~~~~~~a~~~~m~~~~   89 (292)
T 3lou_A           10 QFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVDALRREFEPIAERFRMQWAI   89 (292)
T ss_dssp             EEEEEEEEESCSCHHHHHHHHHHHTTEEEEEEEEEEETTTTEEEEEEEEEECC----CCHHHHHHHHHHHHHHHTCEEEE
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCEEC
T ss_conf             38999989998864999999999789999787344488888078989997268854338899999988666543872330


Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      ++.+.|+|+|||+||+||||++||+++++|+|+++|++|||||++++++|+.+++|+++++.++.+|+++|+++++++++
T Consensus        90 ~~~~~~~riavlvSg~g~~L~~Ll~~~~~g~L~~eI~~ViSN~~~~~~l~~a~~ip~~~~~~~~~~~~~~e~~~~~~l~~  169 (292)
T 3lou_A           90 HDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVSNHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFET  169 (292)
T ss_dssp             EETTSCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSSTTHHHHHHTTCCEEECCCCSSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             45456836999967998269999999976999817999974894279999975498478615876278899999999862


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +++|||||||||||||++|+++|++++||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|+.++|+
T Consensus       170 ~~~Dlivlagym~Il~~~~l~~~~~~iiNiHpSlLP~~~G~~~~~~ai~~g~k~~G~TvH~v~~~lD~GpII~Q~~~~I~  249 (292)
T 3lou_A          170 SGAELVILARYMQVLSPEASARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVD  249 (292)
T ss_dssp             HTCSEEEESSCCSCCCHHHHHHTTTSEEEEEEECSSCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECC
T ss_pred             CCCEEEEHHHHCCCCCCHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
T ss_conf             49809984781341770633216785599656866233788818899977995799999999489837980699998749


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ++||+++|.+|++++|+++|++||++++|+||+++|||||||.
T Consensus       250 ~~dt~~~L~~~~~~~E~~~l~~ai~~~~e~rv~~~~~ktvvF~  292 (292)
T 3lou_A          250 HSYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFQ  292 (292)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCEEEEEC
T ss_conf             9999999999999999999999999998199899099889969


No 2  
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV}
Probab=100.00  E-value=0  Score=662.47  Aligned_cols=280  Identities=38%  Similarity=0.712  Sum_probs=275.5

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC---CCHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             964999998599876688899999857981897344432436889999999728---85277798889874002320201
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~---~~~~~l~~~f~~ia~~~~m~~~i   77 (288)
                      |++||||++||||+||||+||++|+++||||++++||+|.++++||||++|+.+   .+.+.++++|++++++|+|+|++
T Consensus        20 m~~~iL~i~CpD~~GIVa~Vs~~L~~~g~NI~e~~qf~D~~~~~FFmR~~f~~~~~~~~~~~l~~~f~~la~~~~m~~~i   99 (302)
T 3o1l_A           20 MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDLDGFREAFTPIAEEFSMDWRI   99 (302)
T ss_dssp             CCEEEEEEEEECCTTHHHHHHHHHHHTTCCEEEEEEEEETTTTEEEEEEEEEGGGSSSCHHHHHHHHHHHHHHHTCEEEE
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             62699999999998739999999997899882733544899992899999970898779999999876665430401443


Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      ++.++|+|+||||||+||||++||+|+++|+|+++|++|||||++++++|+.++|||+++++++.++.++|+++++++++
T Consensus       100 ~~~~~~~riaIlvS~~g~~l~~ll~~~~~g~L~~~i~~ViSN~~d~~~la~~~~ip~~~~~~~~~~~~~~e~~~~~~l~~  179 (302)
T 3o1l_A          100 TDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVISNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGH  179 (302)
T ss_dssp             EETTSCCEEEEEECSCCHHHHHHHHHHHTTCSCSEEEEEEESSSTTHHHHHTTTCCEEECCCCSSCCHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             25566836999981898439999999877998726889825855378889986399599937843358889999999873


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +++|||||||||||||++|++.|+++|||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|..++|.
T Consensus       180 ~~~Dlivlagy~~il~~~~l~~~~~~iiNiHpSlLP~~rG~~p~~~ai~~g~k~~G~TvH~v~~~lD~GpII~Q~~v~I~  259 (302)
T 3o1l_A          180 HQADVVVLARYMQILPPQLCREYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS  259 (302)
T ss_dssp             TTCSEEEESSCCSCCCTTHHHHTTTCEEEEESSCTTSSCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECC
T ss_pred             CCCEEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
T ss_conf             59839997313543787898632124400578768412585826999984992896899998489747874899998739


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ++||+++|.+|++++|+++|++||++++++|+++++||||||-
T Consensus       260 ~~dt~~~L~~k~~~~e~~ll~~ai~~~~e~ri~~~~~ktvvfd  302 (302)
T 3o1l_A          260 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD  302 (302)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCEEEEEC
T ss_conf             9999999999999999999999999998199799399579839


No 3  
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida}
Probab=100.00  E-value=0  Score=649.66  Aligned_cols=278  Identities=42%  Similarity=0.743  Sum_probs=272.1

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC--CCHHHHHHHHHHHHCCCCCCEECCC
Q ss_conf             64999998599876688899999857981897344432436889999999728--8527779888987400232020124
Q gi|254780911|r    2 SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMKLFIADFQPIVQQFSLQYSIRN   79 (288)
Q Consensus         2 ~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~--~~~~~l~~~f~~ia~~~~m~~~i~~   79 (288)
                      ++||||++||||+||||+||+||+++||||++++||+|.++++||||++|+.+  .+.+.++++|.+++++|+|+|++++
T Consensus         7 ~~~IL~i~CpD~~GiVa~vt~~l~~~g~NI~~~~qf~D~~~~~FFmR~~f~~~~~~~~~~l~~~f~~~a~~~~m~~~l~~   86 (286)
T 3n0v_A            7 DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTA   86 (286)
T ss_dssp             CCEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTTTEEEEEEEEECCSSCCHHHHHHHHHHHHGGGTCEEEEEC
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHCCEECCCCC
T ss_conf             80899998999986599999999978998746611226888848999999769998999999889987521120011136


Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             45655389997088679899998620467415899999773466777886099747416873352776789999973339
Q gi|254780911|r   80 TKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNN  159 (288)
Q Consensus        80 ~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~  159 (288)
                      .++|+|+|||+||+||||++||+|++.|+|+++|++|||||++++++++.+++|+++++++..+++++|+++++.+++++
T Consensus        87 ~~~k~riaIlvSg~g~~l~~Ll~~~~~g~l~~~I~~ViSN~~~~~~l~~~~~i~~~~~~~~~~~~~~~e~~~~~~l~~~~  166 (286)
T 3n0v_A           87 PNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETG  166 (286)
T ss_dssp             TTCCCEEEEEESSCCHHHHHHHHHHHTTSSCCEEEEEEESSSTTHHHHHHTTCCEEECCCBTTBHHHHHHHHHHHHHHHT
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHCCC
T ss_conf             56783589996488567999999998499875999983585668999998549945998476540455456888986379


Q ss_pred             CEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
Q ss_conf             40999827675488778632778479613366767899995899974268376225775305568883444446651888
Q gi|254780911|r  160 VELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA  239 (288)
Q Consensus       160 ~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~  239 (288)
                      +|||||||||||||++|++.|++++||+||||||+|+|++||++|+.+|+|.+|||+||||+++|+||||+|.+++|.++
T Consensus       167 ~Dlivlagy~~il~~~~l~~~~~~~iNiHpslLP~~rG~~~~~~ai~~g~k~~G~TvH~v~~~lD~G~Ii~Q~~~~i~~~  246 (286)
T 3n0v_A          167 AELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHS  246 (286)
T ss_dssp             CSEEEESSCCSCCCHHHHHHTTTSEEEEEECSSTTCCCSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECCTT
T ss_pred             CEEEEEEECCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCEEEEEEEEEEECCCCCCCEEEEEEEECCCC
T ss_conf             65999970562179899975536712467877964559785889997397286458999868975797479899863999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEEC
Q ss_conf             8999999999999999999999998769178868857980
Q gi|254780911|r  240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF  279 (288)
Q Consensus       240 dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf  279 (288)
                      ||+++|.+|++++||++|++||+|++|+||+++||||||.
T Consensus       247 dt~~~L~~~~~~~E~~~l~~ai~~~~e~ri~~~~~ktvv~  286 (286)
T 3n0v_A          247 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL  286 (286)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEEC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCEEEEC
T ss_conf             9999999999999999999999999809999939999979


No 4  
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.95A {Rhodopseudomonas palustris}
Probab=100.00  E-value=0  Score=651.32  Aligned_cols=279  Identities=42%  Similarity=0.799  Sum_probs=271.6

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC---CCHHHHHHHHHHHHCCCCCCEECC
Q ss_conf             64999998599876688899999857981897344432436889999999728---852777988898740023202012
Q gi|254780911|r    2 SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLFIADFQPIVQQFSLQYSIR   78 (288)
Q Consensus         2 ~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~---~~~~~l~~~f~~ia~~~~m~~~i~   78 (288)
                      ++||||++||||+||||+||++|+++|+||++++||+|.++++||||++|+.+   .+.++++++|++++++|+|+|+++
T Consensus         5 ~~~IL~i~CpD~~GIVa~Vs~~l~~~g~NI~~~~qf~D~~~~~FFmR~~f~~~~~~~~~~~l~~~f~~~~~~f~m~~~~~   84 (288)
T 3obi_A            5 HQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMR   84 (288)
T ss_dssp             CEEEEEEEEECCTTHHHHHHHHHHHTTEEEEEEEEEEETTTTEEEEEEEEEESSCCCCHHHHHHHHHHHHHHTTCEEEEE
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             81899998999885599999999978998827103347888808999999638887899999998887776515531124


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH-HHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             445655389997088679899998620467415899999773466777-8860997474168733527767899999733
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL-VENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l-A~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      +.++++|+||||||+||||++||+|+++|+|+++|++|||||+++... ++.++|||+++|..+++|.++|+++++++++
T Consensus        85 ~~~~~~riailvSg~g~~l~~ll~~~~~g~L~~~i~~ViSn~~~~~~~~~~~~~ip~~~~~~~~~~~~~~e~~~l~~l~~  164 (288)
T 3obi_A           85 DRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQ  164 (288)
T ss_dssp             ETTSCEEEEEEECSCCHHHHHHHHHHHTTSSCEEEEEEEESSCGGGSCCTTTTTCCEEECCCCTTTHHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             54567359999947833899999999749998437899568565899788747999899288887579999989999985


Q ss_pred             CCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             39409998276754887786327784796133667678999958999742683762257753055688834444466518
Q gi|254780911|r  158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +++|||||||||||||++|++.|++++||+||||||+|+|++||++|+++|+|.+|||+|||++++|+||||+|+.++|+
T Consensus       165 ~~~Dlivlag~~~il~~~~l~~~~~~iiNiHpslLP~~rG~~p~~~ai~~g~k~~G~TvH~v~~~lD~G~II~Q~~~~I~  244 (288)
T 3obi_A          165 THTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERIS  244 (288)
T ss_dssp             HTCCEEEESSCCSCCCHHHHHHTTTSEEEEEEECSSCCCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEECC
T ss_pred             CCCCEEEEEEECCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECC
T ss_conf             49869998400543782666425786534179778555765769999984996600389997179867873799998769


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             8889999999999999999999999987691788688579808
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ++||+++|.+|++++|+++|++||++++++||+++|||||||.
T Consensus       245 ~~dt~~~l~~k~~~~e~~~l~~al~~~~~~ri~~~~~ktvvf~  287 (288)
T 3obi_A          245 HRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFT  287 (288)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCEEEEEC
T ss_conf             9999999999999999999999999998099999199999937


No 5  
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida}
Probab=100.00  E-value=0  Score=650.19  Aligned_cols=279  Identities=43%  Similarity=0.766  Sum_probs=271.4

Q ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-CHHHHHHHHHHHHCCCCCCEECCCC
Q ss_conf             649999985998766888999998579818973444324368899999997288-5277798889874002320201244
Q gi|254780911|r    2 SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIADFQPIVQQFSLQYSIRNT   80 (288)
Q Consensus         2 ~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-~~~~l~~~f~~ia~~~~m~~~i~~~   80 (288)
                      ++||||++||||+||||+||++|+++||||++++||+|+++++||||++|+.+. +.++++++|++++++|+|+|++++.
T Consensus         6 ~~~ILt~~CpD~~GIVa~vs~~l~~~g~NI~~~~q~~D~~~~~FFmRi~f~~~~~~~~~l~~~~~~~a~~~~m~~~~~~~   85 (287)
T 3nrb_A            6 NQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVEIPVAGVNDFNSAFGKVVEKYNAEWWFRPR   85 (287)
T ss_dssp             TEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTTTEEEEEEEEECCC---CHHHHHHHHHHGGGTCEEEEEET
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEECCC
T ss_conf             76999998999886599999999978998827405348999808999999758899899999999988652200233364


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHH-HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             5655389997088679899998620467415899999773466-777886099747416873352776789999973339
Q gi|254780911|r   81 KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNN  159 (288)
Q Consensus        81 ~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~-~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~  159 (288)
                      ++|+|+||||||+||||++||+|++.|+|+++|++|||||+++ ..+|++++|||+++|.++.+|+++|+++++.+++++
T Consensus        86 ~~k~riaIlvS~~gh~L~~Ll~~~~~g~L~~eI~~VISN~~~~~~~~a~~~~ip~~~~~~~~~~~~~~e~~~~~~l~~~~  165 (287)
T 3nrb_A           86 TDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNHPREALSVSLVGDIPFHYLPVTPATKAAQESQIKNIVTQSQ  165 (287)
T ss_dssp             TCCCEEEEEECSCCHHHHHHHHHHHHTSSCCEEEEEEESSCGGGCCCCCCTTSCEEECCCCGGGHHHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHCCC
T ss_conf             56824899990897009999998774569904999982684067999987799989974898767899999987875268


Q ss_pred             CEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
Q ss_conf             40999827675488778632778479613366767899995899974268376225775305568883444446651888
Q gi|254780911|r  160 VELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA  239 (288)
Q Consensus       160 ~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~  239 (288)
                      +||||||||||||+++|++.|+++|||+||||||+|+|++||++|+.+|+|.+|||+|||++++|+||||+|+.++|+++
T Consensus       166 ~Dlivlag~~~il~~~~l~~~~~~iiNiHpslLP~~rG~~~~~~a~~~g~k~~G~TvH~v~~~lD~G~II~Q~~~~I~~~  245 (287)
T 3nrb_A          166 ADLIVLARYMQILSDDLSAFLSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHR  245 (287)
T ss_dssp             CSEEEESSCCSCCCHHHHHHHTTSEEEEESSCTTTTCSSCHHHHHHHHTCSEEEEEEEECCSSSSCCCEEEEEEEECCTT
T ss_pred             CEEEEEECCCCCCCHHHHHHHHCCCCEECCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCC
T ss_conf             76999870065233568888748831779885868889665678997699634248999607875898489999875999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC
Q ss_conf             89999999999999999999999987691788688579808
Q gi|254780911|r  240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP  280 (288)
Q Consensus       240 dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~  280 (288)
                      ||+++|.+|++++|+++|++||++++++|++++||||+||-
T Consensus       246 dt~~~L~~k~~~~e~~~l~~ai~~~~~~ri~~~~~ktvvf~  286 (287)
T 3nrb_A          246 DSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVFA  286 (287)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEECC
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEC
T ss_conf             99999999999999999999999998399898899999926


No 6  
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus}
Probab=100.00  E-value=0  Score=368.18  Aligned_cols=203  Identities=31%  Similarity=0.405  Sum_probs=194.1

Q ss_pred             CCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCC
Q ss_conf             5389997088679899998620467415899999773466777--886099747416873-3527767899999733394
Q gi|254780911|r   84 TKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNV  160 (288)
Q Consensus        84 ~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~  160 (288)
                      +|+|||+||.||||++|++++++++++++|++||||+++++.+  +..+++|+....... ..+.++|.++++.++++++
T Consensus         2 mkiavl~SG~Gsnl~ali~~~~~~~~~~~I~~Vitn~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   81 (216)
T 2ywr_A            2 LKIGVLVSGRGSNLQAIIDAIESGKVNASIELVISDNPKAYAIERCKKHNVECKVIQRKEFPSKKEFEERMALELKKKGV   81 (216)
T ss_dssp             EEEEEEECSCCHHHHHHHHHHHTTSSCEEEEEEEESCTTCHHHHHHHHHTCCEEECCGGGSSSHHHHHHHHHHHHHHTTC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEEEECCCHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             68999991795679999999873999988999998088507776645148630354214568766779999999987099


Q ss_pred             EEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCC
Q ss_conf             09998276754887786327784796133667678999958999742683762257753055688834444466518888
Q gi|254780911|r  161 ELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ  240 (288)
Q Consensus       161 DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~d  240 (288)
                      |++|++|||+||+++|++.|++++||+||||||+|+|++|+++|+..|++.+|||+|+|++++|+||||.|..++|.++|
T Consensus        82 Dliv~~g~~~il~~~~l~~~~~~~iN~HpSlLP~~rG~~p~~~ai~~g~~~~G~Tih~v~~~~D~G~Ii~q~~~~i~~~d  161 (216)
T 2ywr_A           82 ELVVLAGFMRILSHNFLKYFPNKVINIHPSLIPAFQGLHAQKQAVEFGVKFSGCTVHIVDESVDAGPVIVQAVVPVLPED  161 (216)
T ss_dssp             CEEEESSCCSCCCHHHHTTSTTCEEEEESSCTTTTCSTTHHHHHHHHTCSEEEEEEEECCSSSSCSCEEEEEEEECCTTC
T ss_pred             CEEEEECCCCCCCHHHHHHCCCCEEECCCCCCCCCCCCCCHHHHHHCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCC
T ss_conf             99999471211778786203698278189986658986714789976996046279998567658987999988669999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             9999999999999999999999987691788688579808886763
Q gi|254780911|r  241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       241 t~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                      |.++|.+|++.+|+++|++++++++++|+.++++|+++.+++++..
T Consensus       162 t~~~l~~rl~~~e~~ll~~~i~~i~~~~i~~~~~k~~~~d~~~~t~  207 (216)
T 2ywr_A          162 DENTLADRILKWEHKILPQTVQWFAQDRIIIDGRKVIVKDATYGTL  207 (216)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEETTCCCSCS
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEECCEEEECCCCCCCC
T ss_conf             9999999999999999999999998099899699888678985654


No 7  
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A*
Probab=100.00  E-value=0  Score=356.57  Aligned_cols=203  Identities=23%  Similarity=0.346  Sum_probs=190.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCC
Q ss_conf             5389997088679899998620467415899999773466777--886099747416873-3527767899999733394
Q gi|254780911|r   84 TKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNV  160 (288)
Q Consensus        84 ~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~  160 (288)
                      ||++||+||.||||++||++++.|+++++|++||||+++++++  ++.+++|...+.... .++.+.+..+.+.++++++
T Consensus         1 Mki~il~SG~Gsnl~~li~~~~~~~l~~~I~~Visn~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   80 (212)
T 1jkx_A            1 MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASAFDSREAYDRELIHEIDMYAP   80 (212)
T ss_dssp             CEEEEEESSCCHHHHHHHHHHHTTSSSSEEEEEEESCTTCHHHHHHHHTTCEEEECCGGGCSSHHHHHHHHHHHHGGGCC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             96999982780789999998871999987999994798753013544313122001123579988999999999997099


Q ss_pred             EEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCC
Q ss_conf             09998276754887786327784796133667678999958999742683762257753055688834444466518888
Q gi|254780911|r  161 ELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ  240 (288)
Q Consensus       161 DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~d  240 (288)
                      |++|+||||+|++++|++.|++++||+||||||+|+|++|+++|+.+|.+.+|+|+|+|++++|+||||.|..++|.++|
T Consensus        81 Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~~rG~~p~~~ai~ng~~~~G~Tih~v~~~~D~G~Ii~q~~~~I~~~d  160 (212)
T 1jkx_A           81 DVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGD  160 (212)
T ss_dssp             SEEEESSCCSCCCHHHHHHTTTSEEEEESSCTTSCCSSCHHHHHHHTTCSEEEEEEEECCSSTTCSCEEEEEEEECCTTC
T ss_pred             CEEEEECHHHHCCHHHHHHHCCCEEECCCHHCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCC
T ss_conf             99999361444588998763589688172000367777859999987998577579994078737985799998669999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECC--CCCCCC
Q ss_conf             9999999999999999999999987691788688579808--886763
Q gi|254780911|r  241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP--AYPNNY  286 (288)
Q Consensus       241 t~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~--~~~~~~  286 (288)
                      |.++|.+|++.+|+.+|++++++++++|+.++++++..++  .+|+.|
T Consensus       161 t~~~L~~ki~~~e~~ll~~~i~~~~~g~i~~~~~~~~~~~~r~p~dG~  208 (212)
T 1jkx_A          161 SEDDITARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGY  208 (212)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEETTEEEETTEECCTTCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCEEEECCCCCCCCCC
T ss_conf             999999999999999999999999819968859988999910798568


No 8  
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ}
Probab=100.00  E-value=0  Score=356.94  Aligned_cols=203  Identities=30%  Similarity=0.435  Sum_probs=187.7

Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             2445655389997088679899998620467415899999773466777--88609974741687335277678999997
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTEQNKIESEQKLINII  155 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~~~k~~~e~~il~~l  155 (288)
                      .+..+++|+|||+||.||||++|+++++.+.++++|++||||+++++++  ++.+++|+.+++....    .+.++.+.|
T Consensus         3 ~~m~k~mkIavl~SG~Gsnl~aii~~~~~~~~~~eI~~VIsn~~~~~~l~~~~~~~i~~~~~~~~~~----~~~~~~~~l   78 (215)
T 3kcq_A            3 GSMKKELRVGVLISGRGSNLEALAKAFSTEESSVVISCVISNNAEARGLLIAQSYGIPTFVVKRKPL----DIEHISTVL   78 (215)
T ss_dssp             ----CCEEEEEEESSCCHHHHHHHHHTCCC-CSEEEEEEEESCTTCTHHHHHHHTTCCEEECCBTTB----CHHHHHHHH
T ss_pred             CCCCCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEECCCCCC----CHHHHHHHH
T ss_conf             8889987899999398773999999977699883999999579641777677754998874266760----689999999


Q ss_pred             HHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEE
Q ss_conf             33394099982767548877863277847961336676789999589997426837622577530556888344444665
Q gi|254780911|r  156 EKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR  235 (288)
Q Consensus       156 ~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~  235 (288)
                      +++++|++|+|||||||+++|++.|++++||+||||||+|+|++|+.+|+..|+|.+|||+|+|++++|+||||.|..++
T Consensus        79 ~~~~~Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~~rG~~~~~~ai~~g~~~tG~Tih~v~~~~D~G~Ii~q~~~~  158 (215)
T 3kcq_A           79 REHDVDLVCLAGFMSILPEKFVTDWHHKIINIHPSLLPSFKGLNAQEQAYKAGVKIAGCTLHYVYQELDAGPIIMQAAVP  158 (215)
T ss_dssp             HHTTCSEEEESSCCSCCCHHHHHHTTTSEEEEESSCTTTTCSSCHHHHHHHHTCSEEEEEEEECCSSTTCSCEEEEEEEE
T ss_pred             HHCCCCEEEEECCCCCCCHHHHHHCCCCCEEECCCCCCCCCCCCHHHHHHHCCCCCCCCEEEEEECCCCCCCEEEEEEEE
T ss_conf             86599999990434207889975245665131885356679844077898779824275899970687689857899987


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCC
Q ss_conf             1888899999999999999999999999876917886885798088867
Q gi|254780911|r  236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPN  284 (288)
Q Consensus       236 v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~  284 (288)
                      |.++||.++|.+|++.+|+++|++++++++++++.+.+++++.-.+..+
T Consensus       159 I~~~dt~~~L~~r~~~~e~~l~~~~i~~i~~~~i~~~~q~~~~~t~~d~  207 (215)
T 3kcq_A          159 VLREDTAESLASRILAAEHVCYPKGVKLIAQDKIKLCDDGTVQCTGEDE  207 (215)
T ss_dssp             CCTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCEEECTTSCEEESSSCC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCEEECCCCC
T ss_conf             5999999999999999999999999999996994897799678068987


No 9  
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A*
Probab=100.00  E-value=0  Score=354.19  Aligned_cols=200  Identities=24%  Similarity=0.358  Sum_probs=187.7

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCH-HHHHHHHHCCCCEEECCCCC-CCHHHHHHHHHHHHH
Q ss_conf             4456553899970886798999986204674158999997734-66777886099747416873-352776789999973
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT-THKKLVENYQLPFYYLPMTE-QNKIESEQKLINIIE  156 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~-d~~~lA~~~gIP~~~i~~~~-~~k~~~e~~il~~l~  156 (288)
                      ..+.++|+|||+||.||||++|+++.+ |+++++|++|++|++ .+..+|+++|||+++++..+ .+|+++|.++++.++
T Consensus         8 ~~~~p~riavl~SG~Gsnl~aLi~~~~-~~~~~~iv~vi~~~~~~~~~~A~~~gIp~~~i~~~~~~~r~~~~~~l~~~l~   86 (215)
T 3da8_A            8 PPSAPARLVVLASGTGSLLRSLLDAAV-GDYPARVVAVGVDRECRAAEIAAEASVPVFTVRLADHPSRDAWDVAITAATA   86 (215)
T ss_dssp             CCCSSEEEEEEESSCCHHHHHHHHHSS-TTCSEEEEEEEESSCCHHHHHHHHTTCCEEECCGGGSSSHHHHHHHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHHC-CCCCCEEEEEEECCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             999988899998368265999999637-7999779999967856688999983997377405788999999999999987


Q ss_pred             HCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEEC
Q ss_conf             33940999827675488778632778479613366767899995899974268376225775305568883444446651
Q gi|254780911|r  157 KNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV  236 (288)
Q Consensus       157 ~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v  236 (288)
                      ++++|++|++|||+||+++|++.|++++||+||||||.|+|.+|+.+|+..|++.+|+|+|+|++++|+||||.|..++|
T Consensus        87 ~~~~Dliv~~g~~~il~~~~l~~~~~~~iN~HpslLP~~rG~~~~~~ai~~g~~~~G~TiH~v~~~iD~G~Ii~q~~~~i  166 (215)
T 3da8_A           87 AHEPDLVVSAGFMRILGPQFLSRFYGRTLNTHPALLPAFPGTHGVADALAYGVKVTGATVHLVDAGTDTGPILAQQPVPV  166 (215)
T ss_dssp             TTCCSEEEEEECCSCCCHHHHHHHTTTEEEEESSCTTSSCSTTHHHHHHHHTCSEEEEEEEECCSSSSCSCEEEEEEEEC
T ss_pred             HCCCCEEEECCHHHHCCHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEEEEC
T ss_conf             60999999846133468888642204875078887988899885599998399673328999627873797479999876


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEEC
Q ss_conf             8888999999999999999999999998769178868857980
Q gi|254780911|r  237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF  279 (288)
Q Consensus       237 ~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf  279 (288)
                      .++||.++|.+|++.+|+++|+++++.++++++...+++....
T Consensus       167 ~~~dt~~~L~~k~~~~~~~ll~~~l~~i~~~~i~~~~~~a~~~  209 (215)
T 3da8_A          167 LDGDDEETLHERIKVTERRLLVAAVAALATHGVTVVGRTATMG  209 (215)
T ss_dssp             CTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHCEEEETTEEEEC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEECCCEEEEC
T ss_conf             9999999999999999999999999999949967889884884


No 10 
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A*
Probab=100.00  E-value=1.4e-45  Score=338.78  Aligned_cols=202  Identities=28%  Similarity=0.398  Sum_probs=190.0

Q ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCCE
Q ss_conf             389997088679899998620467415899999773466777--886099747416873-35277678999997333940
Q gi|254780911|r   85 KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVE  161 (288)
Q Consensus        85 riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~D  161 (288)
                      |+|||+||.||||++|+++++.|+++++|++||||+++++++  |+.+++|+..+.... ..+.+.+.++.+.++++++|
T Consensus         2 ki~vl~SG~GSnl~aLl~~~~~~~~~~eI~~Vitn~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~D   81 (209)
T 1meo_A            2 RVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSID   81 (209)
T ss_dssp             EEEEEESSSCTTHHHHHHHHHSTTCSCEEEEEEESSTTCHHHHHHHHTTCCEEECCGGGSSSHHHHHHHHHHHHHHTTCC
T ss_pred             EEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             89999837846599999987669999789999988976777778886296245540456689888899999999861999


Q ss_pred             EEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCCC
Q ss_conf             99982767548877863277847961336676789999589997426837622577530556888344444665188889
Q gi|254780911|r  162 LMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT  241 (288)
Q Consensus       162 livLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~dt  241 (288)
                      ++|++|||+|+++++++.|+.++||+||||||+|+|++|+.+|+..|.+.+|+|+|+|++++|+||||.|..++|.++||
T Consensus        82 liv~~g~~~ii~~~il~~~~~~~iN~HpslLP~~rG~~~~~~ai~~g~~~~G~Tih~v~~~iD~G~Ii~q~~~~I~~~dt  161 (209)
T 1meo_A           82 IVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDT  161 (209)
T ss_dssp             EEEEESCCSCCCHHHHHHTTTSEEEEESSSTTSSCSSCHHHHHHHHTCSEEEEEEEECCC---CCCEEEEEEEECCTTCC
T ss_pred             EEEEECCCHHCCHHHHHHHHCCCEECCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEEEEEECCCCCC
T ss_conf             99995600107789998760795875786677777864999999859916867988964788589858999987699999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             999999999999999999999987691788688579808886763
Q gi|254780911|r  242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       242 ~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                      .++|..|+.++|+++|+++++.++++++.+..+..+.|-.....|
T Consensus       162 ~~~L~~k~~~~~~~ll~~~i~~i~~g~i~~~e~~~i~~~k~~~~~  206 (209)
T 1meo_A          162 VATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWVKEEHHH  206 (209)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTSEEECTTSSEEECCCSCC-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCEEEEECCCCCC
T ss_conf             999999999999999999999998299698899879986265455


No 11 
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1
Probab=99.97  E-value=1.4e-29  Score=225.63  Aligned_cols=174  Identities=17%  Similarity=0.261  Sum_probs=151.9

Q ss_pred             CCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECCH---------HHHHHHHHCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             53899970886--798999986204674158999997734---------6677788609974741687335277678999
Q gi|254780911|r   84 TKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNHT---------THKKLVENYQLPFYYLPMTEQNKIESEQKLI  152 (288)
Q Consensus        84 ~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~~---------d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il  152 (288)
                      ||+++|.|..-  .||++|+.+      +.+|++|++..+         ....+|+++|||++...  +-+    +.+.+
T Consensus         1 Mki~~~g~~~~~~~~l~~L~~~------~~~i~~V~t~~d~~~~~~~~~~v~~~a~~~~i~~~~~~--~~~----~~~~~   68 (660)
T 1z7e_A            1 MKTVVFAYHDMGCLGIEALLAA------GYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPD--NVN----HPLWV   68 (660)
T ss_dssp             CEEEEEECHHHHHHHHHHHHHT------TCEEEEEECCCC--------CCHHHHHHHHTCCEECCS--CTT----SHHHH
T ss_pred             CEEEEEECCHHHHHHHHHHHHC------CCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCEECCC--CCC----CHHHH
T ss_conf             9599990768999999999978------99789998389999776788879999998799788469--899----89999


Q ss_pred             HHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEE
Q ss_conf             99733394099982767548877863277847961336676789999589997426837622577530556888344444
Q gi|254780911|r  153 NIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD  232 (288)
Q Consensus       153 ~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~  232 (288)
                      +.+++.++|+++.++|.+||++++++.++.++||+||||||.|+|+.|+++|+-.|.+.+|+|+|++++++|+||||+|.
T Consensus        69 ~~l~~~~~D~~~~~~~~~ii~~~~l~~~~~g~iN~H~slLP~~RG~~p~~wai~~g~~~~gvt~~~~~~~~D~G~I~~q~  148 (660)
T 1z7e_A           69 ERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQL  148 (660)
T ss_dssp             HHHHHHCCSEEEEESCCSCCCHHHHTTCTTCEEEEESSSTTTTCSSCHHHHHHHTTCSEEEEEEEECCSSTTTSCEEEEE
T ss_pred             HHHHHCCCCEEEEEHHHHHCCHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHCCCCCEEEEEEEECCCCCCCCCCEEE
T ss_conf             99984598999983222245999981588888998887575667817899999869980326999954787667601366


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEE
Q ss_conf             6651888899999999999999999999999876917
Q gi|254780911|r  233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRV  269 (288)
Q Consensus       233 ~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv  269 (288)
                      .+++.++||..+|..+..++...++.+++..+.++..
T Consensus       149 ~~~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~  185 (660)
T 1z7e_A          149 RIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNI  185 (660)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHTTTCC
T ss_pred             ECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             0356887779999999999999999999999976998


No 12 
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A
Probab=99.97  E-value=2.5e-29  Score=223.88  Aligned_cols=175  Identities=17%  Similarity=0.264  Sum_probs=153.5

Q ss_pred             CCEEEEEC-CCC-CCHHHHHHHHCCCCCEEEEEEEEECCHH---------HHHHHHHCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             53899970-886-7989999862046741589999977346---------677788609974741687335277678999
Q gi|254780911|r   84 TKTLILVS-QPD-HCLNDLLYRWNIGTLALNIVGVVSNHTT---------HKKLVENYQLPFYYLPMTEQNKIESEQKLI  152 (288)
Q Consensus        84 ~riailvS-g~g-snL~~Ll~~~~~g~L~~eI~~VISN~~d---------~~~lA~~~gIP~~~i~~~~~~k~~~e~~il  152 (288)
                      ||++||.| ..| .||++|+.+      ..+|++|+++.+.         ...+|+++|||++...  +.+    +.++.
T Consensus         1 Mkiv~~~~~~~~~~~l~~L~~~------~~~i~~V~t~~~~~~~~~~~~~v~~~a~~~~ip~~~~~--~~~----~~~~~   68 (305)
T 2bln_A            1 MKTVVFAYHDMGCLGIEALLAA------GYEISAIFTHTDNPGEKAFYGSVARLAAERGIPVYAPD--NVN----HPLWV   68 (305)
T ss_dssp             CEEEEEECHHHHHHHHHHHHHT------TCEEEEEECCCC------CCCCHHHHHHHHTCCEECCS--CCC----SHHHH
T ss_pred             CEEEEECCCHHHHHHHHHHHHC------CCCEEEEEECCCCCCCCCCCCHHHHHHHHCCCCEECCC--CCC----CHHHH
T ss_conf             9599992778999999999978------99889999089999887898989999998699898459--899----89999


Q ss_pred             HHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEE
Q ss_conf             99733394099982767548877863277847961336676789999589997426837622577530556888344444
Q gi|254780911|r  153 NIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD  232 (288)
Q Consensus       153 ~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~  232 (288)
                      +.+++.++|+++.++|++|+++++++.++..++|+|||+||.|+|..|+.+|+.+|.+.+|+|+|++++++|+||||.|.
T Consensus        69 ~~l~~~~~dl~i~~~~~~ii~~~il~~~~~~~lN~HpslLP~yRG~~p~~wai~~g~~~~g~tih~~~~~~D~G~Ii~q~  148 (305)
T 2bln_A           69 ERIAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQL  148 (305)
T ss_dssp             HHHHHTCCSEEEEESCCSCCCHHHHTTCTTCEEEEESSCTTTTEESCHHHHHHHTTCSEEEEEEEECCSSTTCSCEEEEE
T ss_pred             HHHHHCCCCEEEEEHHHHHCCHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCEEEE
T ss_conf             99983299999986321240499997321032032234377467852899999779886575222310466788710450


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             66518888999999999999999999999998769178
Q gi|254780911|r  233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       233 ~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      .+++.++||.++|..+...+...++.+.++.+.++...
T Consensus       149 ~~~i~~~~~~~~l~~k~~~~~~~ll~~~l~~l~~~~~~  186 (305)
T 2bln_A          149 RIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNIL  186 (305)
T ss_dssp             EEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             34554323277889999888888789999999759976


No 13 
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A*
Probab=99.96  E-value=3.2e-28  Score=216.20  Aligned_cols=178  Identities=20%  Similarity=0.246  Sum_probs=153.6

Q ss_pred             CCCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECC------------HHHHHHHHHCCCCEEECCCCCCCHHH
Q ss_conf             56553899970886--79899998620467415899999773------------46677788609974741687335277
Q gi|254780911|r   81 KEATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNH------------TTHKKLVENYQLPFYYLPMTEQNKIE  146 (288)
Q Consensus        81 ~~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~------------~d~~~lA~~~gIP~~~i~~~~~~k~~  146 (288)
                      +.+|||+.|.|..=  .||++|+..      ..+|++|+|.-            .....+|+++|||++...  +.+.  
T Consensus         1 ~~~mkI~f~Gs~~~a~~~L~~L~~~------~~~i~~VvT~pd~~~grg~~~~~~~v~~~A~~~~i~~~~~~--~~~~--   70 (314)
T 1fmt_A            1 SESLRIIFAGTPDFAARHLDALLSS------GHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPV--SLRP--   70 (314)
T ss_dssp             CCCCEEEEEECSHHHHHHHHHHHHT------TCEEEEEECCCCBC------CBCCHHHHHHHHTTCCEECCS--CSCS--
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHC------CCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCC--CCCC--
T ss_conf             9962899988988999999999978------99779999099985568884889979999998599840352--3462--


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCC
Q ss_conf             67899999733394099982767548877863277847961336676789999589997426837622577530556888
Q gi|254780911|r  147 SEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG  226 (288)
Q Consensus       147 ~e~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~G  226 (288)
                        .+..+.+++.++|++|.++|.+++++++++.++..+||+||||||.|+|+.|+++|+-+|.+.+|+|+|++++++|+|
T Consensus        71 --~~~~~~~~~~~~dl~i~~~~~~iip~~~l~~~~~g~iN~H~slLP~yRG~~pi~wail~g~~~~Gvti~~~~~~~D~G  148 (314)
T 1fmt_A           71 --QENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTG  148 (314)
T ss_dssp             --HHHHHHHHHTTCSEEEEESCCSCCCHHHHHSSTTCEEEEESSSTTTTBSSCHHHHHHHHTCSEEEEEEEECCSSSSCS
T ss_pred             --HHHHHHHHHCCCCEEEEEECCCCCCHHHHHCCCCCEEECCCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCC
T ss_conf             --889999985199999997126469999985789777825555477766758899999779975315999962675677


Q ss_pred             CEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             34444466518888999999999999999999999998769178
Q gi|254780911|r  227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       227 pII~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      ||++|..+++.++||.++|..+.......++.+++....++...
T Consensus       149 ~Ii~q~~~~i~~~~t~~~L~~k~~~~~~~ll~~~l~~l~~~~~~  192 (314)
T 1fmt_A          149 DMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLADGTAK  192 (314)
T ss_dssp             CEEEEEEEECCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHTCCC
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             71478996304565389999998764215668899998669964


No 14 
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A
Probab=99.96  E-value=1.2e-28  Score=219.12  Aligned_cols=191  Identities=17%  Similarity=0.114  Sum_probs=158.1

Q ss_pred             CCCEECC-CCCCCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECC------HHHHHHHHHCCCCEEECCCCCC
Q ss_conf             3202012-4456553899970886--79899998620467415899999773------4667778860997474168733
Q gi|254780911|r   72 SLQYSIR-NTKEATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNH------TTHKKLVENYQLPFYYLPMTEQ  142 (288)
Q Consensus        72 ~m~~~i~-~~~~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~------~d~~~lA~~~gIP~~~i~~~~~  142 (288)
                      +|+++.- ..-.+|||++|.|..-  .+|..|+.   +   ..+|++|++.-      ......|+++|||.+... +-.
T Consensus        10 ~~~~~~~~~~~~~mkIvf~G~~~f~~~~l~~L~~---~---~~~i~~V~T~pdk~~~~~~v~~~a~~~~ipv~~~~-~~~   82 (329)
T 2bw0_A           10 GVDLGTENLYFQSMKIAVIGQSLFGQEVYCHLRK---E---GHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYS-RWR   82 (329)
T ss_dssp             -----------CCCEEEEECCHHHHHHHHHHHHH---T---TCEEEEEEECCCCSSCCCHHHHHHHHHTCCEEECS-CCE
T ss_pred             CCEEEHHHHHHHCCEEEEECCCHHHHHHHHHHHH---C---CCCEEEEEECCCCCCCCCHHHHHHHHHCCCEECCC-CCC
T ss_conf             6311100043223089999697999999999998---8---89789999089988898969999998199886443-367


Q ss_pred             CHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             52776789999973339409998276754887786327784796133667678999958999742683762257753055
Q gi|254780911|r  143 NKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE  222 (288)
Q Consensus       143 ~k~~~e~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~  222 (288)
                      +......++++.+++.++|++|+++|.+|||.++++.++..+||+||||||.|+|+.|+++|+-.|.+.+|+|+|+++++
T Consensus        83 ~~~~~~~e~~~~l~~~~~Dl~v~~~~~~iip~~il~~~~~g~iN~HpSlLP~yRG~~pi~waIl~g~~~tGvTi~~~~~~  162 (329)
T 2bw0_A           83 AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDG  162 (329)
T ss_dssp             ETTEECHHHHHHHHTTCCSEEEESSCSSCCCHHHHTCSTTCEEEEESSCTTTTBSSCHHHHHHHTTCSEEEEEEEECCSS
T ss_pred             CCCCCCHHHHHHHHHHCCCEEEEECCHHHCCHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHCCCCCCCCEEEEECCC
T ss_conf             61204899999999629699999061243779886347898899947888666785667999975987414156641356


Q ss_pred             CCCCCEEEEEEEECCCCCCHHHHHHHH-HHHHHHHHHHHHHHHHCCEE
Q ss_conf             688834444466518888999999999-99999999999999876917
Q gi|254780911|r  223 LDAGPIIEQDVVRVTHAQTIEDYIAIG-KNIEAKVLTKAVNAHIQQRV  269 (288)
Q Consensus       223 lD~GpII~Q~~~~v~~~dt~~~l~~~~-~~~E~~~l~~av~~~~e~rv  269 (288)
                      +|+|||+.|..++|.++||..+|..|. ...-..++.++++.+.++..
T Consensus       163 ~D~G~Il~q~~~~I~~~~t~~~L~~k~l~~~~~~l~~~~l~~i~~~~~  210 (329)
T 2bw0_A          163 LDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKA  210 (329)
T ss_dssp             SSCSCEEEEEEEECCTTCCHHHHHHHTTTHHHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             676771026774126756677899999888788876778776543785


No 15 
>1zgh_A Methionyl-tRNA formyltransferase; southeast collaboratory for structural genomics, PSI, protein structure initiative, secsg; 2.05A {Clostridium thermocellum atcc 27405} SCOP: b.46.1.1 c.65.1.1
Probab=99.87  E-value=6.8e-22  Score=172.04  Aligned_cols=160  Identities=15%  Similarity=0.207  Sum_probs=119.2

Q ss_pred             CCCCCHHHHHHHHCCCCCEEEEEEEEECCH----HHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             886798999986204674158999997734----6677788609974741687335277678999997333940999827
Q gi|254780911|r   92 QPDHCLNDLLYRWNIGTLALNIVGVVSNHT----THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus        92 g~gsnL~~Ll~~~~~g~L~~eI~~VISN~~----d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      .+|+++..|..+..  ..+.   ++.|.++    ....+.++....+...-..  ++.+   ..++.++..+||+|+++|
T Consensus        16 ~r~s~~~~~~~k~~--~~~~---i~~~~k~w~~~~~~~~~~~~~~~~~~~~~~--~~~~---~~~~~l~~~~pd~i~~~~   85 (260)
T 1zgh_A           16 PRGSQSTSLYKKAG--LMNI---IIATTKSWNIKNAQKFKKENESKYNTTIIT--NKDE---LTFEKVKLINPEYILFPH   85 (260)
T ss_dssp             ----------------CEEE---EEECCSHHHHHHHHHHHHHTTTTEEEEEEC--SGGG---CCHHHHHHHCCSEEEESS
T ss_pred             CCHHHHHHHHHHCC--CCEE---EEEECCHHHHHHHHHHHHHHCCCCEEEEEC--CCCH---HHHHHHHHCCCCEEEEEC
T ss_conf             52577776987446--4309---999331656899999998614222268861--8468---789999853989999827


Q ss_pred             CCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCCCHHHHHH
Q ss_conf             67548877863277847961336676789999589997426837622577530556888344444665188889999999
Q gi|254780911|r  168 YMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIA  247 (288)
Q Consensus       168 ymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~dt~~~l~~  247 (288)
                      |++|+++++++.|  ++||+|||+||.|+|++|+.+|+.+|.+.+|+|+|+|++++|+||||.|..+++.  +|.+++..
T Consensus        86 ~~~ii~~~il~~~--~~in~H~s~LP~~rG~~p~~~~i~~~~~~~g~t~~~~~~~iD~G~Ii~q~~i~i~--~~~~~l~~  161 (260)
T 1zgh_A           86 WSWIIPKEIFENF--TCVVFHMTDLPFGRGGSPLQNLIERGIKKTKISAIKVDGGIDTGDIFFKRDLDLY--GTAEEIFM  161 (260)
T ss_dssp             CCSCCCHHHHTTS--CEEEEESSCTTTTEESCHHHHHHHTTCCEEEEEEEECCSSSSCSCEEEEEEEECC--SCHHHHHH
T ss_pred             CCCCCCHHHHHHC--CEEEECCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEECCCCCCCCCEEEEEEEEC--CCHHHHHH
T ss_conf             0011389999539--9799826737577899988999974555463489973688758998458889865--87146789


Q ss_pred             HHHHHHHHHHHHHHHHHHCCE
Q ss_conf             999999999999999987691
Q gi|254780911|r  248 IGKNIEAKVLTKAVNAHIQQR  268 (288)
Q Consensus       248 ~~~~~E~~~l~~av~~~~e~r  268 (288)
                      +   +...++...+..+..+.
T Consensus       162 k---~~~~~~~~li~~i~~~~  179 (260)
T 1zgh_A          162 R---ASKIIFNDMIPELLTKR  179 (260)
T ss_dssp             H---HHHHHHHTHHHHHHHHC
T ss_pred             H---HHHHHHHHHHHHHHCCC
T ss_conf             9---99999998888875589


No 16 
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria}
Probab=99.71  E-value=5.4e-18  Score=144.82  Aligned_cols=184  Identities=10%  Similarity=0.030  Sum_probs=132.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEE----
Q ss_conf             9649999985998766888999998579818973444324368899999997288527779888987400232020----
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYS----   76 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~----   76 (288)
                      ++++++|+.|||||||+|+||++|+++|+||++++|++..+...+++++++..+. ...+++.+.....++.+.+.    
T Consensus         3 ~~~~vitv~g~DrpGlva~vt~~L~~~g~nI~ds~~~~~~~~~~~~~~v~~~~~~-~~~l~~~l~~~~~~l~~~~~~~~~   81 (195)
T 2nyi_A            3 TQSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLNAKD-GKLIQSALESALPGFQISTRRASS   81 (195)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEESSSS-SHHHHHHHHHHSTTCEEEEEECCC
T ss_pred             CEEEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCEEEEEEEECCCCC-HHHHHHHHHHHHHHHHEEEEECCC
T ss_conf             3499999992698878999999999879979985858824772899874013431-022577899987442043320454


Q ss_pred             CCCCCCCCCE-EEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEE----CCCCCCCHHHHHHHH
Q ss_conf             1244565538-99970886798999986204674158999997734667778860997474----168733527767899
Q gi|254780911|r   77 IRNTKEATKT-LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYY----LPMTEQNKIESEQKL  151 (288)
Q Consensus        77 i~~~~~~~ri-ailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~----i~~~~~~k~~~e~~i  151 (288)
                      ......+++. ...++-.|++...||+++ .+.|...-.-|.++|....+.+. .|.|+++    ++....++.+.++++
T Consensus        82 ~~~~~~~~~~~~~vv~v~~~DrpGLL~~i-t~~La~~~inI~~~~~~~~~~~~-~~~~~F~~~~~i~~p~~~~~~l~~~L  159 (195)
T 2nyi_A           82 VAERHVSPDTREYELYVEGPDSEGIVEAV-TAVLAKKGANIVELETETLPAPF-AGFTLFRMGSRVAFPFPLYQEVVTAL  159 (195)
T ss_dssp             C----CCTTEEEEEEEEEEECCTTHHHHH-HHHHHHTTCEEEEEEEEEEECSS-TTCEEEEEEEEEEEEGGGHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEEEEEECCCHHHHHHH-HHHHHHCCCEEEEEEEEEECCCC-CCCCCEEEEEEEECCCCCHHHHHHHH
T ss_conf             11113477741899999506887899999-99997669519980212661676-78852899999967967589999999


Q ss_pred             HHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEEC
Q ss_conf             9997333940999827675488778632778479613
Q gi|254780911|r  152 INIIEKNNVELMILARYMQILSDHLCHKMTGRIINIH  188 (288)
Q Consensus       152 l~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiH  188 (288)
                      .++.++.++|+- +-..++.-+.+=-+.+||++||+|
T Consensus       160 ~~l~~el~vdi~-v~~~~~~~~~~~~~~~~~~~~~~~  195 (195)
T 2nyi_A          160 SRVEEEFGVDID-LEEVVEGEDSEEDDDSPNSPVGRH  195 (195)
T ss_dssp             HHHHHHHTCEEE-EEECC-------------------
T ss_pred             HHHHHHHCCEEE-EEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             999999696899-998777788633445864312379


No 17 
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4} SCOP: d.58.18.7
Probab=99.63  E-value=9.5e-16  Score=129.18  Aligned_cols=80  Identities=19%  Similarity=0.195  Sum_probs=69.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCCC
Q ss_conf             96499999859987668889999985798189734443243688999999972885277798889874002320201244
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNT   80 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~   80 (288)
                      | ++|||++|||||||||+||++|+++|+||++++|+++.+.+.+.|++++..+.+.+.++++|..++++++|+|+++..
T Consensus         4 m-k~vitv~g~DrpGIva~vt~~L~~~g~NI~d~~q~~~~~~F~~~~~v~~~~~~~~~~l~~~l~~la~~l~l~i~i~~e   82 (91)
T 1zpv_A            4 M-KAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTMMAVVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSA   82 (91)
T ss_dssp             E-EEEEEEEESCCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEESSCCCHHHHHHHHHHHHHHHTEEEEEEEG
T ss_pred             E-EEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEECCCEEEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEHH
T ss_conf             2-899999908978789999999998799499845089537128999996499999999999999999983968999808


Q ss_pred             C
Q ss_conf             5
Q gi|254780911|r   81 K   81 (288)
Q Consensus        81 ~   81 (288)
                      +
T Consensus        83 ~   83 (91)
T 1zpv_A           83 A   83 (91)
T ss_dssp             G
T ss_pred             H
T ss_conf             9


No 18 
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5
Probab=99.48  E-value=1.6e-12  Score=106.67  Aligned_cols=157  Identities=11%  Similarity=0.085  Sum_probs=100.0

Q ss_pred             CCE-EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCC
Q ss_conf             964-9999985998766888999998579818973444324368899999997288527779888987400232020124
Q gi|254780911|r    1 MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRN   79 (288)
Q Consensus         1 M~~-~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~   79 (288)
                      |++ +++|+.|||||||+|+||++|+++||||++++|++..+...+.|+++++. ...+.++..+..+.+++++.+.+..
T Consensus         3 M~~~lvItv~g~DrpGiva~ia~~l~~~g~ni~ds~~~~~~~~f~~~~~v~~~~-~~~~~l~~~l~~l~~~~~~~~~~~~   81 (192)
T 1u8s_A            3 LTQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISGSP-SNITRVETTLPLLGQQHDLITMMKR   81 (192)
T ss_dssp             CCEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEECH-HHHHHHHHHHHHHHHHHTCEEEEEE
T ss_pred             CCEEEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEECCEEEEEEEEECCC-HHHHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             632899999935998599999999998799699727889998489999971481-1367999999998775274378897


Q ss_pred             ----CCCCCCEEEEECCCCCCHHHHHH----HHCCCCCEEEEE-EEEECCHHHHHHHHHCCCCEEE------CCCCCCCH
Q ss_conf             ----45655389997088679899998----620467415899-9997734667778860997474------16873352
Q gi|254780911|r   80 ----TKEATKTLILVSQPDHCLNDLLY----RWNIGTLALNIV-GVVSNHTTHKKLVENYQLPFYY------LPMTEQNK  144 (288)
Q Consensus        80 ----~~~~~riailvSg~gsnL~~Ll~----~~~~g~L~~eI~-~VISN~~d~~~lA~~~gIP~~~------i~~~~~~k  144 (288)
                          .......-..++-.|++.-.|++    ...+-.++++-. .-....+..     ..|.|.++      +| ...+.
T Consensus        82 ~~~~~~~~~~~~~~v~v~g~DrpGlL~~It~~la~~~inI~~l~~~t~~~~~~-----~~~~~~f~~~~~i~vp-~~~d~  155 (192)
T 1u8s_A           82 TSPHDHQTHAYTVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISKDKL-----HSEQNQFHIAISARVD-SGCNL  155 (192)
T ss_dssp             ECCCCCCCCSEEEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEEEC-------------CEEEEEEEEEEC-TTSCH
T ss_pred             CCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCC-----CCCCCEEEEEEEEECC-CCCCH
T ss_conf             15444467751699999951762689999999986799700589984267766-----7778579999999579-99999


Q ss_pred             HHHHHHHHHHHHHCCCEEEE
Q ss_conf             77678999997333940999
Q gi|254780911|r  145 IESEQKLINIIEKNNVELMI  164 (288)
Q Consensus       145 ~~~e~~il~~l~~~~~Dliv  164 (288)
                      ++.++++.+++++.++|..+
T Consensus       156 ~~l~~~L~~L~~el~vDi~i  175 (192)
T 1u8s_A          156 MQLQEEFDALCTALDVQGSL  175 (192)
T ss_dssp             HHHHHHHHHHHHHHTCEEEE
T ss_pred             HHHHHHHHHHHHHHCCEEEE
T ss_conf             99999999999985967999


No 19 
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}
Probab=98.96  E-value=2.6e-08  Score=77.28  Aligned_cols=115  Identities=17%  Similarity=0.229  Sum_probs=74.9

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEE--EEEECCC-CHHHHHHHHHHHHCCCCCCEECCC
Q ss_conf             4999998599876688899999857981897344432436889999--9997288-527779888987400232020124
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR--ISFVFNT-CMKLFIADFQPIVQQFSLQYSIRN   79 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmR--i~f~~~~-~~~~l~~~f~~ia~~~~m~~~i~~   79 (288)
                      +.++|++|+||||||+.+|+.|+++|+||+|++|.+-.+  .|-|-  ++...+. ..+.+..++...+..+++++++..
T Consensus        12 ~~lit~~G~DrpGiv~~l~~~l~~~~~ni~d~~~~~l~g--~f~l~ilv~~~~~~~~~~~l~~~L~~~~~~l~l~v~~~~   89 (415)
T 3p96_A           12 SVLITVTGVDQPGVTATLFEVLSRHGVELLNVEQVVIRH--RLTLGVLVCCPADVADGPALRHDVEAAIRKVGLDVSIER   89 (415)
T ss_dssp             EEEEEEEEECCTTHHHHHHHHHTTTTCEEEEEEEEEETT--EEEEEEEEEECHHHHTSHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEECC--EEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             899999818987099999999997799889855389978--888999998148744499999999999997097479984


Q ss_pred             CC------CCCCEEEEECCCC---CCHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             45------6553899970886---7989999862046741589999977
Q gi|254780911|r   80 TK------EATKTLILVSQPD---HCLNDLLYRWNIGTLALNIVGVVSN  119 (288)
Q Consensus        80 ~~------~~~riailvSg~g---snL~~Ll~~~~~g~L~~eI~~VISN  119 (288)
                      .+      ...+..+.+-|..   .-+.++........++++=..-.+.
T Consensus        90 ~~~~~~~~~~~~~~v~v~g~~~~pgiv~~vt~~la~~~~ni~~i~r~~~  138 (415)
T 3p96_A           90 SDDVPIIREPSTHTIFVLGRPITAAAFGAVAREVAALGVNIDLIRGVSD  138 (415)
T ss_dssp             CSSSCSSCCCCSEEEEEEESSCCHHHHHHHHHHHHHTTCEEEEEEEEES
T ss_pred             CCCCHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             4642210467607999975889869999999999965975323324567


No 20 
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5
Probab=98.88  E-value=1.5e-08  Score=78.95  Aligned_cols=83  Identities=10%  Similarity=0.182  Sum_probs=70.5

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECC------CCCEEEEEEEEECC--CCHHHHHHHHHHHHCCCCCC
Q ss_conf             49999985998766888999998579818973444324------36889999999728--85277798889874002320
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL------DTSKLFMRISFVFN--TCMKLFIADFQPIVQQFSLQ   74 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~------~~~~FFmRi~f~~~--~~~~~l~~~f~~ia~~~~m~   74 (288)
                      .|.+++.|+|++||+++||++|++.|.||.++...+..      ....|.|.+++...  .+.+.+++.|..++++++++
T Consensus        93 ~~~v~v~g~DrpGlL~~It~~la~~~inI~~l~~~t~~~~~~~~~~~~f~~~~~i~vp~~~d~~~l~~~L~~L~~el~vD  172 (192)
T 1u8s_A           93 TVEVYVESDDKLGLTEKFTQFFAQRQIGMASLSAQTISKDKLHSEQNQFHIAISARVDSGCNLMQLQEEFDALCTALDVQ  172 (192)
T ss_dssp             EEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEEEC--------CEEEEEEEEEECTTSCHHHHHHHHHHHHHHHTCE
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCE
T ss_conf             69999995176268999999998679970058998426776677785799999995799999999999999999985967


Q ss_pred             EECCCCCCCCC
Q ss_conf             20124456553
Q gi|254780911|r   75 YSIRNTKEATK   85 (288)
Q Consensus        75 ~~i~~~~~~~r   85 (288)
                      +.+......++
T Consensus       173 i~i~~~~~~~~  183 (192)
T 1u8s_A          173 GSLNFIKNSQE  183 (192)
T ss_dssp             EEEEEEEC---
T ss_pred             EEEEECCCCCC
T ss_conf             99997647512


No 21 
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria}
Probab=98.52  E-value=5.6e-07  Score=68.01  Aligned_cols=80  Identities=16%  Similarity=0.297  Sum_probs=65.4

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCC--C--CEEEEEEEEECCC-CHHHHHHHHHHHHCCCCCCEEC
Q ss_conf             499999859987668889999985798189734443243--6--8899999997288-5277798889874002320201
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD--T--SKLFMRISFVFNT-CMKLFIADFQPIVQQFSLQYSI   77 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~--~--~~FFmRi~f~~~~-~~~~l~~~f~~ia~~~~m~~~i   77 (288)
                      .+++.+.|+|++||+++||+.|++.|.||.+++..+...  +  ..|.|...+..+. ..+++++.|..+++++++++.+
T Consensus        93 ~~vv~v~~~DrpGLL~~it~~La~~~inI~~~~~~~~~~~~~~~~~F~~~~~i~~p~~~~~~l~~~L~~l~~el~vdi~v  172 (195)
T 2nyi_A           93 EYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRMGSRVAFPFPLYQEVVTALSRVEEEFGVDIDL  172 (195)
T ss_dssp             EEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTCEEEEEEEEEEEEGGGHHHHHHHHHHHHHHHTCEEEE
T ss_pred             EEEEEEEECCCHHHHHHHHHHHHHCCCEEEEEEEEEECCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCEEEE
T ss_conf             89999950688789999999997669519980212661676788528999999679675899999999999996968999


Q ss_pred             CCCCC
Q ss_conf             24456
Q gi|254780911|r   78 RNTKE   82 (288)
Q Consensus        78 ~~~~~   82 (288)
                      .+..+
T Consensus       173 ~~~~~  177 (195)
T 2nyi_A          173 EEVVE  177 (195)
T ss_dssp             EECC-
T ss_pred             EECCC
T ss_conf             98777


No 22 
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12
Probab=97.98  E-value=3.4e-05  Score=55.56  Aligned_cols=138  Identities=11%  Similarity=0.087  Sum_probs=82.1

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEE---CCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCCC
Q ss_conf             99999859987668889999985798189734443---243688999999972885277798889874002320201244
Q gi|254780911|r    4 YILTITCPSNEEITSIIPDYLSTQGCNILDISQFN---DLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNT   80 (288)
Q Consensus         4 ~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~---D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~   80 (288)
                      +-|.+.|.|++|+.+.||+.++++++||..++|+.   +...+.+++..+.+. .+.+.+.+.+..+-.-.  +++++..
T Consensus         5 ~aL~I~a~DRpGVLadIT~IIAe~giNI~sI~q~i~~~g~~~g~~~I~~EiE~-~dle~LI~kLr~L~~V~--~Ve~h~s   81 (223)
T 1y7p_A            5 RGLRIIAENKIGVLRDLTTIIAEEGGNITFAQTFLIKHGEHEGKALIYFEIEG-GDFEKILERVKTFDYII--EIEEEES   81 (223)
T ss_dssp             EEEEEEEECCTTHHHHHHHHCC----CEEEEEEEECCSSTTTTEEEEEEEECS-SCHHHHHHHHHTCTTEE--EEEEECC
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCEEEEEEEEECC-CCHHHHHHHHHCCCCCE--EEEEECC
T ss_conf             89999995688969999999996699966798513468876449999998145-78999999997799960--8999775


Q ss_pred             C---CCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEE-----ECCCCCCCHHHHHHH
Q ss_conf             5---655389997088679899998620467415899999773466777--886099747-----416873352776789
Q gi|254780911|r   81 K---EATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFY-----YLPMTEQNKIESEQK  150 (288)
Q Consensus        81 ~---~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~-----~i~~~~~~k~~~e~~  150 (288)
                      -   --+|+.|+-  .|.-    .-.                 -..+++  |++|+|--.     .+|...  .++.-.+
T Consensus        82 l~kIfGkRvIi~g--~g~q----v~q-----------------va~gai~Eadrhnirgerisvdtip~~G--e~~l~eA  136 (223)
T 1y7p_A           82 FERVFGKRVIILG--GGAL----VSQ-----------------VAIGAISEADRHNLRGERISVDTMPVVG--EEEIAEA  136 (223)
T ss_dssp             HHHHTCEEEEEEE--CHHH----HHH-----------------HHHHHHHHHHHHHHTSCCEEEEEEECCS--HHHHHHH
T ss_pred             HHHHCCEEEEEEC--CCCE----EEH-----------------HHHHHHHHHHHHCCCCCCCEEEEEEECC--HHHHHHH
T ss_conf             6871531799988--8957----436-----------------4553577777631657752377785067--7899999


Q ss_pred             HHHHHHHCCCEEEEECCCC
Q ss_conf             9999733394099982767
Q gi|254780911|r  151 LINIIEKNNVELMILARYM  169 (288)
Q Consensus       151 il~~l~~~~~DlivLAgym  169 (288)
                      +..+.+-..+..+||||-+
T Consensus       137 v~av~rl~r~~~lvlags~  155 (223)
T 1y7p_A          137 VKAVSRLHRAEVLVLAGGI  155 (223)
T ss_dssp             HHHGGGSTTEEEEEEESSB
T ss_pred             HHHHHCCCCCCEEEEECCC
T ss_conf             9986135677669980653


No 23 
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A
Probab=97.79  E-value=3.2e-05  Score=55.77  Aligned_cols=64  Identities=13%  Similarity=0.172  Sum_probs=47.8

Q ss_pred             CCEEE--EEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHH
Q ss_conf             96499--99985998766888999998579818973444324368899999997288527779888987
Q gi|254780911|r    1 MSSYI--LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPI   67 (288)
Q Consensus         1 M~~~i--Lti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~i   67 (288)
                      |++|.  |.+.|.||||+.+.||+.+++.|.||.++++-..  .+.+.+++.++.. +.+.+..-+..+
T Consensus         1 ~T~f~~~L~I~~~Dr~GlL~dIt~~is~~~inI~~i~~~~~--~~~~~~~i~v~V~-d~~~L~~li~~L   66 (88)
T 2ko1_A            1 MTDFLAGIRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAK--DGIFTCNLMIFVK-NTDKLTTLMDKL   66 (88)
T ss_dssp             CCCEEEEEEEEEECCTTHHHHHHHHHTTSSSCEEEEEEEEC--SSEEEEEEEEEES-SHHHHHHHHHHH
T ss_pred             CCEEEEEEEEEEECCCCHHHHHHHHHHHCCCEEEEEEEEEC--CCEEEEEEEEEEC-CHHHHHHHHHHH
T ss_conf             90679999999977888799999999877973999999704--9979999999998-778899999999


No 24 
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}
Probab=97.66  E-value=0.00036  Score=48.37  Aligned_cols=86  Identities=10%  Similarity=0.145  Sum_probs=62.8

Q ss_pred             CEEEEEEECCC-CCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC-CCHHHHHHHHHHHHCCCCCCEECCC
Q ss_conf             64999998599-876688899999857981897344432436889999999728-8527779888987400232020124
Q gi|254780911|r    2 SSYILTITCPS-NEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLFIADFQPIVQQFSLQYSIRN   79 (288)
Q Consensus         2 ~~~iLti~CpD-~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~-~~~~~l~~~f~~ia~~~~m~~~i~~   79 (288)
                      .++++++.++| ++|+++++|+.++++|+||.......+.....+=++  .... .+.+.+...+..++.+++.++.+..
T Consensus       100 ~~~~v~v~g~~~~pgiv~~vt~~la~~~~ni~~i~r~~~~~~~~ve~~--~s~~~~~~~~l~~al~~~a~~~~~d~~~~~  177 (415)
T 3p96_A          100 STHTIFVLGRPITAAAFGAVAREVAALGVNIDLIRGVSDYPVIGLELR--VSVPPGADEALRTALNRVSSEEHVDVAVED  177 (415)
T ss_dssp             CSEEEEEEESSCCHHHHHHHHHHHHHTTCEEEEEEEEESSSSEEEEEE--EECCTTCHHHHHHHHHHHHHHHTCEEEEEE
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEE--ECCCCCCHHHHHHHHHHHHHHHCCCHHHHC
T ss_conf             607999975889869999999999965975323324567865149998--348878989999999997676184455420


Q ss_pred             C---CCCCCEEEE
Q ss_conf             4---565538999
Q gi|254780911|r   80 T---KEATKTLIL   89 (288)
Q Consensus        80 ~---~~~~riail   89 (288)
                      .   .+++|+++|
T Consensus       178 ~~~~~r~k~lvvf  190 (415)
T 3p96_A          178 YTLERRAKRLIVF  190 (415)
T ss_dssp             CSTTTTCCCEEEE
T ss_pred             CHHCCCCCCEEEE
T ss_conf             2102556658998


No 25 
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} SCOP: d.58.18.6 d.58.18.6
Probab=96.82  E-value=0.027  Score=35.32  Aligned_cols=67  Identities=9%  Similarity=0.202  Sum_probs=48.7

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC---CHHHHHHHHHHHHC
Q ss_conf             9649999985998766888999998579818973444324368899999997288---52777988898740
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLFIADFQPIVQ   69 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~---~~~~l~~~f~~ia~   69 (288)
                      |++++|.+.-.|++|+.++||+.++.+|.||..++--...+.+  +.|+-+....   ..+++...+..+..
T Consensus        27 ~~~~~isvlVeN~pGvL~RV~glFsrRg~NIeSLsv~~te~~~--iSRmTIv~~~~~~~i~qi~kQl~KLId   96 (193)
T 2fgc_A           27 IREHLVSMLVHNKPGVMRKVANLFARRGFNISSITVGESETPG--LSRLVIMVKGDDKTIEQIEKQAYKLVE   96 (193)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHTTTCEEEEEEEEECSSTT--EEEEEEEEEECTTHHHHHHHHHTTSTT
T ss_pred             CEEEEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEECCCCCC--EEEEEEEEECCHHHHHHHHHHHHCCCC
T ss_conf             1089999999787888999999986489685467850258888--489999964898999999999863777


No 26 
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6
Probab=96.70  E-value=0.0056  Score=40.08  Aligned_cols=70  Identities=17%  Similarity=0.236  Sum_probs=51.4

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEE--ECCC-CHHHHHHHHHHHHCCCC
Q ss_conf             964999998599876688899999857981897344432436889999999--7288-52777988898740023
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNT-CMKLFIADFQPIVQQFS   72 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f--~~~~-~~~~l~~~f~~ia~~~~   72 (288)
                      |.++++.+...|+||+.++||+.++.+|.||.+++----.+.+.  .|+-+  .++. ..+++...+.++-.-..
T Consensus         1 M~k~~isvlveN~pGvL~Rv~glFsrRg~NI~SL~v~~te~~~~--SR~Tiv~~g~~~~i~qi~kQL~KlidVi~   73 (164)
T 2f1f_A            1 MARRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTL--SRMTIQTVGDEKVLEQIEKQLHKLVDVLR   73 (164)
T ss_dssp             -CEEEEEEEEECCTTHHHHHHHHHHTTTCCCSEEEEEECSCSSE--EEEEEEEESCHHHHHHHHHHHHHSTTEEE
T ss_pred             CCEEEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCC--EEEEEEEECCHHHHHHHHHHHHCCCCEEE
T ss_conf             95599999998786799999999851675456788723379991--79999998999999999999837735899


No 27 
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans}
Probab=95.82  E-value=0.037  Score=34.37  Aligned_cols=50  Identities=8%  Similarity=-0.039  Sum_probs=28.3

Q ss_pred             CCCCEEEEECCCCCCHHHHH-HHHCCCCCEEEEEEEEECCH-------HHHHHHHHCCCCEEE
Q ss_conf             65538999708867989999-86204674158999997734-------667778860997474
Q gi|254780911|r   82 EATKTLILVSQPDHCLNDLL-YRWNIGTLALNIVGVVSNHT-------THKKLVENYQLPFYY  136 (288)
Q Consensus        82 ~~~riailvSg~gsnL~~Ll-~~~~~g~L~~eI~~VISN~~-------d~~~lA~~~gIP~~~  136 (288)
                      ....+.|=++|....-.+++ .+.+.|     +.+|-+|+.       .+..+|+++|..+.|
T Consensus        77 ~~idivVe~~gg~~~a~~~~~~al~~G-----~~VVTANK~~~a~~~~eL~~~a~~~~~~~~y  134 (444)
T 3mtj_A           77 PEIDIVVELIGGLEPARELVMQAIANG-----KHVVTANKHLVAKYGNEIFAAAQAKGVMVTF  134 (444)
T ss_dssp             TTCCEEEECCCSSTTHHHHHHHHHHTT-----CEEEECCHHHHHHHHHHHHHHHHHHTCCEEC
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHCC-----CCEEECCHHHHHHHHHHHHHHHHHHCCEEEE
T ss_conf             799999992899637999999998628-----8367423367887899999999980988986


No 28 
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosynthesis, structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A*
Probab=95.75  E-value=0.06  Score=32.92  Aligned_cols=105  Identities=16%  Similarity=0.166  Sum_probs=55.4

Q ss_pred             HHHHHHCCCEEEEECCC-----CCCCCHHHHHHCCC--CEEEECCCCCCCCCCC----CHHHHHHHCCCCEEEEEEEEEE
Q ss_conf             99973339409998276-----75488778632778--4796133667678999----9589997426837622577530
Q gi|254780911|r  152 INIIEKNNVELMILARY-----MQILSDHLCHKMTG--RIINIHHSFLPSFKGA----NPYKQAYEYGVKIIGATAHYAI  220 (288)
Q Consensus       152 l~~l~~~~~DlivLAgy-----mril~~~~~~~~~~--~iiNiHpslLP~f~G~----~~y~~A~~~Gvk~~G~TvH~V~  220 (288)
                      -+++.  ..|+|++.==     -.++..+.++..+.  .+||+=       +|.    ...-+|++.| ++.||-.-.-.
T Consensus       191 ~ell~--~sD~v~lh~Plt~~T~~li~~~~~~~mK~ga~lIN~a-------RG~iVde~aL~~AL~~g-~i~gAalDV~~  260 (529)
T 1ygy_A          191 DDLLA--RADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAA-------RGGLVDEAALADAITGG-HVRAAGLDVFA  260 (529)
T ss_dssp             HHHHH--HCSEEEECCCCSTTTTTCBCHHHHTTSCTTEEEEECS-------CTTSBCHHHHHHHHHTS-SEEEEEESSCS
T ss_pred             HHHHH--HCCEEEEECCCCCCCCCCCCHHHHHHCCCCCEEEECC-------CCCEECHHHHHHHHHCC-CCCEEEEECCC
T ss_conf             99984--4999999079985331510799995258998687414-------66557599999999849-97168980215


Q ss_pred             CC-CCCCCEEEEEEEECCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEE
Q ss_conf             55-6888344444665188---889999999999999999999999987691788
Q gi|254780911|r  221 CE-LDAGPIIEQDVVRVTH---AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFI  271 (288)
Q Consensus       221 ~~-lD~GpII~Q~~~~v~~---~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~  271 (288)
                      +| ...-|...-.-+-+.|   ..|.|...+.     .....+-++.|++++...
T Consensus       261 ~EP~~~~pl~~~~nvi~TPHi~~~T~ea~~~~-----~~~~~~ni~~~l~g~~~~  310 (529)
T 1ygy_A          261 TEPCTDSPLFELAQVVVTPHLGASTAEAQDRA-----GTDVAESVRLALAGEFVP  310 (529)
T ss_dssp             SSSCSCCGGGGCTTEEECSSCSSCBHHHHHHH-----HHHHHHHHHHHHTTCCCT
T ss_pred             CCCCCCCHHHCCCCEEECCCCCCCCHHHHHHH-----HHHHHHHHHHHHCCCCCC
T ss_conf             78999944646999999982644849999999-----999999999998699999


No 29 
>2pc6_A Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6
Probab=95.44  E-value=0.036  Score=34.50  Aligned_cols=69  Identities=14%  Similarity=0.227  Sum_probs=49.7

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEE--ECCC-CHHHHHHHHHHHHCCCC
Q ss_conf             964999998599876688899999857981897344432436889999999--7288-52777988898740023
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNT-CMKLFIADFQPIVQQFS   72 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f--~~~~-~~~~l~~~f~~ia~~~~   72 (288)
                      |+ ++|.+...|+||+.++||+.++.+|.||..+.--.-.+.+  +.|+-+  .++. .++++...+..+-.-..
T Consensus         3 Mk-~~isvlveN~pGvL~rv~glFsrRg~NIeSL~v~~te~~~--iSR~Tiv~~g~~~~i~qi~kQL~KLidV~~   74 (165)
T 2pc6_A            3 MR-HIISLLMENEAGALSRVAGLFSARGYNIESLSVAPTEDPT--LSRMTLVTNGPDEIVEQITKQLNKLIEVVK   74 (165)
T ss_dssp             EE-EEEEEEEECSTTHHHHHHHHHHHHTCCCCEEEEEECSSTT--EEEEEEEEEECHHHHHHHHHHHHHSTTEEE
T ss_pred             CE-EEEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCC--EEEEEEEEECCHHHHHHHHHHHHCCCCEEE
T ss_conf             53-9999999878569999999986267435788873247998--079999997788999999999967846799


No 30 
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.58.18.11 d.58.18.11
Probab=94.36  E-value=0.16  Score=29.95  Aligned_cols=43  Identities=14%  Similarity=0.162  Sum_probs=36.3

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCC
Q ss_conf             9649999985998766888999998579818973444324368
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTS   43 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~   43 (288)
                      |..--+.+.-+|+||..|+|++.|+++|.||..++|....+.+
T Consensus         4 m~~~qisV~v~n~pG~la~v~~~la~~ginId~is~~~~~~~~   46 (144)
T 2f06_A            4 MVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFG   46 (144)
T ss_dssp             SEEEEEEEEECSSSSHHHHHHHHHHHTTCCEEEEEEEECSSCE
T ss_pred             CEEEEEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCCCCC
T ss_conf             3899999996896339999999999869559999942467876


No 31 
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A*
Probab=93.90  E-value=0.25  Score=28.62  Aligned_cols=87  Identities=16%  Similarity=0.176  Sum_probs=55.9

Q ss_pred             CCCCCEEEEECCCC--CCHHHHHHHHCCCCCEE-EEEEEEECC---HH-------HHHHHHHCCCCEEECCCCC------
Q ss_conf             56553899970886--79899998620467415-899999773---46-------6777886099747416873------
Q gi|254780911|r   81 KEATKTLILVSQPD--HCLNDLLYRWNIGTLAL-NIVGVVSNH---TT-------HKKLVENYQLPFYYLPMTE------  141 (288)
Q Consensus        81 ~~~~riailvSg~g--snL~~Ll~~~~~g~L~~-eI~~VISN~---~d-------~~~lA~~~gIP~~~i~~~~------  141 (288)
                      +...|++|-+||+-  ..|..++.+++.. ++. ++.++.-||   ++       +..+++++|||++......      
T Consensus        22 ~~~~kvlva~SGG~DS~~Ll~~l~~l~~~-~~~~~i~~~hv~h~~r~~s~~~~~~v~~~~~~~~i~~~~~~~~~~~~~~~  100 (317)
T 1wy5_A           22 SGERRVLIAFSGGVDSVVLTDVLLKLKNY-FSLKEVALAHFNHMLRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKE  100 (317)
T ss_dssp             SSCCEEEEECCSSHHHHHHHHHHHHSTTT-TTCSEEEEEEEECCSSTHHHHHHHHHHHHHHHHTCCEEEEECCHHHHHHH
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHHHHH-CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCC
T ss_conf             99785999981829999999999999987-79980999996189997559999999999996062422110234431147


Q ss_pred             --CC-----HHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             --35-----2776789999973339409998276
Q gi|254780911|r  142 --QN-----KIESEQKLINIIEKNNVELMILARY  168 (288)
Q Consensus       142 --~~-----k~~~e~~il~~l~~~~~DlivLAgy  168 (288)
                        .+     |..-.+.+.+..++++.+.|++|=-
T Consensus       101 ~~~~~e~~aR~~Ry~~l~~~~~~~~~~~i~~gHh  134 (317)
T 1wy5_A          101 NRMSLEEAGRFLRYKFLKEILESEGFDCIATAHH  134 (317)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHHHTTCSEEECCCC
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             9988789999999988553234312664676130


No 32 
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*
Probab=93.60  E-value=0.29  Score=28.12  Aligned_cols=15  Identities=20%  Similarity=0.195  Sum_probs=7.0

Q ss_pred             HHHHHHHHCCCCEEE
Q ss_conf             899999857981897
Q gi|254780911|r   19 IIPDYLSTQGCNILD   33 (288)
Q Consensus        19 ~VT~~La~~g~NI~~   33 (288)
                      ++...|-++|..+.-
T Consensus        25 ala~~L~~~g~eV~~   39 (364)
T 1f0k_A           25 AVAHHLMAQGWQVRW   39 (364)
T ss_dssp             HHHHHHHTTTCEEEE
T ss_pred             HHHHHHHHCCCEEEE
T ss_conf             999999968898999


No 33 
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1
Probab=93.16  E-value=0.43  Score=26.92  Aligned_cols=59  Identities=14%  Similarity=0.278  Sum_probs=39.8

Q ss_pred             CCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECC---HH-------HHHHHHHCCCCEEECCCC
Q ss_conf             6553899970886--79899998620467415899999773---46-------677788609974741687
Q gi|254780911|r   82 EATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNH---TT-------HKKLVENYQLPFYYLPMT  140 (288)
Q Consensus        82 ~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~---~d-------~~~lA~~~gIP~~~i~~~  140 (288)
                      +.+|++|-+||+.  .+|-.+|.+++...+..++.++--||   ++       +..+++++|||++.....
T Consensus        12 ~~~~vlva~SGG~DS~~ll~~l~~~~~~~~~~~~~~~h~~h~~r~~s~~~~~~v~~~~~~~~i~~~~~~~~   82 (433)
T 1ni5_A           12 TSRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQ   82 (433)
T ss_dssp             TCSEEEEECCSBHHHHHHHHHHHHHHTTSTTCEEEEEEECCSCCSSHHHHHHHHHHHHHHTTCCEEEECCC
T ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             99829999818099999999999989758998199999829889557999999999999759978999996


No 34 
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold domains, structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus HB8}
Probab=91.98  E-value=0.28  Score=28.28  Aligned_cols=74  Identities=14%  Similarity=-0.033  Sum_probs=35.7

Q ss_pred             HHHHCCCCEEEEC--CCCCCCCCCCCHH---HHHHH-------CCCCEEEEEEEEEECCCCCCCEEEEEEEECCCCCCHH
Q ss_conf             8632778479613--3667678999958---99974-------2683762257753055688834444466518888999
Q gi|254780911|r  176 LCHKMTGRIINIH--HSFLPSFKGANPY---KQAYE-------YGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE  243 (288)
Q Consensus       176 ~~~~~~~~iiNiH--pslLP~f~G~~~y---~~A~~-------~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~~~dt~~  243 (288)
                      +..+=.|+||||=  -++.| ++|..+|   +.|+.       .-.+-.|.+|--|.++.=.-|+..+...+-....++|
T Consensus       108 ~~~~~~g~Iv~isS~~~~~~-~~~~~~Y~asK~al~~~~~~l~~El~~~gI~V~~v~PG~v~T~~~~~~~~~~~~~~~pe  186 (207)
T 2yut_A          108 ARFQKGARAVFFGAYPRYVQ-VPGFAAYAAAKGALEAYLEAARKELLREGVHLVLVRLPAVATGLWAPLGGPPKGALSPE  186 (207)
T ss_dssp             CCEEEEEEEEEECCCHHHHS-STTBHHHHHHHHHHHHHHHHHHHHHHTTTCEEEEECCCCBCSGGGGGGTSCCTTCBCHH
T ss_pred             HHHCCCCEEEEECCHHHCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHCCCCCCCCCCCHH
T ss_conf             99839977999855033268-99958999999999999999999851139699999719897700110368865579999


Q ss_pred             HHHHHHH
Q ss_conf             9999999
Q gi|254780911|r  244 DYIAIGK  250 (288)
Q Consensus       244 ~l~~~~~  250 (288)
                      +.++++.
T Consensus       187 ~vA~~i~  193 (207)
T 2yut_A          187 EAARKVL  193 (207)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
T ss_conf             9999999


No 35 
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3- phenylpyruvate, PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis}
Probab=91.50  E-value=0.82  Score=24.98  Aligned_cols=12  Identities=8%  Similarity=0.545  Sum_probs=4.6

Q ss_pred             HHHHHHHCCCEE
Q ss_conf             999973339409
Q gi|254780911|r  151 LINIIEKNNVEL  162 (288)
Q Consensus       151 il~~l~~~~~Dl  162 (288)
                      +|+.+.+++++|
T Consensus       225 iL~~Fa~~~INL  236 (329)
T 3luy_A          225 LLDVFRDAGLNM  236 (329)
T ss_dssp             HHHHHHHTTCCE
T ss_pred             HHHHHHHCCCCE
T ss_conf             999999879676


No 36 
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls}
Probab=91.45  E-value=0.83  Score=24.94  Aligned_cols=14  Identities=14%  Similarity=-0.114  Sum_probs=4.6

Q ss_pred             CHHHHHHHHHHHCC
Q ss_conf             66888999998579
Q gi|254780911|r   15 EITSIIPDYLSTQG   28 (288)
Q Consensus        15 GIVA~VT~~La~~g   28 (288)
                      |.|...-..|.+.+
T Consensus        60 G~V~~t~D~L~~~~   73 (283)
T 2qmx_A           60 GSIHQNYDLLLRRP   73 (283)
T ss_dssp             CBCHHHHHHHHHSS
T ss_pred             CCCHHHHHHHHCCC
T ss_conf             35667886865189


No 37 
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus}
Probab=91.31  E-value=0.4  Score=27.20  Aligned_cols=86  Identities=12%  Similarity=0.165  Sum_probs=55.3

Q ss_pred             CCCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECCH----H-------HHHHHHHCCCCEEECCCCC------
Q ss_conf             56553899970886--798999986204674158999997734----6-------6777886099747416873------
Q gi|254780911|r   81 KEATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNHT----T-------HKKLVENYQLPFYYLPMTE------  141 (288)
Q Consensus        81 ~~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~~----d-------~~~lA~~~gIP~~~i~~~~------  141 (288)
                      .+..+++|-+||+-  .+|-.++..++ ..++.++.++--||.    +       ++.+++++|||++....+.      
T Consensus        16 ~~~~~v~va~SGG~DS~~Ll~~l~~~~-~~~~~~~~~~hvnh~lr~~~s~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~   94 (464)
T 3a2k_A           16 SEGAAVIVGVSGGPDSLALLHVFLSLR-DEWKLQVIAAHVDHMFRGRESEEEMEFVKRFCVERRILCETAQIDVPAFQRS   94 (464)
T ss_dssp             SCSSBEEEECCSSHHHHHHHHHHHHHH-HTTTCBCEEEEEECTTCTHHHHHHHHHHHHHHHHTTCEEEEEECCCHHHHTT
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHHH-HHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEHHHCC
T ss_conf             983989999807199999999999988-9729859999977989986669999999999998499199999860011025


Q ss_pred             --CC-----HHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             --35-----277678999997333940999827
Q gi|254780911|r  142 --QN-----KIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       142 --~~-----k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                        .+     |..-.+.+.+..++++.|.|++|=
T Consensus        95 ~~~~~e~~aR~~Ry~~~~~~~~~~~~~~i~~aH  127 (464)
T 3a2k_A           95 AGLGAQEAARICRYRFFAELMEKHQAGYVAVGH  127 (464)
T ss_dssp             TTCCSHHHHHHHHHHHHHHHHHTTTCCEEECCC
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEE
T ss_conf             898989999999987641233345631587542


No 38 
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.58.18.11 d.58.18.11
Probab=90.50  E-value=0.47  Score=26.66  Aligned_cols=34  Identities=24%  Similarity=0.434  Sum_probs=16.6

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCC
Q ss_conf             9859987668889999985798189734443243
Q gi|254780911|r    8 ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD   41 (288)
Q Consensus         8 i~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~   41 (288)
                      ..-+|++|+.++++..|++.|.||....+++...
T Consensus        77 ~~m~~~~G~~a~i~~~L~~~~INI~~i~~~~s~~  110 (144)
T 2f06_A           77 ISCPNVPGALAKVLGFLSAEGVFIEYMYSFANNN  110 (144)
T ss_dssp             EEEESSTTHHHHHHHHHHHTTCCEEEEEEEEETT
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             4766785089999999986899879875233778


No 39 
>2c82_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; RV2870C, DOXP/MEP pathway, oxidoreductase, isoprene biosynthesis, metal-binding; 1.9A {Mycobacterium tuberculosis} PDB: 2jd1_A* 2jcv_A* 2jcz_A* 2jd2_A 2jcx_A* 2jcy_A 2jd0_A*
Probab=90.31  E-value=0.51  Score=26.45  Aligned_cols=155  Identities=13%  Similarity=0.177  Sum_probs=90.7

Q ss_pred             CCCCCCCEEEEECCC--CCCHHHHHHHHCCCCCEEEEEEEEECCHHHH---HHHHHCCCCEEECCCCCCCHHH-------
Q ss_conf             445655389997088--6798999986204674158999997734667---7788609974741687335277-------
Q gi|254780911|r   79 NTKEATKTLILVSQP--DHCLNDLLYRWNIGTLALNIVGVVSNHTTHK---KLVENYQLPFYYLPMTEQNKIE-------  146 (288)
Q Consensus        79 ~~~~~~riailvSg~--gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i~~~~~~k~~-------  146 (288)
                      -.+.|+|++||.|.+  |.+--+++.+..+   ..+|.++.+|+.+..   ..+.+++.++.++.... ....       
T Consensus         8 ~~~~kkkI~IlGsTGSIG~~tL~Vi~~~~~---~f~v~~lsa~~~n~~~L~~q~~~f~p~~v~i~d~~-~~~~~~~~~~~   83 (413)
T 2c82_A            8 RADGRLRVVVLGSTGSIGTQALQVIADNPD---RFEVVGLAAGGAHLDTLLRQRAQTGVTNIAVADEH-AAQRVGDIPYH   83 (413)
T ss_dssp             ---CCEEEEEESTTSHHHHHHHHHHHHCTT---TEEEEEEEECSSCHHHHHHHHHHHCCCCEEESCHH-HHHHHCCCSEE
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCC---CEEEEEEEECCCCHHHHHHHHHHHCCCEEEECCHH-HHHHHCCCEEC
T ss_conf             547997899989798999999999983946---60899999688419999999999699989987989-99883045313


Q ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC--CC
Q ss_conf             6789999973339409998276754887786327784796133667678999958999742683762257753055--68
Q gi|254780911|r  147 SEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE--LD  224 (288)
Q Consensus       147 ~e~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~--lD  224 (288)
                      -+..+.+.+...++|++|.|                         +..|-|..|-..|++.|-++.     +.|-|  +=
T Consensus        84 g~~~l~~~~~~~~~D~vv~a-------------------------i~G~aGL~pt~~ai~~gk~ia-----LANKEslV~  133 (413)
T 2c82_A           84 GSDAATRLVEQTEADVVLNA-------------------------LVGALGLRPTLAALKTGARLA-----LANKESLVA  133 (413)
T ss_dssp             STTHHHHHHHHCCCSEEEEC-------------------------CCSGGGHHHHHHHHHTTCEEE-----ECCHHHHHT
T ss_pred             CHHHHHHHHHCCCCCEEEEE-------------------------CCCCCCHHHHHHHHHCCCCEE-----EECCCEEEE
T ss_conf             84789999715777899980-------------------------362121999999997699089-----843770998


Q ss_pred             CCCEEEEE-----EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             88344444-----665188889999999999999999999999987691788688579808886763
Q gi|254780911|r  225 AGPIIEQD-----VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       225 ~GpII~Q~-----~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                      +|++|...     ..||+              =||-.+-+.++-  +.+=.+   +.++.+|+-|-.
T Consensus       134 aG~li~~~~~k~~iiPvD--------------SEH~Ai~q~l~~--~~~~~v---~kI~lTASGGPF  181 (413)
T 2c82_A          134 GGSLVLRAARPGQIVPVD--------------SEHSALAQCLRG--GTPDEV---AKLVLTASGGPF  181 (413)
T ss_dssp             THHHHHHHCCTTCEEECS--------------HHHHHHHHHGGG--SCGGGE---EEEEEEECCCTT
T ss_pred             CCHHHHHHHHCCCCCCCC--------------CHHHHHHHHHHH--CCHHHE---EEEEEECCCCCH
T ss_conf             748899765305321368--------------048999998642--252220---078994588656


No 40 
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A*
Probab=90.27  E-value=1  Score=24.30  Aligned_cols=56  Identities=14%  Similarity=0.270  Sum_probs=30.3

Q ss_pred             CCCCCEEEEECC-CCCCHHHHHHHHCCCCCEEEEEEEEE-CC---------------HHHHHHHHHCCCCEEECCCC
Q ss_conf             565538999708-86798999986204674158999997-73---------------46677788609974741687
Q gi|254780911|r   81 KEATKTLILVSQ-PDHCLNDLLYRWNIGTLALNIVGVVS-NH---------------TTHKKLVENYQLPFYYLPMT  140 (288)
Q Consensus        81 ~~~~riailvSg-~gsnL~~Ll~~~~~g~L~~eI~~VIS-N~---------------~d~~~lA~~~gIP~~~i~~~  140 (288)
                      +.++|++|..|| -+|...++|-+ +.|.   ++.+|.= |.               .+++.+|+..|||+++++..
T Consensus        15 ~~~kkV~V~mSGGVDSsvaa~lL~-~qG~---~V~gv~m~~~~~~~~~~~c~~~~d~~~a~~va~~LgIp~~~~d~~   87 (380)
T 2der_A           15 ETAKKVIVGMSGGVDSSVSAWLLQ-QQGY---QVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKLGIELHTVNFA   87 (380)
T ss_dssp             --CCEEEEECCSCSTTHHHHHHHH-TTCC---EEEEEEEECCCCCSHHHHHHHHHHHHHHHHHHHHHTCCEEEEECH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHH-HCCC---CEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECHH
T ss_conf             668879998778699999999999-7799---689999988768876678884678999999999849977994508


No 41 
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A
Probab=89.29  E-value=1.1  Score=24.02  Aligned_cols=120  Identities=16%  Similarity=0.264  Sum_probs=65.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEE---CCHH-----------HHHHHHHCCCCEEECCCCCCCHHHHH
Q ss_conf             553899970886798999986204674158999997---7346-----------67778860997474168733527767
Q gi|254780911|r   83 ATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS---NHTT-----------HKKLVENYQLPFYYLPMTEQNKIESE  148 (288)
Q Consensus        83 ~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VIS---N~~d-----------~~~lA~~~gIP~~~i~~~~~~k~~~e  148 (288)
                      ..+++++-||.=-+..+|+.+.+.| .  +|+++++   ...+           ++..|+.-|||........ +.++..
T Consensus         4 ~~~v~vl~SGGKDS~lAl~~a~~~G-~--~v~~L~t~~~~~~~s~~~h~~~~~ll~~qA~algiPL~~~~~~~-~~e~~~   79 (227)
T 2d13_A            4 LADVAVLYSGGKDSNYALYWALKSG-L--RVRYLVSMVSENEESYMYHTPNVELTSLQARALGIPIIKGFTKG-EKEKEV   79 (227)
T ss_dssp             SCEEEEECCSSHHHHHHHHHHHHTT-C--EEEEEEEEECCC---------CCTTHHHHHHHHTCCEEEEEC---CTTSHH
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHCC-C--EEEEEEEEECCCCCCEECCCCCHHHHHHHHHHCCCCEEEEECCC-CHHHHH
T ss_conf             6649999368699999999999869-9--27999997438888141557789999999997599717874678-615899


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCE---EEECCCCCCCCCCCCHH---HHHHHCCCCEE
Q ss_conf             899999733394099982767548877863277847---96133667678999958---99974268376
Q gi|254780911|r  149 QKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI---INIHHSFLPSFKGANPY---KQAYEYGVKII  212 (288)
Q Consensus       149 ~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~i---iNiHpslLP~f~G~~~y---~~A~~~Gvk~~  212 (288)
                      ..+.+.+++.++|-|+.-.   |.+..- ..|-.++   .++ .++.|-+ |.++.   ++-++.|.+.+
T Consensus        80 ~~l~~~l~~~~v~~iv~Gd---i~~~~~-~~~~e~~~~~~gl-~~~~PLW-~~d~~~ll~e~i~~G~~ai  143 (227)
T 2d13_A           80 EDLKNVLEGLKVDGIVAGA---LASRYQ-KERIENVARELGL-KVYTPAW-EKDPYQYMLEIIKLGFKVV  143 (227)
T ss_dssp             HHHHHHHHTBCCSEEECCC---SSCHHH-HHHHHHHHHHHTC-EEECTTT-TCCHHHHHHHHHHTTCEEE
T ss_pred             HHHHHHHHHHCCCEEEEEE---EEEHHH-HHHHHHHHHHCCC-EEECCCC-CCCHHHHHHHHHHCCCEEE
T ss_conf             9999999971756078623---762889-9999999987498-8873324-8877999999998799099


No 42 
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureus subsp. aureus MU50, structural genomics; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3
Probab=89.16  E-value=1.3  Score=23.64  Aligned_cols=11  Identities=9%  Similarity=0.145  Sum_probs=3.6

Q ss_pred             HHHHHHHCCEE
Q ss_conf             99999876917
Q gi|254780911|r  259 KAVNAHIQQRV  269 (288)
Q Consensus       259 ~av~~~~e~rv  269 (288)
                      +++.-|....|
T Consensus       205 ~~L~~f~~~~I  215 (267)
T 2qmw_A          205 SVLNTFALFNI  215 (267)
T ss_dssp             HHHHHHHTTTC
T ss_pred             HHHHHHHHCCC
T ss_conf             99999998896


No 43 
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling, bifunctional enzyme; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1
Probab=88.82  E-value=0.73  Score=25.33  Aligned_cols=75  Identities=17%  Similarity=0.167  Sum_probs=42.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH--HHHCCCCEEECCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             5655389997088679899998620467415899999773466777--88609974741687335277678999997333
Q gi|254780911|r   81 KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL--VENYQLPFYYLPMTEQNKIESEQKLINIIEKN  158 (288)
Q Consensus        81 ~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l--A~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~  158 (288)
                      .+|.|++|+.||..  =++|+.+.-...=..|+.+|.|.++..+.+  +..+++++..-...         .+.+.....
T Consensus         2 tkkikVaIiGtG~i--G~eLl~~lL~~hp~~ei~av~s~~~ag~~l~~a~~~~~~~~~~~~~---------~~~~~~~~~   70 (312)
T 1nvm_B            2 NQKLKVAIIGSGNI--GTDLMIKVLRNAKYLEMGAMVGIDAASDGLARAQRMGVTTTYAGVE---------GLIKLPEFA   70 (312)
T ss_dssp             CSCEEEEEECCSHH--HHHHHHHHHHHCSSEEEEEEECSCTTCHHHHHHHHTTCCEESSHHH---------HHHHSGGGG
T ss_pred             CCCCEEEEECCCHH--HHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHCCCCCCCCCEE---------ECCCCCCCC
T ss_conf             98876999868699--9999999984599868999994670342045566628975556521---------010003202


Q ss_pred             CCEEEEEC
Q ss_conf             94099982
Q gi|254780911|r  159 NVELMILA  166 (288)
Q Consensus       159 ~~DlivLA  166 (288)
                      ++|+|.+|
T Consensus        71 ~vDvVF~A   78 (312)
T 1nvm_B           71 DIDFVFDA   78 (312)
T ss_dssp             GEEEEEEC
T ss_pred             CCCEEEEC
T ss_conf             47689986


No 44 
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens}
Probab=87.07  E-value=1.7  Score=22.77  Aligned_cols=20  Identities=10%  Similarity=0.214  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHCCCEEEEE
Q ss_conf             76789999973339409998
Q gi|254780911|r  146 ESEQKLINIIEKNNVELMIL  165 (288)
Q Consensus       146 ~~e~~il~~l~~~~~DlivL  165 (288)
                      -.=.++|+.+.+++++|.-+
T Consensus       214 GsL~~iL~~Fa~~~INLtkI  233 (313)
T 3mwb_A          214 GALMEILDQFASRGVNLSRI  233 (313)
T ss_dssp             THHHHHHHHHHTTTCCEEEE
T ss_pred             CHHHHHHHHHHHCCCCEEEE
T ss_conf             58999999999869982778


No 45 
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis}
Probab=87.05  E-value=1.7  Score=22.76  Aligned_cols=60  Identities=22%  Similarity=0.253  Sum_probs=31.6

Q ss_pred             CCCHHHHHHCCCCEEEECC--CCCCCCCCCCHH---HHHHH-------CCCCEEEEEEEEEECCCCCCCEEEE
Q ss_conf             4887786327784796133--667678999958---99974-------2683762257753055688834444
Q gi|254780911|r  171 ILSDHLCHKMTGRIINIHH--SFLPSFKGANPY---KQAYE-------YGVKIIGATAHYAICELDAGPIIEQ  231 (288)
Q Consensus       171 il~~~~~~~~~~~iiNiHp--slLP~f~G~~~y---~~A~~-------~Gvk~~G~TvH~V~~~lD~GpII~Q  231 (288)
                      -+-|.+.++-.|+||||=-  ++.| ++|..+|   +.|+.       .-..-.|.+|.-|.++.=.-|+..+
T Consensus       120 ~~lp~m~~~~~G~IInisS~~g~~~-~~~~~~Y~asKaal~~lt~~la~el~~~gIrvn~v~PG~v~T~~~~~  191 (281)
T 3m1a_A          120 ALLPQMRERGSGSVVNISSFGGQLS-FAGFSAYSATKAALEQLSEGLADEVAPFGIKVLIVEPGAFRTNLFGK  191 (281)
T ss_dssp             HHHHHHHHHTCEEEEEECCGGGTCC-CTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECCBCCTTTCC
T ss_pred             HHHHHHHHCCCCEEEEECCHHHCCC-CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCC
T ss_conf             9999776649917999587242478-99977899999999999999999845109099999708896752113


No 46 
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A*
Probab=87.03  E-value=1  Score=24.24  Aligned_cols=116  Identities=15%  Similarity=0.241  Sum_probs=69.1

Q ss_pred             CCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEECC--HHHHHHHHHCCCCEEECCCCCC---CHHH---HHHHH
Q ss_conf             6553899970886--79899998620467415899999773--4667778860997474168733---5277---67899
Q gi|254780911|r   82 EATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSNH--TTHKKLVENYQLPFYYLPMTEQ---NKIE---SEQKL  151 (288)
Q Consensus        82 ~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN~--~d~~~lA~~~gIP~~~i~~~~~---~k~~---~e~~i  151 (288)
                      .++|++||.|.+.  .+--+++.+..    +-+|.++-+|+  +.+...+.+++.++.++.-...   .+.+   -+..+
T Consensus         2 ~kK~I~IlGSTGSIG~~tL~Vi~~~~----~f~v~~Lsa~~N~~~L~~q~~~f~p~~v~i~~~~~~~~~~~~~~~g~~~l   77 (376)
T 3a06_A            2 EERTLVILGATGSIGTQTLDVLKKVK----GIRLIGISFHSNLELAFKIVKEFNVKNVAITGDVEFEDSSINVWKGSHSI   77 (376)
T ss_dssp             -CEEEEEETTTSHHHHHHHHHHHHSC----SEEEEEEEESSCHHHHHHHHHHHTCCEEEECSSCCCCCSSSEEEESTTHH
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC----CCEEEEEECCCCHHHHHHHHHHCCCCEEEECCHHHHHHHCCCEECCHHHH
T ss_conf             84789998877099999999982289----96599997798899999999982999999958899765087150486679


Q ss_pred             HHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC--CCCCCEE
Q ss_conf             99973339409998276754887786327784796133667678999958999742683762257753055--6888344
Q gi|254780911|r  152 INIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE--LDAGPII  229 (288)
Q Consensus       152 l~~l~~~~~DlivLAgymril~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~--lD~GpII  229 (288)
                      .+++...++|+++.|=                         -.|.|..|--.|+++|-++.     +.|-|  +=+|++|
T Consensus        78 ~~~~~~~~~D~vv~Ai-------------------------~G~aGL~pt~~ai~~gk~ia-----LANKEslV~aG~li  127 (376)
T 3a06_A           78 EEMLEALKPDITMVAV-------------------------SGFSGLRAVLASLEHSKRVC-----LANKESLVCGGFLV  127 (376)
T ss_dssp             HHHHHHHCCSEEEECC-------------------------CSTTHHHHHHHHHHHCSEEE-----ECCSHHHHHHHHHH
T ss_pred             HHHHCCCCCCEEEEEC-------------------------CHHHHCHHHHHHHHCCCEEE-----EECCCCEEECCHHH
T ss_conf             9984567887899954-------------------------12310325777762587577-----62443046752989


Q ss_pred             EE
Q ss_conf             44
Q gi|254780911|r  230 EQ  231 (288)
Q Consensus       230 ~Q  231 (288)
                      .+
T Consensus       128 ~~  129 (376)
T 3a06_A          128 KK  129 (376)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 47 
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A*
Probab=87.03  E-value=1.3  Score=23.66  Aligned_cols=148  Identities=16%  Similarity=0.189  Sum_probs=62.0

Q ss_pred             CCEEEEEEEEECCHHHH---HHHHHCCCCEEECCCC-C-CC-HHHHHHHHHHHHHHCCCEEEEECCCC-----CCCCHHH
Q ss_conf             74158999997734667---7788609974741687-3-35-27767899999733394099982767-----5488778
Q gi|254780911|r  108 TLALNIVGVVSNHTTHK---KLVENYQLPFYYLPMT-E-QN-KIESEQKLINIIEKNNVELMILARYM-----QILSDHL  176 (288)
Q Consensus       108 ~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i~~~-~-~~-k~~~e~~il~~l~~~~~DlivLAgym-----ril~~~~  176 (288)
                      +|.....+|++--.-..   .+++.+|....+.+.. + .. ....-..+-+++.  ..|+|++.==.     .++..++
T Consensus       142 el~gktlgIiG~G~IG~~va~~~~~~gm~V~~~d~~~~~~~~~~~~~~~l~ell~--~sDiVslh~Plt~~T~~lin~~~  219 (404)
T 1sc6_A          142 EARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLN--MSDVVSLHVPENPSTKNMMGAKE  219 (404)
T ss_dssp             CSTTCEEEEECCSHHHHHHHHHHHHTTCEEEEECSSCCCCCTTCEECSCHHHHHH--HCSEEEECCCSSTTTTTCBCHHH
T ss_pred             CCCCEEEEEECCCCCCHHHHHHCCCCCCEEEECCCCCCCCCCCCEECCHHHHHHH--HCCEEEECCCCCCCCCCHHHHHH
T ss_conf             4430368995033310333310034573686324446531135311030555452--28799972788856635158999


Q ss_pred             HHHCCCC--EEEECCCCCCCCCCC----CHHHHHHHCCCCEEEEEEE-EEECCCC-----CCCEEEEEEEEC---CCCCC
Q ss_conf             6327784--796133667678999----9589997426837622577-5305568-----883444446651---88889
Q gi|254780911|r  177 CHKMTGR--IINIHHSFLPSFKGA----NPYKQAYEYGVKIIGATAH-YAICELD-----AGPIIEQDVVRV---THAQT  241 (288)
Q Consensus       177 ~~~~~~~--iiNiHpslLP~f~G~----~~y~~A~~~Gvk~~G~TvH-~V~~~lD-----~GpII~Q~~~~v---~~~dt  241 (288)
                      +...+..  +||+=       +|.    ...-+|++.| ++.|+-.- |-+|-+.     ..|.....-+-+   .-..|
T Consensus       220 l~~mK~gailIN~a-------RG~iVde~aL~~aL~~g-~i~gaalDVf~~EP~~~~~p~~~pl~~~~nVi~TPHig~~T  291 (404)
T 1sc6_A          220 ISLMKPGSLLINAS-------RGTVVDIPALADALASK-HLAGAAIDVFPTEPATNSDPFTSPLAEFDNVLLTPHIGGST  291 (404)
T ss_dssp             HHHSCTTEEEEECS-------CSSSBCHHHHHHHHHTT-SEEEEEEEC---------CTTTGGGTTCTTEEEECCCSCCS
T ss_pred             HHHCCCCCEEEECC-------CCCEECHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC
T ss_conf             97469986999437-------77656589999997517-66639997289987643344457212599889887146578


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             99999999999999999999998769178
Q gi|254780911|r  242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       242 ~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      .|...+..    ..+ .+.+..|+++...
T Consensus       292 ~ea~~~~~----~~~-~~ni~~~l~~~~~  315 (404)
T 1sc6_A          292 QEAQENIG----LEV-AGKLIKYSDNGST  315 (404)
T ss_dssp             HHHHHHHH----HHH-HHHHHHHHHHCCC
T ss_pred             HHHHHHHH----HHH-HHHHHHHHCCCCC
T ss_conf             99999999----999-9999999749997


No 48 
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B*
Probab=86.11  E-value=1.9  Score=22.43  Aligned_cols=105  Identities=9%  Similarity=-0.047  Sum_probs=53.1

Q ss_pred             EEEEEE-CCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-CHHHHHHHHHHHHCCCCCCEECCCCC
Q ss_conf             999998-5998766888999998579818973444324368899999997288-52777988898740023202012445
Q gi|254780911|r    4 YILTIT-CPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIADFQPIVQQFSLQYSIRNTK   81 (288)
Q Consensus         4 ~iLti~-CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-~~~~l~~~f~~ia~~~~m~~~i~~~~   81 (288)
                      ..+|+. .||++|+.|++-+.|++.|.|+--+.|-..... .+..-+.|..+. +.......+..+..+.+.. ++....
T Consensus        16 a~iti~~l~~~~g~~a~iF~~la~~~I~vdmI~q~~s~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~v~~~~   93 (178)
T 2dtj_A           16 AKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVE-DGTTDITFTCPRSDGRRAMEILKKLQVQGNWT-NVLYDD   93 (178)
T ss_dssp             EEEEEEEEECSTTHHHHHHHHHHHTTCCCCEEEECCCCTT-TCEEEEEEEEEHHHHHHHHHHHHTTTTTTTCS-EEEEES
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC-CCEEEEEEECCHHHHHHHHHHHHHHHHCCCCC-EEEEEC
T ss_conf             9999915899852899999999973875799972465456-75059999614888999998542012015741-378705


Q ss_pred             CCCCEEEEECCCCCC---HHHHHHHHCCCCCE
Q ss_conf             655389997088679---89999862046741
Q gi|254780911|r   82 EATKTLILVSQPDHC---LNDLLYRWNIGTLA  110 (288)
Q Consensus        82 ~~~riailvSg~gsn---L~~Ll~~~~~g~L~  110 (288)
                      ..-++.+...|--++   +..++.+-....++
T Consensus        94 ~~a~VSvVG~gm~~~~gvaakif~aL~~~~In  125 (178)
T 2dtj_A           94 QVGKVSLVGAGMKSHPGVTAEFMEALRDVNVN  125 (178)
T ss_dssp             CEEEEEEEEECCTTCHHHHHHHHHHHHHTTCC
T ss_pred             CEEEEEEECCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             60588886244256999278999999988997


No 49 
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A
Probab=84.95  E-value=2.1  Score=22.08  Aligned_cols=74  Identities=15%  Similarity=0.118  Sum_probs=40.7

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             79899998620467415899999773466777---886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      +.+.+||..     -..+++.|.+.......+   |-++|.+.+.  -+.  .+-++. .++.++.++.+  +.+..+|+
T Consensus        61 ~d~~ell~~-----~~iD~V~I~tp~~~H~~~~~~al~aGkhVl~--EKPla~~~~ea-~~l~~~a~~~~--~~~~v~~~  130 (362)
T 1ydw_A           61 GSYESLLED-----PEIDALYVPLPTSLHVEWAIKAAEKGKHILL--EKPVAMNVTEF-DKIVDACEANG--VQIMDGTM  130 (362)
T ss_dssp             SSHHHHHHC-----TTCCEEEECCCGGGHHHHHHHHHTTTCEEEE--CSSCSSSHHHH-HHHHHHHHTTT--CCEEECCC
T ss_pred             CCHHHHHCC-----CCCCEEEEECCCHHHHHHHHHHHHCCCEEEE--ECCCCCHHHHH-HHHHHHHHHHC--CCCCCEEC
T ss_conf             899999649-----9988899958826889999999976985999--47810004678-99999986302--24410000


Q ss_pred             CCCCHHHHH
Q ss_conf             548877863
Q gi|254780911|r  170 QILSDHLCH  178 (288)
Q Consensus       170 ril~~~~~~  178 (288)
                      +-..|.+..
T Consensus       131 ~r~~p~~~~  139 (362)
T 1ydw_A          131 WVHNPRTAL  139 (362)
T ss_dssp             GGGSGGGTT
T ss_pred             CCCCHHHHH
T ss_conf             125738888


No 50 
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}
Probab=84.53  E-value=2.2  Score=21.94  Aligned_cols=138  Identities=9%  Similarity=0.116  Sum_probs=70.4

Q ss_pred             EEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHC-CCEEEE-
Q ss_conf             999708867989999862046741589999977346677788609974741687335277678999997333-940999-
Q gi|254780911|r   87 LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN-NVELMI-  164 (288)
Q Consensus        87 ailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~-~~Dliv-  164 (288)
                      .++|+|.++.+..-+-+ .--+-.++|.++=-|.+.+..++++.|-....++.+-.+.++.++-+-++.+++ .+|.+| 
T Consensus        31 valVTGas~GIG~aiA~-~la~~Ga~V~~~~~~~~~l~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDiLVn  109 (277)
T 3gvc_A           31 VAIVTGAGAGIGLAVAR-RLADEGCHVLCADIDGDAADAAATKIGCGAAACRVDVSDEQQIIAMVDACVAAFGGVDKLVA  109 (277)
T ss_dssp             EEEETTTTSTHHHHHHH-HHHHTTCEEEEEESSHHHHHHHHHHHCSSCEEEECCTTCHHHHHHHHHHHHHHHSSCCEEEE
T ss_pred             EEEEECCCCHHHHHHHH-HHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89993878789999999-99987999999979889999999982996489996389999999999999997399989998


Q ss_pred             ECCCCCC----------------------------CCHHHHHHCCCCEEEEC--CCCCCCCCCCCHH---HHHH------
Q ss_conf             8276754----------------------------88778632778479613--3667678999958---9997------
Q gi|254780911|r  165 LARYMQI----------------------------LSDHLCHKMTGRIINIH--HSFLPSFKGANPY---KQAY------  205 (288)
Q Consensus       165 LAgymri----------------------------l~~~~~~~~~~~iiNiH--pslLP~f~G~~~y---~~A~------  205 (288)
                      -||....                            .-|.+.++=.|+||||=  -+..| ++|..+|   +.|+      
T Consensus       110 NAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~G~IVnisS~~~~~~-~~~~~~Y~asKaal~~ltk~  188 (277)
T 3gvc_A          110 NAGVVHLASLIDTTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVA-VGGTGAYGMSKAGIIQLSRI  188 (277)
T ss_dssp             CCCCCCCBCTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCEEEEEECCGGGTSC-CTTBHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCC-CCCCHHHHHHHHHHHHHHHH
T ss_conf             99889999904499999999999981999999999999887659944999834665678-99977899999999999999


Q ss_pred             ---HCCCCEEEEEEEEEECCCCCCCE
Q ss_conf             ---42683762257753055688834
Q gi|254780911|r  206 ---EYGVKIIGATAHYAICELDAGPI  228 (288)
Q Consensus       206 ---~~Gvk~~G~TvH~V~~~lD~GpI  228 (288)
                         |-+  -.|.+|.-|.++.=.-|+
T Consensus       189 lA~ela--~~gIrVN~V~PG~i~T~~  212 (277)
T 3gvc_A          189 TAAELR--SSGIRSNTLLPAFVDTPM  212 (277)
T ss_dssp             HHHHHG--GGTEEEEEEEECSBCCHH
T ss_pred             HHHHHH--HHCEEEEEEEECCCCCHH
T ss_conf             999860--419199999628898715


No 51 
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}
Probab=83.95  E-value=1.5  Score=23.22  Aligned_cols=18  Identities=11%  Similarity=0.434  Sum_probs=9.2

Q ss_pred             HHHHHHHHCCCCEEECCC
Q ss_conf             667778860997474168
Q gi|254780911|r  122 THKKLVENYQLPFYYLPM  139 (288)
Q Consensus       122 d~~~lA~~~gIP~~~i~~  139 (288)
                      |++.+|+..|||++.++.
T Consensus        61 da~~va~~LgIp~~~~d~   78 (376)
T 2hma_A           61 DVVAVADQIGIPYYSVNF   78 (376)
T ss_dssp             HHHHHHHHHTCCEEEEEC
T ss_pred             HHHHHHHHCCCCEEEECH
T ss_conf             999999985998899650


No 52 
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A*
Probab=83.49  E-value=2.5  Score=21.64  Aligned_cols=165  Identities=14%  Similarity=0.124  Sum_probs=83.8

Q ss_pred             CCCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEEC--CHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             56553899970886--7989999862046741589999977--3466777886099747416873352776789999973
Q gi|254780911|r   81 KEATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSN--HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIE  156 (288)
Q Consensus        81 ~~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN--~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~  156 (288)
                      ..++|++||.|.+.  .+--+++.+..+   .-+|.++.+|  .+.+...+++++-++.++.-.+     ....+.+.+.
T Consensus         2 ~~~K~I~IlGsTGSIG~~tL~Vi~~~~d---~f~v~~Lsa~~n~~~L~~q~~~f~p~~v~i~d~~-----~~~~lk~~~~   73 (388)
T 1r0k_A            2 SQPRTVTVLGATGSIGHSTLDLIERNLD---RYQVIALTANRNVKDLADAAKRTNAKRAVIADPS-----LYNDLKEALA   73 (388)
T ss_dssp             CCCEEEEEETTTSHHHHHHHHHHHHTGG---GEEEEEEEESSCHHHHHHHHHHTTCSEEEESCGG-----GHHHHHHHTT
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCC---CCEEEEEEECCCHHHHHHHHHHHCCCEEEECCHH-----HHHHHHHHCC
T ss_conf             9988899988586989999999982958---7089999958989999999999699999994899-----9999998657


Q ss_pred             HCCCEEEEECCCCCCCCHHHHHHCC-CCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC--CCCCCEEEEE-
Q ss_conf             3394099982767548877863277-84796133667678999958999742683762257753055--6888344444-
Q gi|254780911|r  157 KNNVELMILARYMQILSDHLCHKMT-GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE--LDAGPIIEQD-  232 (288)
Q Consensus       157 ~~~~DlivLAgymril~~~~~~~~~-~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~--lD~GpII~Q~-  232 (288)
                      ..++.  ++.|.--+   ..+...+ .-++|-    +-.+-|..|--.|++.|-++.     +.|-|  +=+|++|.+. 
T Consensus        74 ~~~~~--~~~g~~~l---~~~~~~~~D~vv~a----i~G~aGL~pt~~ai~~gk~i~-----lANKEslV~~G~~~~~~~  139 (388)
T 1r0k_A           74 GSSVE--AAAGADAL---VEAAMMGADWTMAA----IIGCAGLKATLAAIRKGKTVA-----LANKESLVSAGGLMIDAV  139 (388)
T ss_dssp             TCSSE--EEESHHHH---HHHHTSCCSEEEEC----CCSGGGHHHHHHHHHTTSEEE-----ECCSHHHHTTHHHHHHHH
T ss_pred             CCCEE--EECCHHHH---HHHCCCCCCEEEEE----CCCHHHHHHHHHHHHCCCEEE-----EECCCEEEEECHHHHHHH
T ss_conf             89838--95073787---77413677889993----585757999999997699189-----832525998228889999


Q ss_pred             ------EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             ------665188889999999999999999999999987691788688579808886763
Q gi|254780911|r  233 ------VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       233 ------~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                            .+||+              =||-.+.+.++-.-.     .+=+.++.+|+-|-.
T Consensus       140 ~~~~~~iiPvD--------------SEH~ai~q~l~~~~~-----~~i~ki~lTASGGpF  180 (388)
T 1r0k_A          140 REHGTTLLPVD--------------SEHNAIFQCFPHHNR-----DYVRRIIITASGGPF  180 (388)
T ss_dssp             HHHTCEEEECS--------------HHHHHHHHHCCTTCG-----GGEEEEEEEECCCTT
T ss_pred             HHCCCEEEECC--------------CHHHHHHHHHCCCCC-----CCEEEEEEECCCCHH
T ss_conf             97398688704--------------107599998515772-----001079996357136


No 53 
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii}
Probab=81.55  E-value=2.9  Score=21.15  Aligned_cols=57  Identities=11%  Similarity=0.059  Sum_probs=37.3

Q ss_pred             CCCCCCEEEEECCCC-CC-HHHHHHHHCCCCCEEEEEEEEECC------HHHHHHHHHCCCCEEECCCCC
Q ss_conf             456553899970886-79-899998620467415899999773------466777886099747416873
Q gi|254780911|r   80 TKEATKTLILVSQPD-HC-LNDLLYRWNIGTLALNIVGVVSNH------TTHKKLVENYQLPFYYLPMTE  141 (288)
Q Consensus        80 ~~~~~riailvSg~g-sn-L~~Ll~~~~~g~L~~eI~~VISN~------~d~~~lA~~~gIP~~~i~~~~  141 (288)
                      .-+.+|++|+.||+- |. +..|+.  +   +..++.+|--|+      +.+..+|+..|||++.++.++
T Consensus         3 ~~k~~kv~V~~SGG~DS~~la~ll~--~---~g~~v~~v~~~~~~~~~~~~a~~~a~~lgi~~~~~~~~~   67 (203)
T 3k32_A            3 AMKLMDVHVLFSGGKDSSLSAVILK--K---LGYNPHLITINFGVIPSYKLAEETAKILGFKHKVITLDR   67 (203)
T ss_dssp             ---CEEEEEECCCSHHHHHHHHHHH--H---TTEEEEEEEEECSSSCTTHHHHHHHHHHTCEEEEEECCT
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHH--H---CCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCH
T ss_conf             5533708999558789999999999--7---199769999879951478999999999699718985789


No 54 
>2o4u_X Dimeric dihydrodiol dehydrogenase; NADP-binding rossmann-fold domain, predominantly anti- parallel beta sheet, oxidoreductase; 2.00A {Macaca fascicularis} PDB: 2o48_X 2poq_X*
Probab=80.95  E-value=3  Score=21.01  Aligned_cols=82  Identities=11%  Similarity=0.081  Sum_probs=39.9

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC---CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             9899998620467415899999773466777---886099747416873---3527767899999733394099982767
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE---QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~---~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      ++.+|+...     .++++.|.+.......+   |-++|.+.+.   ++   .+-++. .++.++.++.+  +.+..||+
T Consensus        57 ~~~~ll~~~-----~iD~v~I~tp~~~h~~~~~~al~~gkhVl~---EKP~~~~~~e~-~~l~~~a~~~~--~~~~v~~~  125 (334)
T 2o4u_X           57 SYEELAKDP-----NVEVAYVGTQHPQHKAAVMLCLAAGKAVLC---EKPMGVNAAEV-REMVTEARSRG--LFLMEAIW  125 (334)
T ss_dssp             SHHHHHTCT-----TCSEEEECCCGGGHHHHHHHHHHTTCEEEE---CSSSSSSHHHH-HHHHHHHHHHT--CCEEECCG
T ss_pred             CHHHHHCCC-----CCCEEEEECCCCCCHHHHHHHHHCCCEEEE---CCCCCCCCCCH-HHHHHHHHHCC--CCEEEEEE
T ss_conf             999995699-----998899905654114778999986991884---69862122210-23444454235--42157641


Q ss_pred             CCCCHHHHH-------HCCCCEEEEC
Q ss_conf             548877863-------2778479613
Q gi|254780911|r  170 QILSDHLCH-------KMTGRIINIH  188 (288)
Q Consensus       170 ril~~~~~~-------~~~~~iiNiH  188 (288)
                      +-..|.+..       .--|++..++
T Consensus       126 ~r~~p~~~~~~~~i~~g~~G~i~~~~  151 (334)
T 2o4u_X          126 TRFFPASEALRSVLAQGTLGDLRVAR  151 (334)
T ss_dssp             GGGSHHHHHHHHHHHHTTTCSEEEEE
T ss_pred             CCCCCHHHHHHHHHHCCCCCCEEEEE
T ss_conf             02670688888776438747369999


No 55 
>1g8l_A Molybdopterin biosynthesis MOEA protein; molybdenum cofactor biosynthesis, metal binding protein; 1.95A {Escherichia coli} SCOP: b.85.6.1 b.103.1.1 c.57.1.2 PDB: 1fc5_A 1g8r_A 2nqu_A 2nro_A 2nqq_A 2nqk_A 2nqr_A 2nqm_A 2nqs_A 2nrp_A 2nqv_A 2nrs_A 2nqn_A
Probab=80.30  E-value=2.3  Score=21.84  Aligned_cols=82  Identities=7%  Similarity=-0.002  Sum_probs=54.7

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             44565538999708867989999862046741589999977346677788609974741687335277678999997333
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN  158 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~  158 (288)
                      ...+++|++|+.+|..-.        ..|+-...=...=||..-+..+.+++|+.....++-.+++++..+.+.+.+.  
T Consensus       173 ~V~~~prV~iisTGdEL~--------~~g~~~~~g~i~dsN~~~l~a~l~~~G~~~~~~~~~~Dd~~~i~~~~~~~~~--  242 (411)
T 1g8l_A          173 PVIRKVRVALFSTGDELQ--------LPGQPLGDGQIYDTNRLAVHLMLEQLGCEVINLGIIRDDPHALRAAFIEADS--  242 (411)
T ss_dssp             EEECCCEEEEEEECTTEE--------CTTSCCCSSCEECCHHHHHHHHHHHTTCEEEEEEEECSCHHHHHHHHHHHHH--
T ss_pred             EEECCCEEEEEECCCCCC--------CCCCCCCCCEEEECCHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHH--
T ss_conf             993598799996686456--------8999799871983458999999997799899746426869999999875442--


Q ss_pred             CCEEEEECCCCC
Q ss_conf             940999827675
Q gi|254780911|r  159 NVELMILARYMQ  170 (288)
Q Consensus       159 ~~DlivLAgymr  170 (288)
                      +.|+|+..|=.-
T Consensus       243 ~~DiiIttGG~S  254 (411)
T 1g8l_A          243 QADVVISSGGVS  254 (411)
T ss_dssp             HCSEEEECSSSC
T ss_pred             CCCEEEECCCCC
T ss_conf             035588515755


No 56 
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043}
Probab=80.27  E-value=3.2  Score=20.86  Aligned_cols=33  Identities=9%  Similarity=0.093  Sum_probs=17.4

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEE
Q ss_conf             9649999985998766888999998579818973
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDI   34 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~   34 (288)
                      |++.-+=+.|-..-+ +......+.+.|+.|.-+
T Consensus         2 MkkirigiiG~g~~~-~~~~~~~~~~~~~elvav   34 (336)
T 2p2s_A            2 MKKIRFAAIGLAHNH-IYDMCQQLIDAGAELAGV   34 (336)
T ss_dssp             --CCEEEEECCSSTH-HHHHHHHHHHTTCEEEEE
T ss_pred             CCCCEEEEECCCHHH-HHHHHHHHHCCCCEEEEE
T ss_conf             960569999368899-999998865089789999


No 57 
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V}
Probab=80.16  E-value=2.8  Score=21.32  Aligned_cols=85  Identities=16%  Similarity=0.216  Sum_probs=45.1

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEEC-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             79899998620467415899999773466777---88609974741-687335277678999997333940999827675
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYL-PMTEQNKIESEQKLINIIEKNNVELMILARYMQ  170 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i-~~~~~~k~~~e~~il~~l~~~~~DlivLAgymr  170 (288)
                      .++.+++..   .  .++++.|.+....-..+   |-++|.+.+.= |.. .+-+++ .++.++.++.++  .++-+|++
T Consensus        57 ~~~~~ll~~---~--~~D~V~I~tp~~~H~~~~~~al~~gk~vl~EKP~a-~~~~e~-~~l~~~~~~~~~--~~~v~~~~  127 (329)
T 3evn_A           57 DKLEDMLAD---E--SIDVIYVATINQDHYKVAKAALLAGKHVLVEKPFT-LTYDQA-NELFALAESCNL--FLMEAQKS  127 (329)
T ss_dssp             SCHHHHHTC---T--TCCEEEECSCGGGHHHHHHHHHHTTCEEEEESSCC-SSHHHH-HHHHHHHHHTTC--CEEEECSS
T ss_pred             CCHHHHHCC---C--CCCEEEECCCHHHHHHHHHHHHHCCCEEEEEECCC-CCHHHH-HHHHHHHHHCCC--CCEEEECC
T ss_conf             899999628---8--98889905826655577899998799899972454-558998-654445531354--20343102


Q ss_pred             CCCHHHHH------H-CCCCEEEEC
Q ss_conf             48877863------2-778479613
Q gi|254780911|r  171 ILSDHLCH------K-MTGRIINIH  188 (288)
Q Consensus       171 il~~~~~~------~-~~~~iiNiH  188 (288)
                      ...|.+..      . .-|++..++
T Consensus       128 r~~p~~~~~k~~i~~g~iG~i~~i~  152 (329)
T 3evn_A          128 VFIPMTQVIKKLLASGEIGEVISIS  152 (329)
T ss_dssp             CSSHHHHHHHHHHHTTTTCSEEEEE
T ss_pred             CCCCCHHHHHHHHHCCCCCCCCCCC
T ss_conf             4687136666676549978641012


No 58 
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A
Probab=79.71  E-value=3.3  Score=20.74  Aligned_cols=56  Identities=9%  Similarity=0.051  Sum_probs=25.5

Q ss_pred             CCCCCCCEEEEECCCCCCHHHH--HHHHCCCCCEEEEEEEEECCH-HHHHHHHHCCCCE
Q ss_conf             4456553899970886798999--986204674158999997734-6677788609974
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLNDL--LYRWNIGTLALNIVGVVSNHT-THKKLVENYQLPF  134 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~~L--l~~~~~g~L~~eI~~VISN~~-d~~~lA~~~gIP~  134 (288)
                      ...++.|++|..-|.++-+..-  +.+.+.-.=..||++|.+-.+ .+..+|+++|+|.
T Consensus        35 p~~~piRvGiIG~G~~~g~~~~~H~~al~~~~~~~elvAv~d~~~e~a~~~a~~~g~~~   93 (479)
T 2nvw_A           35 PSSRPIRVGFVGLTSGKSWVAKTHFLAIQQLSSQFQIVALYNPTLKSSLQTIEQLQLKH   93 (479)
T ss_dssp             GGGCCEEEEEECCCSTTSHHHHTHHHHHHHTTTTEEEEEEECSCHHHHHHHHHHTTCTT
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             99997279999689876479999999998379887999998899999999999858897


No 59 
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogenase; structural genomics, short-chain dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2
Probab=79.00  E-value=3.5  Score=20.60  Aligned_cols=106  Identities=19%  Similarity=0.229  Sum_probs=48.5

Q ss_pred             CCEEEEC--CCCCCCCCCCCHH---HHH---------HHCCCCEEEEEEEEEECCCCCCCEEEEEEEE---CCCCCCHHH
Q ss_conf             8479613--3667678999958---999---------7426837622577530556888344444665---188889999
Q gi|254780911|r  182 GRIINIH--HSFLPSFKGANPY---KQA---------YEYGVKIIGATAHYAICELDAGPIIEQDVVR---VTHAQTIED  244 (288)
Q Consensus       182 ~~iiNiH--pslLP~f~G~~~y---~~A---------~~~Gvk~~G~TvH~V~~~lD~GpII~Q~~~~---v~~~dt~~~  244 (288)
                      +.|||+=  .++.| ++|..+|   +.|         +..-..-.|.+|.-|.++.=.-|++..-.-.   -...+..+.
T Consensus       133 g~IinisS~~~~~~-~~~~~~Y~asKaav~~ltrs~ala~el~~~gIrVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~  211 (267)
T 2gdz_A          133 GIIINMSSLAGLMP-VAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDH  211 (267)
T ss_dssp             EEEEEECCGGGTSC-CTTCHHHHHHHHHHHHHHHHHHHHHHHHTCCEEEEEEEESCBSSHHHHGGGCHHHHGGGGGGHHH
T ss_pred             EEEEEEEEHHCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHCCCCHHCCCCHHHHHH
T ss_conf             19999715200778-88975899999999999989999998578885999996188987455402500000023889999


Q ss_pred             HHHH---HHHHHHHHHHHHHHHHHCCE------EEEECCEEEECCCCC---CCCCC
Q ss_conf             9999---99999999999999987691------788688579808886---76359
Q gi|254780911|r  245 YIAI---GKNIEAKVLTKAVNAHIQQR------VFINKRKTIVFPAYP---NNYFQ  288 (288)
Q Consensus       245 l~~~---~~~~E~~~l~~av~~~~e~r------v~~~~~ktvvf~~~~---~~~~~  288 (288)
                      +.+.   ++-.+..=.++++-+.+++.      +.++|++++-|+.+.   +-||+
T Consensus       212 ~~~~~p~~r~~~peevA~~v~fL~s~~~itG~~i~VdGG~~~~~~~~~~~~~~~~~  267 (267)
T 2gdz_A          212 IKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYGSKENLYFQ  267 (267)
T ss_dssp             HHHHHHHHCCBCHHHHHHHHHHHHHCTTCSSCEEEEETTTEEEECCCCSCTTGGGC
T ss_pred             HHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEECCCCEEECCCCCCCCCCCCC
T ss_conf             98458988983999999999999767889988899899972151689975566779


No 60 
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica}
Probab=78.98  E-value=3.5  Score=20.59  Aligned_cols=72  Identities=13%  Similarity=0.222  Sum_probs=41.1

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC---CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             9899998620467415899999773466777---886099747416873---3527767899999733394099982767
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE---QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~---~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      ..+++|..-     ..+++.|.+.+.....+   |-++|.+  ++ ++|   .+.++.+ ++.++.++.  .+++..+|+
T Consensus        55 ~~~ell~~~-----~vD~V~i~tp~~~H~~~~~~al~~gkh--V~-~EKPla~~~~ea~-~l~~~a~~~--g~~~~v~~~  123 (387)
T 3moi_A           55 TLAEMMQHV-----QMDAVYIASPHQFHCEHVVQASEQGLH--II-VEKPLTLSRDEAD-RMIEAVERA--GVHLVVGTS  123 (387)
T ss_dssp             SHHHHHHHS-----CCSEEEECSCGGGHHHHHHHHHHTTCE--EE-ECSCCCSCHHHHH-HHHHHHHHH--TCCEEECCC
T ss_pred             CHHHHHCCC-----CCCEEEECCCCHHHHHHHHHHHHHCCC--EE-CCCCCCCCHHHHH-HHHHHHHHH--CCEEEEEEC
T ss_conf             999996599-----998899908967899999999861895--65-3788879999999-999999980--994897222


Q ss_pred             CCCCHHHHH
Q ss_conf             548877863
Q gi|254780911|r  170 QILSDHLCH  178 (288)
Q Consensus       170 ril~~~~~~  178 (288)
                      +-..|.+..
T Consensus       124 ~r~~p~~~~  132 (387)
T 3moi_A          124 RSHDPVVRT  132 (387)
T ss_dssp             GGGSHHHHH
T ss_pred             CCCCHHHHH
T ss_conf             336848999


No 61 
>2q8n_A Glucose-6-phosphate isomerase; TM1385, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: 2PE; 1.82A {Thermotoga maritima MSB8}
Probab=78.48  E-value=3.6  Score=20.49  Aligned_cols=57  Identities=12%  Similarity=0.074  Sum_probs=35.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHH-------CCCCCEEEEEEEEECCHH--HHHHHHHCCCCEEECCC
Q ss_conf             5538999708867989999862-------046741589999977346--67778860997474168
Q gi|254780911|r   83 ATKTLILVSQPDHCLNDLLYRW-------NIGTLALNIVGVVSNHTT--HKKLVENYQLPFYYLPM  139 (288)
Q Consensus        83 ~~riailvSg~gsnL~~Ll~~~-------~~g~L~~eI~~VISN~~d--~~~lA~~~gIP~~~i~~  139 (288)
                      +.-..|.+||.|++++-+....       +.|.-..+-.+|++|...  +..+|++++++.+.+|-
T Consensus       140 ~~TlfiviSKSGtT~ETl~n~~~~~~~l~~~~~~~~~~~~v~t~~~~~~l~~~a~~~~~~~f~~~~  205 (460)
T 2q8n_A          140 KTTLFNVISKSGSTAEVMATYSIARGILEAYGLDPREHMLITTDPEKGFLRKLVKEEGFRSLEVPP  205 (460)
T ss_dssp             GGEEEEEECSSSCCHHHHHHHHHHHHHHHHTTCCGGGTEEEEECSSSSHHHHHHHHHTCEEEECCT
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             527999986998988999999999999997388656554433143167887566886444404887


No 62 
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}
Probab=78.07  E-value=3.7  Score=20.41  Aligned_cols=163  Identities=11%  Similarity=0.061  Sum_probs=86.0

Q ss_pred             HHHHHHHHHCCCCCCEECCCCCCCCCEEEEE----CCCCCCHHHHHHHHCCCCCEEEEEEEEEC--CH----HHHHHHHH
Q ss_conf             7988898740023202012445655389997----08867989999862046741589999977--34----66777886
Q gi|254780911|r   60 FIADFQPIVQQFSLQYSIRNTKEATKTLILV----SQPDHCLNDLLYRWNIGTLALNIVGVVSN--HT----THKKLVEN  129 (288)
Q Consensus        60 l~~~f~~ia~~~~m~~~i~~~~~~~riailv----Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~----d~~~lA~~  129 (288)
                      +...+.++...-.....+.....++++..|+    ||.-+++.-|-.+.+...-  .+.++-++  +.    .++.+|+.
T Consensus        76 l~~~l~~~L~~~~~~~~~~~~~~~p~vi~~vG~~G~GKTTTiaKLA~~~~~~~~--kv~lva~Dt~R~aA~eQL~~~a~~  153 (302)
T 3b9q_A           76 LKESVLEMLAKKNSKTELQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGT--KVLMAAGDTFRAAASDQLEIWAER  153 (302)
T ss_dssp             HHHHHHHHHCC--CCCSCCCCSSSCEEEEEECCTTSCHHHHHHHHHHHHHHTTC--CEEEECCCCSCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCC--CCCEECCCCCCHHHHHHHHHHHHH
T ss_conf             999999863343663012204789869997579888677499999999997699--873211565787799999999864


Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCCCCCCCH---HH------HH----HCCCCEEEECCCCCCC
Q ss_conf             09974741687335277678999997333940999--8276754887---78------63----2778479613366767
Q gi|254780911|r  130 YQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMI--LARYMQILSD---HL------CH----KMTGRIINIHHSFLPS  194 (288)
Q Consensus       130 ~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dliv--LAgymril~~---~~------~~----~~~~~iiNiHpslLP~  194 (288)
                      .++|++.................+..+..+.|+|+  .||-++.=..   ++      +.    ..+..++=    .|++
T Consensus       154 ~~v~~~~~~~~~~~~~~~~~~~~~~a~~~~~D~ilIDTaGR~~~~~~lm~el~~i~~~~~k~~~~~p~e~~L----Vlda  229 (302)
T 3b9q_A          154 TGCEIVVAEGDKAKAATVLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILL----VLDG  229 (302)
T ss_dssp             HTCEEECCC--CCCHHHHHHHHHHHHHHTTCSEEEECCCCCSSCCHHHHHHHHHHHHHHHTTSTTCCSEEEE----EEEG
T ss_pred             CCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEE----EEEC
T ss_conf             265303303652068899999999999779999998488878565889999999999986126889856899----8405


Q ss_pred             CCCCCHHHHHHH--CCCCEEEEEEEEEECCCCCCCE
Q ss_conf             899995899974--2683762257753055688834
Q gi|254780911|r  195 FKGANPYKQAYE--YGVKIIGATAHYAICELDAGPI  228 (288)
Q Consensus       195 f~G~~~y~~A~~--~Gvk~~G~TvH~V~~~lD~GpI  228 (288)
                      -.|.+...||..  ..+.++|+-.--+|+.--.|.+
T Consensus       230 ~~gq~~~~q~~~f~~~~~~~g~IlTKlD~~ak~G~~  265 (302)
T 3b9q_A          230 NTGLNMLPQAREFNEVVGITGLILTKLDGSARGGCV  265 (302)
T ss_dssp             GGGGGGHHHHHHHHHHTCCCEEEEECCSSCSCTHHH
T ss_pred             CCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHH
T ss_conf             668889999999860689987999621289963699


No 63 
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reductase family; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus HB8}
Probab=77.35  E-value=3.9  Score=20.27  Aligned_cols=101  Identities=15%  Similarity=0.137  Sum_probs=46.3

Q ss_pred             CCCCCHHHHHHCCCCEEEECCCC-CCCCCCCCHH---HHHHHC-------CCCEEEEEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             75488778632778479613366-7678999958---999742-------683762257753055688834444466518
Q gi|254780911|r  169 MQILSDHLCHKMTGRIINIHHSF-LPSFKGANPY---KQAYEY-------GVKIIGATAHYAICELDAGPIIEQDVVRVT  237 (288)
Q Consensus       169 mril~~~~~~~~~~~iiNiHpsl-LP~f~G~~~y---~~A~~~-------Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~  237 (288)
                      +|-.-|.+.++=.|+||||=-.. +-.++|..+|   +.|+..       -..-.|.+|.-|.++.=.-|+.. ....-.
T Consensus       117 ~~~~~p~m~~~~~G~IvnisS~~~~~~~~~~~~Y~asK~al~~lt~~la~el~~~gIrVn~I~PG~v~T~~~~-~~~~~~  195 (234)
T 2ehd_A          117 IRHAVPALLRRGGGTIVNVGSLAGKNPFKGGAAYNASKFGLLGLAGAAMLDLREANVRVVNVLPGSVDTGFAG-NTPGQA  195 (234)
T ss_dssp             HHHHHHHHHTTTCEEEEEECCTTTTSCCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEECC---------------
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCC-CCCCCC
T ss_conf             9999999998499789998468777889998479999999999999999984812859999971889770000-788775


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHC--CEEEEECCEEEECCCCCC
Q ss_conf             88899999999999999999999999876--917886885798088867
Q gi|254780911|r  238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQ--QRVFINKRKTIVFPAYPN  284 (288)
Q Consensus       238 ~~dt~~~l~~~~~~~E~~~l~~av~~~~e--~rv~~~~~ktvvf~~~~~  284 (288)
                      ...++|++            ++++-+.++  ..+++  +..+|.|-.|.
T Consensus       196 ~~~~Pedi------------A~~i~~l~s~~~~~~i--~~i~i~Pt~~~  230 (234)
T 2ehd_A          196 WKLKPEDV------------AQAVLFALEMPGHAMV--SEIELRPTRPT  230 (234)
T ss_dssp             --CCHHHH------------HHHHHHHHHSCCSSCC--CEEECCC----
T ss_pred             CCCCHHHH------------HHHHHHHHCCCCCCCC--CCEEEEECCCC
T ss_conf             46999999------------9999999789943468--98899989999


No 64 
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus}
Probab=77.24  E-value=3.9  Score=20.25  Aligned_cols=89  Identities=13%  Similarity=0.172  Sum_probs=52.7

Q ss_pred             CCEEEEECCCCCC---------------HHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHH
Q ss_conf             5389997088679---------------8999986204674158999997734667778860997474168733527767
Q gi|254780911|r   84 TKTLILVSQPDHC---------------LNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESE  148 (288)
Q Consensus        84 ~riailvSg~gsn---------------L~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e  148 (288)
                      ++++||+-|.|+=               ++-++++.+    +.....|+++..+...+...+++++..-.......   -
T Consensus         1 m~~~ILAgG~ssRmg~~K~ll~l~Gkpli~~vi~~l~----~~~~iivv~~~~~~~~~~~~~~~~~i~d~~~~~Gp---l   73 (208)
T 3ngw_A            1 MKVAVLVGGVGRRIGMEKTEVMLCGKKLIEWVLEKYS----PFQTVFVCRDEKQAEKLSSRYEAEFIWDLHKGVGS---I   73 (208)
T ss_dssp             CEEEEECCCCCTTTTSCGGGCEETTEEHHHHHHHHHT----TSEEEEECSSHHHHHHHHTTSCSCEECCTTCCCSH---H
T ss_pred             CEEEEECCCCCCCCCCCCCCCEECCCHHHHHHHHHHC----CCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCC---H
T ss_conf             9599986765446998961977998539999999834----61443334550578998751266301235788671---8


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCHHHHHHC
Q ss_conf             89999973339409998276754887786327
Q gi|254780911|r  149 QKLINIIEKNNVELMILARYMQILSDHLCHKM  180 (288)
Q Consensus       149 ~~il~~l~~~~~DlivLAgymril~~~~~~~~  180 (288)
                      ..+...++..+. ++|+++=|=.++++.++..
T Consensus        74 ~gi~~al~~~~~-~lv~~~D~Pli~~~~i~~l  104 (208)
T 3ngw_A           74 AGIHAALRHFGS-CVVAAIDMPFVKPEVLEHL  104 (208)
T ss_dssp             HHHHHHHHHHSS-EEEEETTCTTCCHHHHHHH
T ss_pred             HHHHHHHHHCCC-EEEECCCCCCCCHHHHHHH
T ss_conf             999999985030-0461589787769999999


No 65 
>1uz5_A MOEA protein, 402AA long hypothetical molybdopterin biosynthesis MOEA protein; MOEA molybdopterin, MOCF biosynthesis; 2.05A {Pyrococcus horikoshii} SCOP: b.85.6.1 b.103.1.1 c.57.1.2
Probab=77.19  E-value=2.4  Score=21.68  Aligned_cols=83  Identities=5%  Similarity=-0.026  Sum_probs=54.6

Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             44565538999708867989999862046741589999977346677788609974741687335277678999997333
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN  158 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~  158 (288)
                      ...+++|++|+.+|..=.  +.=...+.|    +  ..=||..-+..+.+++|+....+.+-.++++.....+.+.+.+ 
T Consensus       176 ~V~~~prV~iisTGdEl~--~~~~~~~~g----~--i~dsN~~~l~a~l~~~G~~~~~~~~~~D~~~~i~~~i~~~~~~-  246 (402)
T 1uz5_A          176 KVFRKPKVAVISTGNEIV--PPGNELKPG----Q--IYDINGRALCDAINELGGEGIFMGVARDDKESLKALIEKAVNV-  246 (402)
T ss_dssp             EEECCCEEEEEEECTTEE--CTTSCCCTT----C--EECCHHHHHHHHHHHHTSEEEEEEEECSSHHHHHHHHHHHHHH-
T ss_pred             EEECCCEEEEEECCCCCC--CCCCCCCCC----C--EEECCHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHCCCC-
T ss_conf             997287699993577656--989878999----6--8445599999999866972776266685689999987632223-


Q ss_pred             CCEEEEECCCCCC
Q ss_conf             9409998276754
Q gi|254780911|r  159 NVELMILARYMQI  171 (288)
Q Consensus       159 ~~DlivLAgymri  171 (288)
                       .|+|+..|=+-.
T Consensus       247 -~DivIttGG~S~  258 (402)
T 1uz5_A          247 -GDVVVISGGASG  258 (402)
T ss_dssp             -CSEEEEECCC--
T ss_pred             -CCEEEEECCCCC
T ss_conf             -544787547558


No 66 
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A*
Probab=76.48  E-value=2  Score=22.29  Aligned_cols=75  Identities=13%  Similarity=0.261  Sum_probs=34.9

Q ss_pred             CCCCCHHHHHHHHCCCCCEEEEEEEEECCH----HHHHHHHHCCCCEEECCCCCC----CHH---------HHHHHHHHH
Q ss_conf             886798999986204674158999997734----667778860997474168733----527---------767899999
Q gi|254780911|r   92 QPDHCLNDLLYRWNIGTLALNIVGVVSNHT----THKKLVENYQLPFYYLPMTEQ----NKI---------ESEQKLINI  154 (288)
Q Consensus        92 g~gsnL~~Ll~~~~~g~L~~eI~~VISN~~----d~~~lA~~~gIP~~~i~~~~~----~k~---------~~e~~il~~  154 (288)
                      .....+..+.+..+.-+-|.-+...-..+.    .+..+++..|+|...-+..+.    +..         -.......+
T Consensus       192 ~~~~~i~~~~~~l~~a~~P~ii~G~~~~~~~~~~~l~~la~~~~~pv~~~~~~~g~~~~~~~~~~~g~~g~~~~~~~~~~  271 (566)
T 1ozh_A          192 APDDAIDQVAKLIAQAKNPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNFSRFAGRVGLFNNQAGDRL  271 (566)
T ss_dssp             SCHHHHHHHHHHHHHCSSEEEEECGGGGSGGGHHHHHHHHHHHCCCEEECGGGTTTCCTTTCTTEEEECSSBTTCHHHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHCC
T ss_conf             99899999999998476984026886545211577887765228862102333676445665312314687688676235


Q ss_pred             HHHCCCEEEEECCC
Q ss_conf             73339409998276
Q gi|254780911|r  155 IEKNNVELMILARY  168 (288)
Q Consensus       155 l~~~~~DlivLAgy  168 (288)
                      +.  +.|+|++-|.
T Consensus       272 ~~--~~D~il~~G~  283 (566)
T 1ozh_A          272 LQ--LADLVICIGY  283 (566)
T ss_dssp             HH--HCSEEEEESC
T ss_pred             CC--CCCEEEECCC
T ss_conf             65--0315776486


No 67 
>2hig_A 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A*
Probab=75.88  E-value=2.3  Score=21.82  Aligned_cols=95  Identities=13%  Similarity=0.113  Sum_probs=48.9

Q ss_pred             CCCEECCCCCCCCCEEEEECCCCC-CHHHHHHHHCCCCCE-EEEEEEEECCHHHHHHHHHCCCCEEECCC----------
Q ss_conf             320201244565538999708867-989999862046741-58999997734667778860997474168----------
Q gi|254780911|r   72 SLQYSIRNTKEATKTLILVSQPDH-CLNDLLYRWNIGTLA-LNIVGVVSNHTTHKKLVENYQLPFYYLPM----------  139 (288)
Q Consensus        72 ~m~~~i~~~~~~~riailvSg~gs-nL~~Ll~~~~~g~L~-~eI~~VISN~~d~~~lA~~~gIP~~~i~~----------  139 (288)
                      +.+-+++....+.|++|+.||... .+++.|...-...+. ....-|+.=+....+|.+.....+.-++.          
T Consensus        86 g~r~~~~~~p~~~rIgIltsGGdaPGmNavIr~vv~~a~~~~~~~~V~Gi~~G~~GLi~~~~~~~~~L~~~~v~~i~~~G  165 (487)
T 2hig_A           86 AARSRIHFNPTETTIGIVTCGGICPGLNDVIRSITLTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYG  165 (487)
T ss_dssp             CCBSEESSCGGGCEEEEEECSSCCTTHHHHHHHHHHHHHHHHCCSEEEECSTGGGGGSHHHHTTCEEECHHHHTTGGGSS
T ss_pred             CCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCCCCCCCHHHHHHHHHCC
T ss_conf             99652135888858999885788476899999999999996599389998411488605997541018999984088569


Q ss_pred             -----CCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             -----7335277678999997333940999827
Q gi|254780911|r  140 -----TEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       140 -----~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                           +..+++ .-+++++.|+++++|.++.-|
T Consensus       166 GtiLGTsR~~e-~~~~i~~~L~~~~Id~LivIG  197 (487)
T 2hig_A          166 GTILGSSRGPQ-DPKEMVDTLERLGVNILFTVG  197 (487)
T ss_dssp             SCSSCCCCSCC-CHHHHHHHHHHHTCSEEEEEE
T ss_pred             CCEECCCCCCC-CHHHHHHHHHHHCCCEEEEEC
T ss_conf             70612589985-699999999984998799956


No 68 
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus}
Probab=75.65  E-value=4.3  Score=19.97  Aligned_cols=147  Identities=16%  Similarity=0.203  Sum_probs=68.6

Q ss_pred             CEEEEEEEEECCH---HHHHHHHHCCCCEEECCCCC-CCHH--HHHHHHHHHHHHCCCEEEEECC-----CCCCCCHHHH
Q ss_conf             4158999997734---66777886099747416873-3527--7678999997333940999827-----6754887786
Q gi|254780911|r  109 LALNIVGVVSNHT---THKKLVENYQLPFYYLPMTE-QNKI--ESEQKLINIIEKNNVELMILAR-----YMQILSDHLC  177 (288)
Q Consensus       109 L~~eI~~VISN~~---d~~~lA~~~gIP~~~i~~~~-~~k~--~~e~~il~~l~~~~~DlivLAg-----ymril~~~~~  177 (288)
                      +.....+++.--.   .....++.+|.......... ....  ..-..+-+++.  ..|+|++.=     --.++..+++
T Consensus       154 l~~k~~giiG~G~iG~~va~~~~~~g~~v~~~~~~~~~~~~~~~~~~~L~ell~--~sDiIslh~Plt~~T~~lIn~~~l  231 (416)
T 3k5p_A          154 VRGKTLGIVGYGNIGSQVGNLAESLGMTVRYYDTSDKLQYGNVKPAASLDELLK--TSDVVSLHVPSSKSTSKLITEAKL  231 (416)
T ss_dssp             STTCEEEEECCSHHHHHHHHHHHHTTCEEEEECTTCCCCBTTBEECSSHHHHHH--HCSEEEECCCC-----CCBCHHHH
T ss_pred             ECCEEEEEEECCCCCCEEEEECCCCCCEEEEECCCCCCHHCCEEECCCHHHHHH--HCCEEEECCCCCCCCCCHHHHHHH
T ss_conf             046089998126642111231013551577631654401023121489999975--288888714530023266689999


Q ss_pred             HHCCC--CEEEECCCCCCCCCCC----CHHHHHHHCCCCEEEEEEEEE-ECCCCC-----CCEEEEEEEECCC---CCCH
Q ss_conf             32778--4796133667678999----958999742683762257753-055688-----8344444665188---8899
Q gi|254780911|r  178 HKMTG--RIINIHHSFLPSFKGA----NPYKQAYEYGVKIIGATAHYA-ICELDA-----GPIIEQDVVRVTH---AQTI  242 (288)
Q Consensus       178 ~~~~~--~iiNiHpslLP~f~G~----~~y~~A~~~Gvk~~G~TvH~V-~~~lD~-----GpII~Q~~~~v~~---~dt~  242 (288)
                      ...+.  .+||+=       +|.    ...-+|++.| ++.|+-.-.- +|-+..     -|.....-+-+.|   .-|.
T Consensus       232 ~~mK~ga~lIN~a-------RG~iVDe~aL~~aL~~g-~i~gaalDVf~~EP~~~~~~~~~pl~~~~nVi~TPHig~~T~  303 (416)
T 3k5p_A          232 RKMKKGAFLINNA-------RGSDVDLEALAKVLQEG-HLAGAAIDVFPVEPASNGERFSTPLQGLENVILTPHIGGSTE  303 (416)
T ss_dssp             HHSCTTEEEEECS-------CTTSBCHHHHHHHHHTT-SEEEEEECCCSSCCSSTTSCCCCTTTTCTTEEECCSCTTCCH
T ss_pred             HCCCCCCEEEECC-------CCCCCCHHHHHHHHHCC-CCEEEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCH
T ss_conf             5089998688526-------65401899999999809-925899968999989854344583126997899994264869


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             9999999999999999999998769178
Q gi|254780911|r  243 EDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       243 ~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      |...+..     ....+.++-|+++.-.
T Consensus       304 ea~~~~~-----~~~~~ni~~~l~~g~~  326 (416)
T 3k5p_A          304 EAQERIG-----TEVTRKLVEYSDVGST  326 (416)
T ss_dssp             HHHHHHH-----HHHHHHHHHHHHHCCC
T ss_pred             HHHHHHH-----HHHHHHHHHHHHCCCC
T ss_conf             9999999-----9999999999816998


No 69 
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}
Probab=75.28  E-value=4.4  Score=19.90  Aligned_cols=146  Identities=12%  Similarity=0.079  Sum_probs=78.4

Q ss_pred             CCCCCCCCCEEEEE----CCCCCCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEEECCCCCCCHHH
Q ss_conf             12445655389997----08867989999862046741589999977--3466----77788609974741687335277
Q gi|254780911|r   77 IRNTKEATKTLILV----SQPDHCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFYYLPMTEQNKIE  146 (288)
Q Consensus        77 i~~~~~~~riailv----Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~~i~~~~~~k~~  146 (288)
                      +.....++.+..||    ||.-+++.-|-.+++....  .+.++-++  |..+    +.+|+..|+|+++......+...
T Consensus       150 ~~~~~~~p~vIl~vG~nGvGKTTTiaKLA~~~k~~g~--kv~l~a~DTfRaaAveQL~~~a~~~~v~~~~~~~~~~~~a~  227 (359)
T 2og2_A          150 LQLGFRKPAVIMIVGVNGGGKTTSLGKLAHRLKNEGT--KVLMAAGDTFRAAASDQLEIWAERTGCEIVVAEGDKAKAAT  227 (359)
T ss_dssp             CCCCSSSSEEEEEECCTTSCHHHHHHHHHHHHHHTTC--CEEEECCCCSCHHHHHHHHHHHHHHTCEEECCSSSSCCHHH
T ss_pred             CCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCC--CCEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCHHHHH
T ss_conf             3336789869999788888646179999999996699--86056404232769999999986428842421576227788


Q ss_pred             HHHHHHHHHHHCCCEEEE--ECCCCCCCCH---HHHH----------HCCCCEEEECCCCCCCCCCCCHHHHHHH--CCC
Q ss_conf             678999997333940999--8276754887---7863----------2778479613366767899995899974--268
Q gi|254780911|r  147 SEQKLINIIEKNNVELMI--LARYMQILSD---HLCH----------KMTGRIINIHHSFLPSFKGANPYKQAYE--YGV  209 (288)
Q Consensus       147 ~e~~il~~l~~~~~Dliv--LAgymril~~---~~~~----------~~~~~iiNiHpslLP~f~G~~~y~~A~~--~Gv  209 (288)
                      .....++.-+..+.|+|+  .||-++.=..   ++-+          ..+..++=+    |++--|.+...||..  .-+
T Consensus       228 v~~~a~~~Ak~~~~DvvlIDTAGR~~~~~~lm~EL~ki~~~i~k~~~~~p~e~lLV----lda~~gq~~~~qa~~f~~~~  303 (359)
T 2og2_A          228 VLSKAVKRGKEEGYDVVLCDTSGRLHTNYSLMEELIACKKAVGKIVSGAPNEILLV----LDGNTGLNMLPQAREFNEVV  303 (359)
T ss_dssp             HHHHHHHHHHHTTCSEEEEECCCCSSCCHHHHHHHHHHHHHHHHHSTTCCSEEEEE----EEGGGGGGGHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEE----ECCCCCHHHHHHHHHHHHCC
T ss_conf             88999999997799989984888785658899999999987631257898358998----23565889999999986058


Q ss_pred             CEEEEEEEEEECCCCCCCE
Q ss_conf             3762257753055688834
Q gi|254780911|r  210 KIIGATAHYAICELDAGPI  228 (288)
Q Consensus       210 k~~G~TvH~V~~~lD~GpI  228 (288)
                      .++|+-.--+|+.--.|.+
T Consensus       304 ~~~g~IlTKlD~tak~G~~  322 (359)
T 2og2_A          304 GITGLILTKLDGSARGGCV  322 (359)
T ss_dssp             CCCEEEEESCTTCSCTHHH
T ss_pred             CCCEEEEECCCCCCCCCHH
T ss_conf             9987999711289960599


No 70 
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis}
Probab=74.77  E-value=4.5  Score=19.81  Aligned_cols=84  Identities=13%  Similarity=0.183  Sum_probs=49.7

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             79899998620467415899999773466777---886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      .++.+|+..   .  .++++.|-+.+..-..+   |-++|+|.+.=  +.  .+.++. .+++++.++.+.  .++.+|+
T Consensus        57 ~~~~~ll~~---~--~iD~V~I~tp~~~H~~~~~~al~~gk~v~~E--KPl~~~~~e~-~~l~~~~~~~~~--~~~v~~~  126 (330)
T 3e9m_A           57 GSYEELCKD---E--TIDIIYIPTYNQGHYSAAKLALSQGKPVLLE--KPFTLNAAEA-EELFAIAQEQGV--FLMEAQK  126 (330)
T ss_dssp             SSHHHHHHC---T--TCSEEEECCCGGGHHHHHHHHHHTTCCEEEC--SSCCSSHHHH-HHHHHHHHHTTC--CEEECCS
T ss_pred             CCHHHHHCC---C--CCCEEEECCCHHHHHHHHHHHHHCCCCEEEC--CCCHHHHHHH-HHHHHHHHHHCC--CEEEEEC
T ss_conf             999999548---9--9998998997076899999999859957640--3211225677-889999986354--1121001


Q ss_pred             CCCCHHHHH-------HCCCCEEEEC
Q ss_conf             548877863-------2778479613
Q gi|254780911|r  170 QILSDHLCH-------KMTGRIINIH  188 (288)
Q Consensus       170 ril~~~~~~-------~~~~~iiNiH  188 (288)
                      +-..|.+..       .--|++..+.
T Consensus       127 ~r~~p~~~~~k~~i~~~~iG~i~~~~  152 (330)
T 3e9m_A          127 SVFLPITQKVKATIQEGGLGEILWVQ  152 (330)
T ss_dssp             GGGCHHHHHHHHHHHTTTTCSEEEEE
T ss_pred             CCCCCCHHHHHHHHHCCCCCCEEEEE
T ss_conf             24576313444466517866137876


No 71 
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2}
Probab=74.65  E-value=4.5  Score=19.80  Aligned_cols=98  Identities=16%  Similarity=0.271  Sum_probs=48.6

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECCHHHHH---HHHHCCCCEEEC-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             989999862046741589999977346677---788609974741-6873352776789999973339409998276754
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNHTTHKK---LVENYQLPFYYL-PMTEQNKIESEQKLINIIEKNNVELMILARYMQI  171 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~---lA~~~gIP~~~i-~~~~~~k~~~e~~il~~l~~~~~DlivLAgymri  171 (288)
                      .++++|..   .  ..+++.|.+.......   .|-++|++.+.= |.. .+.++ -.+++++.++.+.- ++..||++.
T Consensus        78 ~~~ell~~---~--~iDaV~I~Tp~~~H~~~~~~al~~GkhVl~EKPla-~~~~e-~~~l~~~~~~~~~~-~~~v~~~~R  149 (357)
T 3ec7_A           78 DYHDLIND---K--DVEVVIITASNEAHADVAVAALNANKYVFCEKPLA-VTAAD-CQRVIEAEQKNGKR-MVQIGFMRR  149 (357)
T ss_dssp             SHHHHHHC---T--TCCEEEECSCGGGHHHHHHHHHHTTCEEEEESSSC-SSHHH-HHHHHHHHHHHTSC-CEEEECGGG
T ss_pred             CHHHHHCC---C--CCCEEEECCCCCCCHHHHHHHHHCCCEEEECCCCH-HHHHH-HHHHHHHHCCCCCC-CCCCCCCCC
T ss_conf             99999659---9--98889988985000045788985177699758813-55899-99987653025664-323332212


Q ss_pred             CCHHHHHH-------CCCCEE-----EECCCCCCCCCCCCHH
Q ss_conf             88778632-------778479-----6133667678999958
Q gi|254780911|r  172 LSDHLCHK-------MTGRII-----NIHHSFLPSFKGANPY  201 (288)
Q Consensus       172 l~~~~~~~-------~~~~ii-----NiHpslLP~f~G~~~y  201 (288)
                      ..|.+...       .-|++.     .-++...|.+.+.++.
T Consensus       150 ~~p~~~~~k~~i~~g~~G~~~~i~~~~~~~~~~~~~~~gg~l  191 (357)
T 3ec7_A          150 YDKGYVQLKNIIDSGEIGQPLMVHGRHYNASTVPEYKTPQAI  191 (357)
T ss_dssp             GSHHHHHHHHHHHHTTTCSEEEEEEEEECSCCCTTCCTTHHH
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHCCCCCC
T ss_conf             688999999987631268631001001455677401035664


No 72 
>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp}
Probab=74.31  E-value=4.4  Score=19.87  Aligned_cols=24  Identities=4%  Similarity=-0.004  Sum_probs=20.8

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHH
Q ss_conf             964999998599876688899999
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYL   24 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~L   24 (288)
                      |++.-+..++-|.||+=+.+.++.
T Consensus         1 mkrI~IltsGG~~pG~Na~i~~~v   24 (319)
T 1zxx_A            1 MKRIGILTSGGDAPGMNAAVRAVT   24 (319)
T ss_dssp             CCEEEEEECSSCCTTHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             988999884787466999999999


No 73 
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A
Probab=73.47  E-value=4.9  Score=19.60  Aligned_cols=112  Identities=11%  Similarity=0.112  Sum_probs=60.2

Q ss_pred             EEEE-ECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECC-CCHHHHHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             9999-8599876688899999857981897344432436889999999728-8527779888987400232020124456
Q gi|254780911|r    5 ILTI-TCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLFIADFQPIVQQFSLQYSIRNTKE   82 (288)
Q Consensus         5 iLti-~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~-~~~~~l~~~f~~ia~~~~m~~~i~~~~~   82 (288)
                      .+++ ..||++|..+++.+.|++++.||--+.|........ ++-+.|... .+.......+.++..++.-...+.  ..
T Consensus        18 ~iti~g~~~~~g~~a~iF~~la~~~I~VdmI~q~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~   94 (167)
T 2dt9_A           18 QIGLIGIPDQPGIAAKVFQALAERGIAVDMIIQGVPGHDPS-RQQMAFTVKKDFAQEALEALEPVLAEIGGEAILR--PD   94 (167)
T ss_dssp             EEEEEEEECSTTHHHHHHHHHHHHTCCCSCEEBCCCCSCTT-EEEEEEEEEGGGHHHHHHHHHHHHHHHCCEEEEE--CS
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-EEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEE--CC
T ss_conf             99990789997679999999998298804787124566773-0023313407799999888887787627514871--79


Q ss_pred             CCCEEEEECCCCCC---HHHHHHHHCCCCCE--------EEEEEEEEC
Q ss_conf             55389997088679---89999862046741--------589999977
Q gi|254780911|r   83 ATKTLILVSQPDHC---LNDLLYRWNIGTLA--------LNIVGVVSN  119 (288)
Q Consensus        83 ~~riailvSg~gsn---L~~Ll~~~~~g~L~--------~eI~~VISN  119 (288)
                      --++.+-.+|--+.   ...++.+-....++        ..|.+||..
T Consensus        95 ~akVSvVG~gm~~~~gvaarif~aL~~~~I~v~~istSe~~IS~vV~~  142 (167)
T 2dt9_A           95 IAKVSIVGVGLASTPEVPAKMFQAVASTGANIEMIATSEVRISVIIPA  142 (167)
T ss_dssp             EEEEEEEESSGGGSTHHHHHHHHHHHHTTCCCCEEEECSSEEEEEEEG
T ss_pred             CEEEEEECCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEH
T ss_conf             508988457714598837999999997899779998256889999819


No 74 
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum}
Probab=73.34  E-value=4.9  Score=19.58  Aligned_cols=26  Identities=4%  Similarity=0.029  Sum_probs=13.3

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHHH
Q ss_conf             9999973339409998276754887786
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHLC  177 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~~  177 (288)
                      ++.+..++.+  +++.-||++-..|.+.
T Consensus       125 ~l~~~a~~~g--~~~~vg~~~r~~p~~~  150 (383)
T 3oqb_A          125 EVVKLANSKG--VKHGTVQDKLFLPGLK  150 (383)
T ss_dssp             HHHHHHHHTT--CCEEECCGGGGSHHHH
T ss_pred             HHHHHHHCCC--CEEEEEEEECCCCCCC
T ss_conf             8654665059--6699997431466434


No 75 
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima}
Probab=73.25  E-value=4.9  Score=19.57  Aligned_cols=46  Identities=9%  Similarity=0.209  Sum_probs=21.0

Q ss_pred             HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHH
Q ss_conf             886099747416873--352776789999973339409998276754887786
Q gi|254780911|r  127 VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYMQILSDHLC  177 (288)
Q Consensus       127 A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgymril~~~~~  177 (288)
                      |-++|++.+.=  +.  .+.++. .++.+..++.++  .+..||++...|.+.
T Consensus        84 al~~gkhV~~E--KP~a~~~~e~-~~l~~~a~~~~~--~~~v~~~~r~~p~~~  131 (344)
T 3ezy_A           84 CAKAKKHVFCE--KPLSLNLADV-DRMIEETKKADV--ILFTGFNRRFDRNFK  131 (344)
T ss_dssp             HHHTTCEEEEE--SCSCSCHHHH-HHHHHHHHHHTC--CEEEECGGGGCHHHH
T ss_pred             HHHCCCCEEEE--CCCCCCHHHH-HHHHHHHHCCCC--EEEEEECCCCCHHHH
T ss_conf             99769968994--5721110367-777777643697--699983433789999


No 76 
>2fts_A Gephyrin; gephyrin, neuroreceptor anchoring, structural protein; 2.41A {Rattus norvegicus} SCOP: b.85.6.1 b.103.1.1 c.57.1.2 PDB: 2fu3_A 1t3e_A
Probab=73.17  E-value=2.8  Score=21.27  Aligned_cols=89  Identities=11%  Similarity=0.026  Sum_probs=58.4

Q ss_pred             CCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             24456553899970886798999986204674158999997734667778860997474168733527767899999733
Q gi|254780911|r   78 RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        78 ~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      -...+++|++|+.+|..=.  +    .....-+.+  ..=||..-+..+.+++|.......+-+++++...+.+.+.++ 
T Consensus       176 V~V~~~prV~iistGdElv--~----~~~~~~~g~--i~dsN~~~l~a~l~~~G~~~~~~~~v~Dd~~~l~~~l~~~~~-  246 (419)
T 2fts_A          176 VEVNKFPVVAVMSTGNELL--N----PEDDLLPGK--IRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGIS-  246 (419)
T ss_dssp             EEEECCCCEEEEEECTTEE--C----TTSCCCTTC--EECCHHHHHHHHHHTTTCCEEEEEEECSSHHHHHHHHHHHHH-
T ss_pred             CEEECCCEEEEEECCCCCC--C----CCCCCCCCC--EECCCHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHH-
T ss_conf             3797486799991585224--7----777778985--703635779999997799479844448998999999999986-


Q ss_pred             CCCEEEEECCCCCCCCHHH
Q ss_conf             3940999827675488778
Q gi|254780911|r  158 NNVELMILARYMQILSDHL  176 (288)
Q Consensus       158 ~~~DlivLAgymril~~~~  176 (288)
                       +.|+|+..|=.-.=..++
T Consensus       247 -~~DivIttGG~S~G~~D~  264 (419)
T 2fts_A          247 -RADVIITSGGVSMGEKDY  264 (419)
T ss_dssp             -HCSEEEEESCCSSSCCHH
T ss_pred             -HCCEEEECCCCCCCCCHH
T ss_conf             -337177206777883356


No 77 
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A*
Probab=73.03  E-value=2.6  Score=21.49  Aligned_cols=67  Identities=13%  Similarity=0.040  Sum_probs=31.7

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEEC-----CHHHHHHHHHCCCCEEECCCCC----CCHHH--------HHHHHHHHHHHCC
Q ss_conf             89999862046741589999977-----3466777886099747416873----35277--------6789999973339
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSN-----HTTHKKLVENYQLPFYYLPMTE----QNKIE--------SEQKLINIIEKNN  159 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN-----~~d~~~lA~~~gIP~~~i~~~~----~~k~~--------~e~~il~~l~~~~  159 (288)
                      +..+....+..+=   .+++++.     .+.+..+|++.|+|...-...+    .+...        ......+.++  +
T Consensus       204 ~~~~~~~L~~a~r---pvii~G~~~~~~~~~l~~lae~~~~Pv~~t~~~~~~~~~~~~~~~g~~g~~~~~~a~~~~~--~  278 (590)
T 1ybh_A          204 LEQIVRLISESKK---PVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPADDELSLHMLGMHGTVYANYAVE--H  278 (590)
T ss_dssp             HHHHHHHHHHCSS---EEEEECGGGTTCHHHHHHHHHHHCCCEEECTTTTTSSCTTSTTEEEECSTTSCHHHHHHHH--H
T ss_pred             HHHHHHHHHCCCC---CEEEECCCCCCHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH--C
T ss_conf             9999999971799---0999898544459999999998798999875357567886754566456767799986664--1


Q ss_pred             CEEEEECCC
Q ss_conf             409998276
Q gi|254780911|r  160 VELMILARY  168 (288)
Q Consensus       160 ~DlivLAgy  168 (288)
                      .|+|+..|.
T Consensus       279 aD~vl~lG~  287 (590)
T 1ybh_A          279 SDLLLAFGV  287 (590)
T ss_dssp             CSEEEEESC
T ss_pred             CCEEEEECC
T ss_conf             999999798


No 78 
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}
Probab=72.74  E-value=5  Score=19.49  Aligned_cols=157  Identities=16%  Similarity=0.245  Sum_probs=85.4

Q ss_pred             HHHCCCCCCEECCCCCCCCCEEEEE----CCCCCCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEE
Q ss_conf             8740023202012445655389997----08867989999862046741589999977--3466----777886099747
Q gi|254780911|r   66 PIVQQFSLQYSIRNTKEATKTLILV----SQPDHCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFY  135 (288)
Q Consensus        66 ~ia~~~~m~~~i~~~~~~~riailv----Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~  135 (288)
                      ++.+-++-+-.......++.+..||    ||.-++..-|-+.++...  -.+.+|-++  |+.|    +.+|+..++|++
T Consensus        82 eL~~llg~~~~~~~~~~~p~vi~~vG~~G~GKTTT~aKLA~~~~~~g--~kv~lva~Dt~R~aA~eQL~~~a~~~~v~v~  159 (443)
T 3dm5_A           82 ELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRG--YKVGVVCSDTWRPGAYHQLRQLLDRYHIEVF  159 (443)
T ss_dssp             HHHHHTTSSCCCCCCCSSSEEEEEECCTTSSHHHHHHHHHHHHHTTT--CCEEEEECCCSSTHHHHHHHHHHGGGTCEEE
T ss_pred             HHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCC--CCEEEEECCCCCHHHHHHHHHHHHCCCCCEE
T ss_conf             99987354322233478982899966788972327999999999769--9424653145576699999998512456500


Q ss_pred             ECCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCCCCCCCHHHHHHCC--CCEEEECCCC--CCCCCCCCHHHHH--HHC
Q ss_conf             41687335277678999997333940999--82767548877863277--8479613366--7678999958999--742
Q gi|254780911|r  136 YLPMTEQNKIESEQKLINIIEKNNVELMI--LARYMQILSDHLCHKMT--GRIINIHHSF--LPSFKGANPYKQA--YEY  207 (288)
Q Consensus       136 ~i~~~~~~k~~~e~~il~~l~~~~~Dliv--LAgymril~~~~~~~~~--~~iiNiHpsl--LP~f~G~~~y~~A--~~~  207 (288)
                      -.+.. .+..+--.+-++..+..+.|+|+  .||-++. ..+..+...  .++++-|-.|  |++--|.+.+.||  +..
T Consensus       160 ~~~~~-~dp~~i~~~a~~~a~~~~~D~viIDTAGR~~~-d~~lm~EL~~i~~~~~p~e~lLVlda~~gq~a~~~a~~f~~  237 (443)
T 3dm5_A          160 GNPQE-KDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKE-DKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKE  237 (443)
T ss_dssp             CCTTC-CCHHHHHHHHHHHHHHTTCSEEEEECCCCSSC-CHHHHHHHHHHHHHHCCSEEEEEEEGGGGGGHHHHHHHHHH
T ss_pred             CCCCC-CCHHHHHHHHHHHHHHCCCCEEEEECCCCCHH-HHHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             67643-36678999999999866999899878875365-89999999975214698247874114346678999998553


Q ss_pred             CCCEEEEEEEEEECCCCCC
Q ss_conf             6837622577530556888
Q gi|254780911|r  208 GVKIIGATAHYAICELDAG  226 (288)
Q Consensus       208 Gvk~~G~TvH~V~~~lD~G  226 (288)
                      .+.++|+-.--.|+.--.|
T Consensus       238 ~~~i~giIlTKlD~~akgG  256 (443)
T 3dm5_A          238 ATPIGSIIVTKLDGSAKGG  256 (443)
T ss_dssp             SCTTEEEEEECCSSCSSHH
T ss_pred             HCCCCCEEEECCCCCCCCH
T ss_conf             1588835773356787634


No 79 
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A
Probab=72.71  E-value=5  Score=19.48  Aligned_cols=15  Identities=0%  Similarity=0.388  Sum_probs=7.0

Q ss_pred             HHHHHCCCEEEEECC
Q ss_conf             997333940999827
Q gi|254780911|r  153 NIIEKNNVELMILAR  167 (288)
Q Consensus       153 ~~l~~~~~DlivLAg  167 (288)
                      +.+.+.+||+|+..|
T Consensus        89 ~~~~~~kpD~vlv~G  103 (375)
T 3beo_A           89 KVMKEAKPDIVLVHG  103 (375)
T ss_dssp             HHHHHHCCSEEEEET
T ss_pred             HHHHHCCCCEEEEEC
T ss_conf             999747998899946


No 80 
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A*
Probab=71.70  E-value=5.3  Score=19.33  Aligned_cols=85  Identities=15%  Similarity=0.088  Sum_probs=49.1

Q ss_pred             CCCCCCEEEEECCCCCCHHH--------------------HHHHHCCCCCEEEEEEEEECCHH-HHHHHHHCCCCEEECC
Q ss_conf             45655389997088679899--------------------99862046741589999977346-6777886099747416
Q gi|254780911|r   80 TKEATKTLILVSQPDHCLND--------------------LLYRWNIGTLALNIVGVVSNHTT-HKKLVENYQLPFYYLP  138 (288)
Q Consensus        80 ~~~~~riailvSg~gsnL~~--------------------Ll~~~~~g~L~~eI~~VISN~~d-~~~lA~~~gIP~~~i~  138 (288)
                      ...++|.+|||.|.|+=|..                    ++++...-.+. +|.+|++.+.+ ...+.+++++.+.+.+
T Consensus        22 ~~~~mkaiIlAaG~GtRl~~~t~~~PK~Ll~I~gkplI~~~i~~l~~~gi~-~Iiiv~g~~~e~i~~~~~~~~i~i~~~~  100 (254)
T 1jyk_A           22 KEIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGIN-DIIIIVGYLKEQFDYLKEKYGVRLVFND  100 (254)
T ss_dssp             -CCCCEEEEEECSCCGGGTTTTSSSCGGGCEETTEEHHHHHHHHHHHTTCC-CEEEEECTTGGGGTHHHHHHCCEEEECT
T ss_pred             CCCCCCEEEECCCCCCCCCCCCCCCCEEEEEECCEEHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             137867899898476778831069870120899848899999999986998-8999326432222222233676322222


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             87335277678999997333940999827
Q gi|254780911|r  139 MTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       139 ~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      -... .... ..+.......+-++||+++
T Consensus       101 ~~~~-~gt~-~sl~~a~~~~~~~~ii~~d  127 (254)
T 1jyk_A          101 KYAD-YNNF-YSLYLVKEELANSYVIDAD  127 (254)
T ss_dssp             TTTT-SCTH-HHHHTTGGGCTTEEEEETT
T ss_pred             CCCC-CCCC-CCCCCHHHHHHCCCCCCCC
T ss_conf             2112-3333-3322104444102244453


No 81 
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone, THDP, metal, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A*
Probab=69.30  E-value=2.8  Score=21.30  Aligned_cols=46  Identities=4%  Similarity=0.002  Sum_probs=24.8

Q ss_pred             HHHHHHHHCCCCEEECCCCCC-----CHHH--HHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             667778860997474168733-----5277--67899999733394099982767
Q gi|254780911|r  122 THKKLVENYQLPFYYLPMTEQ-----NKIE--SEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus       122 d~~~lA~~~gIP~~~i~~~~~-----~k~~--~e~~il~~l~~~~~DlivLAgym  169 (288)
                      ....+|+..++|...-...+.     ...-  ......+.+.  +.|+++..|.+
T Consensus       236 ~~~~lae~~~~pv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~D~vl~lG~~  288 (556)
T 3hww_A          236 KVALWAQTLGWPLIGDVLSQTGQPLPCADLWLGNAKATSELQ--QAQIVVQLGSS  288 (556)
T ss_dssp             HHHHHHHHHTCCEEECTTTCSCCSSCCHHHHTTSHHHHHHHT--TCSEEEEESBC
T ss_pred             HHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCCHHHHHHCC--CCEEEECCCCC
T ss_conf             999877763487200136777677665421004477887403--42056315766


No 82 
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*
Probab=69.09  E-value=6  Score=18.95  Aligned_cols=106  Identities=17%  Similarity=0.152  Sum_probs=53.1

Q ss_pred             HHHHHHCCCCEEEEC--CCCCCCCCCCCHH---HHHHHCCCC-------EEEEEEEEEECCCCCCCEEEEEEEECCCCCC
Q ss_conf             778632778479613--3667678999958---999742683-------7622577530556888344444665188889
Q gi|254780911|r  174 DHLCHKMTGRIINIH--HSFLPSFKGANPY---KQAYEYGVK-------IIGATAHYAICELDAGPIIEQDVVRVTHAQT  241 (288)
Q Consensus       174 ~~~~~~~~~~iiNiH--pslLP~f~G~~~y---~~A~~~Gvk-------~~G~TvH~V~~~lD~GpII~Q~~~~v~~~dt  241 (288)
                      |.+.++-.++|||+-  .++.|..+...+|   +.|+..=+|       -.|.+|.-|.+++=..|++.+..     ...
T Consensus       138 ~~m~~~~~g~IV~isS~~~~~~~~~~~~~Y~asKaal~~ltr~lA~el~~~gIrVN~I~PG~i~T~~~~~~~-----~~~  212 (278)
T 2bgk_A          138 RVMIPAKKGSIVFTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVF-----GVD  212 (278)
T ss_dssp             HHHGGGTCEEEEEECCGGGTCCCTTSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEESCCSCCCCTTSS-----SCC
T ss_pred             HHHHHCCCCEEEEEEEHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCHHHHHHC-----CCC
T ss_conf             999864897399997653346899951899999999999999999986254909999961989874665430-----278


Q ss_pred             HHHHHHHHHH--------HHHHHHHHHHHHHHCC--------EEEEECCEEEECCCCCC
Q ss_conf             9999999999--------9999999999998769--------17886885798088867
Q gi|254780911|r  242 IEDYIAIGKN--------IEAKVLTKAVNAHIQQ--------RVFINKRKTIVFPAYPN  284 (288)
Q Consensus       242 ~~~l~~~~~~--------~E~~~l~~av~~~~e~--------rv~~~~~ktvvf~~~~~  284 (288)
                      .+...+....        .+..=.+.++-+.+.+        -+.++|+-|..-|+.|-
T Consensus       213 ~~~~~~~~~~~~~~~gR~~~pediA~~v~fL~Sd~s~~itG~~i~VDGG~t~~~p~~p~  271 (278)
T 2bgk_A          213 SSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTNPAFPT  271 (278)
T ss_dssp             HHHHHHHHHHTCSSCSCCCCHHHHHHHHHHHHSGGGTTCCSCEEEESTTGGGCCTHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCCCCCCCH
T ss_conf             78999999743465789819999999999996714359668668869381168899966


No 83 
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri}
Probab=69.08  E-value=6  Score=18.95  Aligned_cols=72  Identities=17%  Similarity=0.204  Sum_probs=40.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             56553899970886798999986204674158999997734667778860997474168733527767899999733394
Q gi|254780911|r   81 KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNV  160 (288)
Q Consensus        81 ~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~  160 (288)
                      ..|+|++|..+|..  -..++.+.+.. -..++++.|++.+...+ ..-+|+|-+.  .         ..+.++++++++
T Consensus         2 n~k~rvlI~Gag~~--g~~l~~~l~~~-~~y~vvgfiD~d~~~~g-~~i~gi~V~~--~---------~~l~~~i~~~~i   66 (141)
T 3nkl_A            2 NAKKKVLIYGAGSA--GLQLANMLRQG-KEFHPIAFIDDDRKKHK-TTMQGITIYR--P---------KYLERLIKKHCI   66 (141)
T ss_dssp             -CCEEEEEECCSHH--HHHHHHHHHHS-SSEEEEEEECSCGGGTT-CEETTEEEEC--G---------GGHHHHHHHHTC
T ss_pred             CCCCEEEEECCCHH--HHHHHHHHHHC-CCCEEEEEEECCCCCCE-EEECCCCCCC--H---------HHHHHHHHHCCC
T ss_conf             98777999877989--99999999878-99669999957864141-4867820366--8---------787788864686


Q ss_pred             EEEEECC
Q ss_conf             0999827
Q gi|254780911|r  161 ELMILAR  167 (288)
Q Consensus       161 DlivLAg  167 (288)
                      |-|++|-
T Consensus        67 ~~viia~   73 (141)
T 3nkl_A           67 STVLLAV   73 (141)
T ss_dssp             CEEEECC
T ss_pred             CEEEEEC
T ss_conf             3899945


No 84 
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A*
Probab=69.07  E-value=6  Score=18.95  Aligned_cols=68  Identities=12%  Similarity=0.127  Sum_probs=32.4

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEEC-------CHHHHHHHHHCCCCEEECCCCCC----C-HHHHHHHHHHHHHHCCCEEEE
Q ss_conf             89999862046741589999977-------34667778860997474168733----5-277678999997333940999
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSN-------HTTHKKLVENYQLPFYYLPMTEQ----N-KIESEQKLINIIEKNNVELMI  164 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN-------~~d~~~lA~~~gIP~~~i~~~~~----~-k~~~e~~il~~l~~~~~Dliv  164 (288)
                      +..+....+..+-|+   ++++-       .+.+..||+..|+|+..-...+.    + ..-........+  ...|+++
T Consensus       203 v~~~~~~l~~akrPv---ii~G~~~~~~~a~~~l~~lae~~g~pv~tt~~~k~~~~~~~~~~~~~~~~~~~--~~aD~vl  277 (568)
T 2c31_A          203 IARAADLIKNAKRPV---IMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFAL--AQCDVCV  277 (568)
T ss_dssp             HHHHHHHHHTCSSEE---EEECHHHHHHTCHHHHHHHHHHHTCCEEECGGGTTSSCTTCTTBCGGGHHHHH--HHCSEEE
T ss_pred             HHHHHHHHHCCCCCE---EEECCCCCHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCHHHHCCCC--CCCCEEE
T ss_conf             999999997179948---99888722101799999999972998663021245677668642101211445--5676887


Q ss_pred             ECCCC
Q ss_conf             82767
Q gi|254780911|r  165 LARYM  169 (288)
Q Consensus       165 LAgym  169 (288)
                      ..|-.
T Consensus       278 ~vG~~  282 (568)
T 2c31_A          278 LIGAR  282 (568)
T ss_dssp             EESCC
T ss_pred             ECCCC
T ss_conf             51677


No 85 
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A*
Probab=68.93  E-value=3.3  Score=20.75  Aligned_cols=44  Identities=18%  Similarity=0.130  Sum_probs=22.4

Q ss_pred             HHHHHHHCCCCEEECCCCC----C-CHH-------HHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             6777886099747416873----3-527-------76789999973339409998276
Q gi|254780911|r  123 HKKLVENYQLPFYYLPMTE----Q-NKI-------ESEQKLINIIEKNNVELMILARY  168 (288)
Q Consensus       123 ~~~lA~~~gIP~~~i~~~~----~-~k~-------~~e~~il~~l~~~~~DlivLAgy  168 (288)
                      +..||+..++|...-...+    . ...       .........+.  +.|+|+..|-
T Consensus       310 l~~lae~l~~PV~~t~~~~g~~~~~~p~~~g~~G~~~~~~a~~~~~--~aDlvl~lG~  365 (677)
T 1t9b_A          310 LKELSDRAQIPVTTTLQGLGSFDQEDPKSLDMLGMHGCATANLAVQ--NADLIIAVGA  365 (677)
T ss_dssp             HHHHHHHTTCCEEECGGGTTSSCTTSTTEEEECSTTSCHHHHHHHH--HCSEEEEESC
T ss_pred             HHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHC--CCCEEEEECC
T ss_conf             9999887398789763347766888820035446667789998651--6998999799


No 86 
>1zhv_A Hypothetical protein ATU0741; NESG, ATR8, structural genomics, PSI, protein structure initiative; 1.50A {Agrobacterium tumefaciens str} SCOP: d.58.18.8 d.58.18.8
Probab=67.87  E-value=4.7  Score=19.73  Aligned_cols=26  Identities=31%  Similarity=0.376  Sum_probs=12.2

Q ss_pred             CCCCHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             98766888999998579818973444
Q gi|254780911|r   12 SNEEITSIIPDYLSTQGCNILDISQF   37 (288)
Q Consensus        12 D~~GIVA~VT~~La~~g~NI~~~~Q~   37 (288)
                      |..||+|++++-|++.|.-|.-++-|
T Consensus        74 ~~vGila~is~~LA~agIsif~iSty   99 (134)
T 1zhv_A           74 DETGIVLSVISPLSTNGIGIFVVSTF   99 (134)
T ss_dssp             SSCCHHHHHHHHHHTTTCCCEEEECS
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             05656999989998779965998754


No 87 
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A
Probab=67.73  E-value=6.4  Score=18.76  Aligned_cols=37  Identities=14%  Similarity=0.121  Sum_probs=22.2

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHHHHH-------CCCCEEEEC
Q ss_conf             999997333940999827675488778632-------778479613
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHLCHK-------MTGRIINIH  188 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~~~~-------~~~~iiNiH  188 (288)
                      +|.++.++.+.  ++..+|++-..|.+...       .=|++..++
T Consensus       137 ~l~~~a~~~~~--~~~v~~~~r~~p~~~~~k~li~~G~iG~i~~~~  180 (438)
T 3btv_A          137 SIYKAAAERGV--QTIISLQGRKSPYILRAKELISQGYIGDINSIE  180 (438)
T ss_dssp             HHHHHHHTTTC--EEEEECGGGGCHHHHHHHHHHHTTTTCSEEEEE
T ss_pred             HHHHHHHHCCC--EEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             99998761398--677734202574899988898659738769999


No 88 
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A
Probab=67.41  E-value=6.5  Score=18.72  Aligned_cols=206  Identities=15%  Similarity=0.142  Sum_probs=98.2

Q ss_pred             HHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCH-HHHHHH-HHHHHCCCCCCE-ECCCCCCCCCEEEEE----C
Q ss_conf             899999857981897344432436889999999728852-777988-898740023202-012445655389997----0
Q gi|254780911|r   19 IIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-KLFIAD-FQPIVQQFSLQY-SIRNTKEATKTLILV----S   91 (288)
Q Consensus        19 ~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~-~~l~~~-f~~ia~~~~m~~-~i~~~~~~~riailv----S   91 (288)
                      .|...|-+.+.|..-+.++.+.-.....- -+.....+. +.+... ++++.+-++-.. .+.....++++..||    |
T Consensus        34 eIr~aLLeADV~~~vv~~~~~~ik~~~~~-~~v~~~~~~~~~i~kiv~~eL~~llg~~~~~~~~~~~~p~Vi~lvG~~Gv  112 (504)
T 2j37_W           34 EVCTALLEADVNIKLVKQLRENVKSAIDL-EEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGS  112 (504)
T ss_dssp             HHHHHHCCTTTSSSTTHHHHHHHHHHHTT-CCCCSSSCHHHHHHHHHHHHHHHHHCCCCCCCCCCSS--EEEEEECSTTS
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCC
T ss_conf             99999996678899999999999999712-53667799899999999999999848665434435689759999668788


Q ss_pred             CCCCCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEE-
Q ss_conf             8867989999862046741589999977--3466----77788609974741687335277678999997333940999-
Q gi|254780911|r   92 QPDHCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMI-  164 (288)
Q Consensus        92 g~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dliv-  164 (288)
                      |..+...-|-..++...  -.+.+|-++  |+.|    +.+|+..++|++... ...+....-.+-++..+..+.|+|+ 
T Consensus       113 GKTTT~aKLA~~~~~~g--~kv~Lva~Dt~R~aAveQLk~~a~~~~vp~~~~~-~~~dp~~i~~~~~~~ak~~~~DvIiI  189 (504)
T 2j37_W          113 GKTTTCSKLAYYYQRKG--WKTCLICADTFRAGAFDQLKQNATKARIPFYGSY-TEMDPVIIASEGVEKFKNENFEIIIV  189 (504)
T ss_dssp             SHHHHHHHHHHHHHHTT--CCEEEEEECCSSSHHHHHHHHHHHHHTCCEEECC-CCSCHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             CCCCCHHHHHHHHHHHH--CCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC-CCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             86550899999998600--2020000123677799999998730477655754-43476889999999998669988995


Q ss_pred             -ECCCCCCCCHHHHHHCC--CCEEEECCCC--CCCCCCCCHHHHH--HHCCCCEEEEEEEEEECCCCCCCEE
Q ss_conf             -82767548877863277--8479613366--7678999958999--7426837622577530556888344
Q gi|254780911|r  165 -LARYMQILSDHLCHKMT--GRIINIHHSF--LPSFKGANPYKQA--YEYGVKIIGATAHYAICELDAGPII  229 (288)
Q Consensus       165 -LAgymril~~~~~~~~~--~~iiNiHpsl--LP~f~G~~~y~~A--~~~Gvk~~G~TvH~V~~~lD~GpII  229 (288)
                       .||-+++=..- .+...  .+.++-|--+  +.+--|-....+|  |...+.++|+-.--+|+.--.|.++
T Consensus       190 DTAGR~~~d~~l-m~El~~i~~~~~P~e~llVlda~~Gq~a~~~a~~F~~~v~i~gvIlTKlDg~argG~aL  260 (504)
T 2j37_W          190 DTSGRHKQEDSL-FEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGAL  260 (504)
T ss_dssp             EECCCCTTCHHH-HHHHHHHHHHHCCSEEEEEEETTCCTTHHHHHHHHHHHHCCCCEEEECTTSCCCCTHHH
T ss_pred             CCCCCCHHHHHH-HHHHHHHHHCCCCCEEEEECCHHHCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHH
T ss_conf             586765317999-99999876015863135521002023489999998754266605775113677614674


No 89 
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A*
Probab=67.30  E-value=2.5  Score=21.62  Aligned_cols=93  Identities=13%  Similarity=0.165  Sum_probs=44.6

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEE---C-CHHHHHHHHHCCCCEEECCCCCC-CHHH-----------H-----HHHHHHH
Q ss_conf             98999986204674158999997---7-34667778860997474168733-5277-----------6-----7899999
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVS---N-HTTHKKLVENYQLPFYYLPMTEQ-NKIE-----------S-----EQKLINI  154 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VIS---N-~~d~~~lA~~~gIP~~~i~~~~~-~k~~-----------~-----e~~il~~  154 (288)
                      .+..+.......+-+.-++..-.   + .+.+..+|++.|+|...-+..+. ..+.           .     .....++
T Consensus       205 ~~~~~~~~l~~akrpvii~g~g~~~~~~~~~l~~lae~l~~Pv~~t~~~~~~~~~~hp~~~G~~~~~~~~~~~~~~~~~~  284 (573)
T 2iht_A          205 AADQAAALLAEAKHPVLVVGAAAIRSGAVPAIRALAERLNIPVITTYIAKGVLPVGHELNYGAVTGYMDGILNFPALQTM  284 (573)
T ss_dssp             HHHHHHHHHHHCSSEEEEECHHHHHTTCHHHHHHHHHHHTCCEEECSTTTTSSCTTCTTEEEECCTTHHHHHTSCHHHHH
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHH
T ss_conf             99999999985689879746874661158999999998798999853667888988642214300013466444789975


Q ss_pred             HHHCCCEEEEECCCC--CCCCHHHHHHCC-CCEEEECCC
Q ss_conf             733394099982767--548877863277-847961336
Q gi|254780911|r  155 IEKNNVELMILARYM--QILSDHLCHKMT-GRIINIHHS  190 (288)
Q Consensus       155 l~~~~~DlivLAgym--ril~~~~~~~~~-~~iiNiHps  190 (288)
                      +.  +.|+|+..|..  ..+++.+....+ .+++.+++.
T Consensus       285 ~~--~~D~il~~G~~~~~~~~~~~~~~~~~~~~~~~~~~  321 (573)
T 2iht_A          285 FA--PVDLVLTVGYDYAEDLRPSMWQKGIEKKTVRISPT  321 (573)
T ss_dssp             HT--TCCEEEEETCCGGGCCCHHHHCCSSCCEEEEEESS
T ss_pred             HC--CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             13--56779995776422355533344532000125530


No 90 
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis}
Probab=66.98  E-value=6.6  Score=18.66  Aligned_cols=156  Identities=12%  Similarity=0.075  Sum_probs=77.5

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCC-HHHHHHHHHHHHCCCCCCEE---CCCCCCC
Q ss_conf             9859987668889999985798189734443243688999999972885-27779888987400232020---1244565
Q gi|254780911|r    8 ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-MKLFIADFQPIVQQFSLQYS---IRNTKEA   83 (288)
Q Consensus         8 i~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~-~~~l~~~f~~ia~~~~m~~~---i~~~~~~   83 (288)
                      ...+|++|+.+++.+.+++++.||.-+.|-.......   .+.|....+ .+..+.-.+++..++.....   +......
T Consensus       276 ~~m~~~~G~~a~if~~l~~~~IsVd~i~qs~s~~~~~---~is~~v~~~~~~~ae~i~~~l~~~l~~~~~~~~~~~V~v~  352 (600)
T 3l76_A          276 LRVPDRPGVASKLFRDIAQQQVDIDLIIQSIHDGNSN---DIAFTVVKDLLNTAEAVTSAIAPALRSYPEADQEAEIIVE  352 (600)
T ss_dssp             EEEECSTTHHHHHHHHHHHTTCCCCCEEBCCCBTTEE---EEEEEECGGGHHHHHHHHHHHGGGGSSSTTCSSSSEEEEE
T ss_pred             ECCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCC---CEEEEEEHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             5589987507888677886283089999623678866---5899987557678999999999999876631567608997


Q ss_pred             CCEE---EEECCCCCC---HHHHHHHHCCCCC--------EEEEEEEEECCHHH---HHHHHHCCCCEEEC---------
Q ss_conf             5389---997088679---8999986204674--------15899999773466---77788609974741---------
Q gi|254780911|r   84 TKTL---ILVSQPDHC---LNDLLYRWNIGTL--------ALNIVGVVSNHTTH---KKLVENYQLPFYYL---------  137 (288)
Q Consensus        84 ~ria---ilvSg~gsn---L~~Ll~~~~~g~L--------~~eI~~VISN~~d~---~~lA~~~gIP~~~i---------  137 (288)
                      ..++   +-.+|-..+   +..++.+..+-.+        ..+|.+||....-.   +.|-+.|++..--.         
T Consensus       353 ~~vAiVSvVG~gm~~~~Giaakif~aL~~~~InI~~~gsSe~nIS~VV~~~d~~~Av~aLH~~F~l~~~~~~~~~~~~~~  432 (600)
T 3l76_A          353 KGIAKIAIAGAGMIGRPGIAAKMFKTLADVGVNIEMISTSEVKVSCVIDQRDADRAIAALSNAFGVTLSPPKNQTDTSHL  432 (600)
T ss_dssp             CSEEEEEEECGGGTTCTTHHHHHHHHHHHTTCCCCEEEECSSEEEEEEEGGGHHHHHHHHHHHTTCCBCCCCCCCC---C
T ss_pred             CCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEECCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             78779999767624580289999999985898389998678879999818999999999999839788876676666789


Q ss_pred             ---------------CCCC-CCHHHHHHHHHHHHHHCC--CEEEEEC
Q ss_conf             ---------------6873-352776789999973339--4099982
Q gi|254780911|r  138 ---------------PMTE-QNKIESEQKLINIIEKNN--VELMILA  166 (288)
Q Consensus       138 ---------------~~~~-~~k~~~e~~il~~l~~~~--~DlivLA  166 (288)
                                     .... .++..+-.++...|.+.+  +|+|.-+
T Consensus       433 ~~V~gva~~~~~~~vt~~~~~~~~g~~a~iF~~La~~~InVdmI~qs  479 (600)
T 3l76_A          433 PAVRGVALDQDQAQIAIRHVPDRPGMAAQLFTALAEANISVDMIIQS  479 (600)
T ss_dssp             CSCCEEEEECSEEEEEEEEEESSTTHHHHHHHHHHHTTCCCCEEEEE
T ss_pred             CCEEEEEECCCEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             84657882377269996388998417999999999769807999907


No 91 
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae}
Probab=66.24  E-value=6.8  Score=18.57  Aligned_cols=38  Identities=16%  Similarity=0.121  Sum_probs=18.8

Q ss_pred             CCCCCCCEEEEECCCCCC---HHHHHHHHCCCCCEEEEEEE
Q ss_conf             445655389997088679---89999862046741589999
Q gi|254780911|r   79 NTKEATKTLILVSQPDHC---LNDLLYRWNIGTLALNIVGV  116 (288)
Q Consensus        79 ~~~~~~riailvSg~gsn---L~~Ll~~~~~g~L~~eI~~V  116 (288)
                      +..+++|+.++|+++.|.   ...+-...+...++++|..+
T Consensus         2 ~~~k~~kIlL~C~~GmSSsll~~km~~~a~~~~~~~~v~A~   42 (108)
T 3nbm_A            2 NASKELKVLVLCAGSGTSAQLANAINEGANLTEVRVIANSG   42 (108)
T ss_dssp             ---CCEEEEEEESSSSHHHHHHHHHHHHHHHHTCSEEEEEE
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             97763469999799975999999999999976997899995


No 92 
>1wu2_A MOEA protein, molybdopterin biosynthesis MOEA protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.30A {Pyrococcus horikoshii} SCOP: b.85.6.1 b.103.1.1 c.57.1.2 PDB: 1xi8_A
Probab=65.92  E-value=4.3  Score=19.98  Aligned_cols=79  Identities=13%  Similarity=0.112  Sum_probs=52.9

Q ss_pred             CCCCCCCEEEEECCCCCC---HHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             445655389997088679---89999862046741589999977346677788609974741687335277678999997
Q gi|254780911|r   79 NTKEATKTLILVSQPDHC---LNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINII  155 (288)
Q Consensus        79 ~~~~~~riailvSg~gsn---L~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l  155 (288)
                      ...+++|++|+.+|..=.   -..-+   +.|.      ..=||..-+..+.+++|+......+-+++.+...+.+.+.+
T Consensus       178 ~V~~~prV~iisTGdELv~~~~~~~~---~~g~------I~dsN~~~l~a~l~~~g~~~~~~~~~~Dd~~~i~~~l~~~~  248 (396)
T 1wu2_A          178 PVKVKPKVGIIITGSELIEEPSEEGF---KEGK------IVETNSIMLQGLVEKFFGEPILYGVLPDDESIIKETLEKAK  248 (396)
T ss_dssp             EEECCCEEEEEEECTTEESSCCHHHH---HTTC------EECCHHHHHHHHHHHTTCEEEEEEEECSCHHHHTTHHHHHH
T ss_pred             EEECCCEEEEEEECCCCCCCCCCCCC---CCCC------EECCCHHHHHHHHHHCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99649879999607621246766788---8881------73387898899999779987572233798999999999987


Q ss_pred             HHCCCEEEEECCC
Q ss_conf             3339409998276
Q gi|254780911|r  156 EKNNVELMILARY  168 (288)
Q Consensus       156 ~~~~~DlivLAgy  168 (288)
                      .  +.|+|+..|=
T Consensus       249 ~--~~DiiittGG  259 (396)
T 1wu2_A          249 N--ECDIVLITGG  259 (396)
T ss_dssp             H--CSEEEECC--
T ss_pred             H--CCCEEEECCC
T ss_conf             4--2767873178


No 93 
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A*
Probab=64.14  E-value=4.8  Score=19.67  Aligned_cols=28  Identities=18%  Similarity=0.446  Sum_probs=12.6

Q ss_pred             EEEEEEEEECCHHH---HHHHHHCCCCEEEC
Q ss_conf             15899999773466---77788609974741
Q gi|254780911|r  110 ALNIVGVVSNHTTH---KKLVENYQLPFYYL  137 (288)
Q Consensus       110 ~~eI~~VISN~~d~---~~lA~~~gIP~~~i  137 (288)
                      +++..++-+|-..+   ..+.+.+.+|..++
T Consensus        62 ~~~~IviaCNTa~a~~~~~l~~~~~ipvi~i   92 (254)
T 1b73_A           62 GVDIIVVACNTASAYALERLKKEINVPVFGV   92 (254)
T ss_dssp             TCSEEEECCHHHHTTSHHHHHHHSSSCEEES
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEC
T ss_conf             9999999378578999999998637987605


No 94 
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, enzyme, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli}
Probab=63.22  E-value=4.8  Score=19.62  Aligned_cols=45  Identities=7%  Similarity=-0.031  Sum_probs=23.0

Q ss_pred             HHHHHHHHCCCCEEECCCCC----CCH---------HHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             66777886099747416873----352---------776789999973339409998276
Q gi|254780911|r  122 THKKLVENYQLPFYYLPMTE----QNK---------IESEQKLINIIEKNNVELMILARY  168 (288)
Q Consensus       122 d~~~lA~~~gIP~~~i~~~~----~~k---------~~~e~~il~~l~~~~~DlivLAgy  168 (288)
                      .+..||+..++|...-...+    ++.         ..........+.  +.|+|+..|-
T Consensus       245 ~l~~lae~~~~Pv~tt~~~~g~~~~~~~~~~g~~g~~~~~~~~~~~~~--~aDlvl~lG~  302 (616)
T 2pan_A          245 LLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLL--ASDMVFGIGN  302 (616)
T ss_dssp             HHHHHHHHHTCCEEECTTTTTSSCTTSTTBCCCCSSSSCCHHHHHHHH--HCSEEEEESC
T ss_pred             HHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCC--CCCEEEEECC
T ss_conf             999999987989895245577546887333575567665334554312--5627987355


No 95 
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3iie_A
Probab=63.17  E-value=7.7  Score=18.18  Aligned_cols=128  Identities=14%  Similarity=0.157  Sum_probs=66.6

Q ss_pred             CCCCCEEEEECCCC--CCHHHHHHHHCCCCCEEEEEEEEEC--CHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHH
Q ss_conf             56553899970886--7989999862046741589999977--3466777886099747416873352776789999973
Q gi|254780911|r   81 KEATKTLILVSQPD--HCLNDLLYRWNIGTLALNIVGVVSN--HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIE  156 (288)
Q Consensus        81 ~~~~riailvSg~g--snL~~Ll~~~~~g~L~~eI~~VISN--~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~  156 (288)
                      +--+|++||.|.+.  .+--+++.+..+   ..+|.++.+|  .+.+...+.++...+.++.-..     ....+.+.+.
T Consensus         7 ~~MK~I~ILGSTGSIG~qtL~Vi~~~~~---~f~v~~Lsa~~N~~~L~~q~~ef~pk~v~i~d~~-----~~~~lk~~l~   78 (406)
T 1q0q_A            7 SGMKQLTILGSTGSIGCSTLDVVRHNPE---HFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA-----SAKLLKTMLQ   78 (406)
T ss_dssp             --CEEEEEETTTSHHHHHHHHHHHHCTT---TEEEEEEEESSCHHHHHHHHHHHCCSEEEESSHH-----HHHHHHHHHH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCC---CCEEEEEEECCCHHHHHHHHHHHCCCEEEEECHH-----HHHHHHHHHH
T ss_conf             8985899975586999999999983948---7489999959879999999998199999993889-----9999999877


Q ss_pred             HCCCEEEEECCCCCCCCHHHH-HH---CC-CCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEEEEEECC--CCCCCEE
Q ss_conf             339409998276754887786-32---77-84796133667678999958999742683762257753055--6888344
Q gi|254780911|r  157 KNNVELMILARYMQILSDHLC-HK---MT-GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE--LDAGPII  229 (288)
Q Consensus       157 ~~~~DlivLAgymril~~~~~-~~---~~-~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~TvH~V~~~--lD~GpII  229 (288)
                      ..+.+.-++.|      .+-+ +-   .. .-+||-    +..|-|..|--.|+.+|-++.     +.|-|  +=+|++|
T Consensus        79 ~~~~~~~i~~G------~~~l~~~~~~~~~D~vi~a----isG~aGL~pt~~ai~~gk~ia-----lANKEslV~aG~li  143 (406)
T 1q0q_A           79 QQGSRTEVLSG------QQAACDMAALEDVDQVMAA----IVGAAGLLPTLAAIRAGKTIL-----LANKESLVTCGRLF  143 (406)
T ss_dssp             HTTCCCEEEES------HHHHHHHHTCTTCCEEEEC----CSSGGGHHHHHHHHHTTCEEE-----ECCHHHHHHHTHHH
T ss_pred             HCCCCCEEEEC------CHHHHHHHCCCCCCEEEEE----CCCCHHHHHHHHHHHCCCCEE-----EECCCCEEECCHHH
T ss_conf             44899489867------3478887356778899994----257300899999997699179-----95153167557878


Q ss_pred             EE
Q ss_conf             44
Q gi|254780911|r  230 EQ  231 (288)
Q Consensus       230 ~Q  231 (288)
                      .+
T Consensus       144 ~~  145 (406)
T 1q0q_A          144 MD  145 (406)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             87


No 96 
>1xw8_A UPF0271 protein YBGL; NESG, northeast structural genomics consortium, structural genomics, protein structure initiative, PSI, X-RAY; 2.00A {Escherichia coli} SCOP: c.6.2.5
Probab=62.65  E-value=7.4  Score=18.32  Aligned_cols=125  Identities=8%  Similarity=0.012  Sum_probs=61.3

Q ss_pred             CHHHHHHHHHHHHCCCCCCEECCCCCCCC----CEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCC
Q ss_conf             52777988898740023202012445655----38999708867989999862046741589999977346677788609
Q gi|254780911|r   56 CMKLFIADFQPIVQQFSLQYSIRNTKEAT----KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQ  131 (288)
Q Consensus        56 ~~~~l~~~f~~ia~~~~m~~~i~~~~~~~----riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~g  131 (288)
                      +.+.+... -.+|++.+..+.-++..+-+    |..+-.|.  .-|.+++ .++-              ..+..+|+.+|
T Consensus        36 D~~~m~~t-v~lA~~~~V~IGAHPsypD~~gFGRr~~~~s~--~el~~~i-~~Qi--------------~al~~~a~~~g   97 (252)
T 1xw8_A           36 DAQIMQAC-VREAIKNGVAIGAHPSFPDRENFGRSAMQLPP--ETVYAQT-LYQI--------------GALATIARAQG   97 (252)
T ss_dssp             CHHHHHHH-HHHHHHHTCEEEEECCCC-------CCCCCCH--HHHHHHH-HHHH--------------HHHHHHHHHTT
T ss_pred             CHHHHHHH-HHHHHHCCCEEECCCCCCCCCCCCCCCCCCCH--HHHHHHH-HHHH--------------HHHHHHHHHCC
T ss_conf             79999999-99999849878058999976789988788999--9999999-9999--------------99999999849


Q ss_pred             CCEEECC-CCC-CC----HHHHHHHHHHHHHHCCCEEEEECCCCCCCCH--------HHHHHCCCCEEEECCCCCCC-CC
Q ss_conf             9747416-873-35----2776789999973339409998276754887--------78632778479613366767-89
Q gi|254780911|r  132 LPFYYLP-MTE-QN----KIESEQKLINIIEKNNVELMILARYMQILSD--------HLCHKMTGRIINIHHSFLPS-FK  196 (288)
Q Consensus       132 IP~~~i~-~~~-~~----k~~~e~~il~~l~~~~~DlivLAgymril~~--------~~~~~~~~~iiNiHpslLP~-f~  196 (288)
                      .+..||. |.- .|    -++.-..+++.+++++++|++++-....+..        -+-+.|..|--|---+|.|. -+
T Consensus        98 ~~l~hVKpHGALYn~a~~d~~lA~~i~~ai~~~~~~l~l~~~~~s~~~~~A~~~Gl~~~~E~FADR~Y~~dG~LvpR~~~  177 (252)
T 1xw8_A           98 GVMRHVKPHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADRGYQADGSLVPRSQS  177 (252)
T ss_dssp             CCEEEECCCHHHHHHHTTCHHHHHHHHHHHHHHCTTCEEEEETTSHHHHHHHHTTCCEEEEECTTSCBCTTSSBCCTTTC
T ss_pred             CCCCEECCCHHHHHHHHCCHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHHHHHCCCCEEEEEEECCCCCCCCCEEECCCC
T ss_conf             96310250369998751379999999999998594154424887499999987599779999862657899998862477


Q ss_pred             CC
Q ss_conf             99
Q gi|254780911|r  197 GA  198 (288)
Q Consensus       197 G~  198 (288)
                      |+
T Consensus       178 gA  179 (252)
T 1xw8_A          178 GA  179 (252)
T ss_dssp             C-
T ss_pred             CC
T ss_conf             87


No 97 
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protein, nucleotide-binding, transcription regulation, activator, repressor; HET: PG4; 2.30A {Escherichia coli}
Probab=62.59  E-value=7.9  Score=18.11  Aligned_cols=106  Identities=14%  Similarity=0.146  Sum_probs=56.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHHHCCCCCCEECCCCCCCC
Q ss_conf             99998599876688899999857981897344432436889999999728852777988898740023202012445655
Q gi|254780911|r    5 ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEAT   84 (288)
Q Consensus         5 iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~~~~~   84 (288)
                      -|-+.|.||.|+...+...+++.+.++......  .. ...+.+...........+...+..+.......-.......+.
T Consensus         2 rl~v~~~DR~gl~~eil~~l~~~~i~i~~iei~--~~-~~~~~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~~~~e~~   78 (190)
T 2jhe_A            2 RLEVFCEDRLGLTRELLDLLVLRGIDLRGIEID--PI-GRIYLNFAELEFESFSSLMAEIRRIAGVTDVRTVPWMPSERE   78 (190)
T ss_dssp             EEEEEECSCTTHHHHHHHHHHHTTCCEEEEEEE--TT-TEEEEEECCCCHHHHHHHHHHHHHSTTEEEEEEESCCTTTHH
T ss_pred             EEEEECCCCHHHHHHHHHHHHHCCCCEEEEEEE--CC-CEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_conf             079982641167999999998668737999996--46-429999623465678999999998651676654430577999


Q ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCEEE--EEEEEECCHH
Q ss_conf             3899970886798999986204674158--9999977346
Q gi|254780911|r   85 KTLILVSQPDHCLNDLLYRWNIGTLALN--IVGVVSNHTT  122 (288)
Q Consensus        85 riailvSg~gsnL~~Ll~~~~~g~L~~e--I~~VISN~~d  122 (288)
                      +         .-++++++...+|-+-.+  =..+..|+.-
T Consensus        79 ~---------~~~~~il~~~~dgii~~D~~g~i~~~N~aa  109 (190)
T 2jhe_A           79 H---------LALSALLEALPEPVLSVDMKSKVDMANPAS  109 (190)
T ss_dssp             H---------HHHHHHHHHCSSCEEEECTTCBEEEECHHH
T ss_pred             H---------HHHHHHHHHCCCCEEEECCCCCEEEECHHH
T ss_conf             9---------999999974040708998999599999899


No 98 
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, PSI-2, protein structure initiative; 2.75A {Neisseria meningitidis MC58}
Probab=62.14  E-value=8.1  Score=18.06  Aligned_cols=102  Identities=10%  Similarity=0.018  Sum_probs=56.9

Q ss_pred             EEEEE-CCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCC-CHHHHHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             99998-5998766888999998579818973444324368899999997288-527779888987400232020124456
Q gi|254780911|r    5 ILTIT-CPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIADFQPIVQQFSLQYSIRNTKE   82 (288)
Q Consensus         5 iLti~-CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~-~~~~l~~~f~~ia~~~~m~~~i~~~~~   82 (288)
                      .+++. -||++|+.+++-+.|+++|.||--+.|....+.   -+.+.|..+. +.......+..+....+ .+++.....
T Consensus        27 ~vti~~~~~~~g~~~~iF~~la~~gI~vdmI~q~~~~~~---~~~isf~~~~~d~~~~~~~~~~~~~~~~-~~~v~~~~~  102 (167)
T 2re1_A           27 RINVRGVPDKPGVAYQILGAVADANIEVDMIIQNVGSEG---TTDFSFTVPRGDYKQTLEILSERQDSIG-AASIDGDDT  102 (167)
T ss_dssp             EEEEEEEECCTTHHHHHHHHHHTTTCCCCCEEEC----C---EEEEEEEECGGGHHHHHHHHHHSSTTTT-CSEEEEESS
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCC---EEEEEEEEEHHHHHHHHHHHHHHHHHCC-CEEEEECCC
T ss_conf             999905899831899999999984998799984047897---6899998418887779999986553148-317997078


Q ss_pred             CCCEEEEECCCCCC---HHHHHHHHCCCCCE
Q ss_conf             55389997088679---89999862046741
Q gi|254780911|r   83 ATKTLILVSQPDHC---LNDLLYRWNIGTLA  110 (288)
Q Consensus        83 ~~riailvSg~gsn---L~~Ll~~~~~g~L~  110 (288)
                      --++++-..|--+.   ...+..+.....++
T Consensus       103 ~akvsvVG~gm~~~~gvaak~f~aL~~~~In  133 (167)
T 2re1_A          103 VCKVSAVGLGMRSHVGVAAKIFRTLAEEGIN  133 (167)
T ss_dssp             EEEEEEECSSCTTCCCHHHHHHHHHHHTTCC
T ss_pred             EEEEEEECCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             7799998462003888278999999978993


No 99 
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal phosphate, isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2
Probab=61.94  E-value=8.1  Score=18.03  Aligned_cols=135  Identities=12%  Similarity=0.079  Sum_probs=61.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEE---------------------EEECCHHHH----HHHHHCCCCEEE
Q ss_conf             6553899970886798999986204674158999---------------------997734667----778860997474
Q gi|254780911|r   82 EATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG---------------------VVSNHTTHK----KLVENYQLPFYY  136 (288)
Q Consensus        82 ~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~---------------------VISN~~d~~----~lA~~~gIP~~~  136 (288)
                      .+.+.+|-+|..-|. +++-..++.-.+++.|..                     +-.+..++.    .++++.+..|.+
T Consensus        77 ~~~~gVV~aSaGNha-~gvA~aA~~lGi~~~IvmP~~t~~~Ki~~~r~~GAeVv~~g~~~~~a~~~a~~~~~~~g~~~i~  155 (514)
T 1tdj_A           77 QKAHGVITASAGNHA-QGVAFSSARLGVKALIVMPTATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELSQQQGFTWVP  155 (514)
T ss_dssp             SCSSSCEEEECSSSH-HHHHHHHHHTTCCEEEECCSSCCHHHHHHHHHHSCEEECCCSSHHHHHHHHHHHHHHHCCEECC
T ss_pred             CCCCEEEEECCCHHH-HHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHCCEEEECCCCCHHHHHHHHHHHHCCCCCCCC
T ss_conf             799989997876999-9999999984997899997998799999999819869984872014566555444124323566


Q ss_pred             CCCCCCCHHH-HH---HHHHHHHHHCCCEEEEEC-CCCCCCC---HHHHHHC-CCCEEEECCCCCCCCCCCCHHHHHHHC
Q ss_conf             1687335277-67---899999733394099982-7675488---7786327-784796133667678999958999742
Q gi|254780911|r  137 LPMTEQNKIE-SE---QKLINIIEKNNVELMILA-RYMQILS---DHLCHKM-TGRIINIHHSFLPSFKGANPYKQAYEY  207 (288)
Q Consensus       137 i~~~~~~k~~-~e---~~il~~l~~~~~DlivLA-gymril~---~~~~~~~-~~~iiNiHpslLP~f~G~~~y~~A~~~  207 (288)
                       |.++.+... +.   .++++.+  -++|.|+++ |-.=.++   ..+-... .-|||-+-|.      |+..+.++++.
T Consensus       156 -p~ddp~viaGqgTi~~EI~~q~--~~~D~IvvpvGgGGliaGia~~lK~~~P~ikIIgVEp~------~a~~~~~sl~~  226 (514)
T 1tdj_A          156 -PFDHPMVIAGQGTLALELLQQD--AHLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAE------DSACLKAALDA  226 (514)
T ss_dssp             -SSCCHHHHHHHHHHHHHHHHHC--TTCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEET------TTCHHHHHHHH
T ss_pred             -CCCCHHHHHCCCCHHHHHHHHC--CCCCEEEEECCHHHHHHHHHHHHHHHCCCCEEEEECCC------CCHHHHHHHHC
T ss_conf             -5568777640321788999756--99999999276419999999999986998718877843------15568878757


Q ss_pred             CCCEEEEEEEEEECCCCCC
Q ss_conf             6837622577530556888
Q gi|254780911|r  208 GVKIIGATAHYAICELDAG  226 (288)
Q Consensus       208 Gvk~~G~TvH~V~~~lD~G  226 (288)
                      |-.+.-.+++-.-+++..+
T Consensus       227 G~~v~~~~~~t~AdGiav~  245 (514)
T 1tdj_A          227 GHPVDLPRVGLFAEGVAVK  245 (514)
T ss_dssp             TSCCCCSCCCSSSSTTCCS
T ss_pred             CCEECCCCCCCEECCCCCC
T ss_conf             9740368888554244589


No 100
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum}
Probab=61.90  E-value=8.1  Score=18.03  Aligned_cols=87  Identities=13%  Similarity=0.142  Sum_probs=45.5

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHH---HHHHHCCCCEEECCCCCC-CHHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             798999986204674158999997734667---778860997474168733-5277678999997333940999827675
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHK---KLVENYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVELMILARYMQ  170 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i~~~~~-~k~~~e~~il~~l~~~~~DlivLAgymr  170 (288)
                      +++.++|..     -.++.+.|.+......   ..|-++|++.+.=  +.- ...+.-.++.++.+++++  ++..||++
T Consensus        58 ~~~~~ll~~-----~~iD~V~I~tp~~~H~~~~~~al~~Gk~V~~E--KP~a~~~~ea~~l~~~a~~~~~--~~~v~~~~  128 (359)
T 3m2t_A           58 DNVPAMLNQ-----VPLDAVVMAGPPQLHFEMGLLAMSKGVNVFVE--KPPCATLEELETLIDAARRSDV--VSGVGMNF  128 (359)
T ss_dssp             SSHHHHHHH-----SCCSEEEECSCHHHHHHHHHHHHHTTCEEEEC--SCSCSSHHHHHHHHHHHHHHTC--CEEECCHH
T ss_pred             CCHHHHHCC-----CCCCEEEECCCHHHHHHHHHHHHHCCCEEEEE--ECCCHHHHHHHHHHHHHHHCCC--CCCCCCCE
T ss_conf             899999659-----99998998786354358999998439809998--5330317999998866541133--43342000


Q ss_pred             CCCHHHHHH-------CCCCEEEECCC
Q ss_conf             488778632-------77847961336
Q gi|254780911|r  171 ILSDHLCHK-------MTGRIINIHHS  190 (288)
Q Consensus       171 il~~~~~~~-------~~~~iiNiHps  190 (288)
                      ...|.+...       .-|++.-++-+
T Consensus       129 R~~p~~~~~k~~i~~g~iG~i~~i~~~  155 (359)
T 3m2t_A          129 KFARPVRQLREMTQVDEFGETLHIQLN  155 (359)
T ss_dssp             HHCHHHHHHHHHHTSGGGCCEEEEEEE
T ss_pred             EHHHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             003578999999986105854999992


No 101
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, structural genomics; 2.00A {Exiguobacterium sibiricum 255-15}
Probab=61.18  E-value=8.4  Score=17.94  Aligned_cols=72  Identities=8%  Similarity=0.015  Sum_probs=33.9

Q ss_pred             CCEEEEEEECCCCCC-HHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEE-CCCCHHHHHHHHHHHHCCCCCCE
Q ss_conf             964999998599876-6888999998579818973444324368899999997-28852777988898740023202
Q gi|254780911|r    1 MSSYILTITCPSNEE-ITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLFIADFQPIVQQFSLQY   75 (288)
Q Consensus         1 M~~~iLti~CpD~~G-IVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~-~~~~~~~l~~~f~~ia~~~~m~~   75 (288)
                      |++..+++.|..+.+ ++.++..  +..++.|+-.+-.-+.-. .++.--.+. ...+.+.+...+.+++++.+.++
T Consensus         2 m~k~~ILi~~~g~~~~l~~~~~~--~~~~~~vi~~D~~~~~~~-~~~~D~~~~~p~~~~~~~~~~l~~i~~~~~id~   75 (331)
T 2pn1_A            2 MQKPHLLITSAGRRAKLVEYFVK--EFKTGRVSTADCSPLASA-LYMADQHYIVPKIDEVEYIDHLLTLCQDEGVTA   75 (331)
T ss_dssp             TTCCEEEEESCTTCHHHHHHHHH--HCCSSEEEEEESCTTCGG-GGGSSSEEECCCTTSTTHHHHHHHHHHHHTCCE
T ss_pred             CCCCEEEEECCCHHHHHHHHHHH--CCCCCEEEEECCCCCCHH-HHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCE
T ss_conf             98878999288618999999997--499998999889999857-884598898799885679999999999959999


No 102
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A
Probab=60.74  E-value=5  Score=19.53  Aligned_cols=66  Identities=8%  Similarity=0.046  Sum_probs=41.3

Q ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCC-C--EEEEEEEEECCCCHHHHHHHHHHHHCCC
Q ss_conf             4999998599876688899999857981897344432436-8--8999999972885277798889874002
Q gi|254780911|r    3 SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-S--KLFMRISFVFNTCMKLFIADFQPIVQQF   71 (288)
Q Consensus         3 ~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~-~--~FFmRi~f~~~~~~~~l~~~f~~ia~~~   71 (288)
                      +.-|.++..|++|-.+++=..+-+++.||+++..--.+.. +  -||+.  ++... .+.+...++.+.+..
T Consensus        34 ktSiiFSLkd~vGsLaraLkvFe~~~INLtHIESRPSk~~~~~yeffVd--~E~~~-~~~l~~li~~Lk~~~  102 (429)
T 1phz_A           34 AISLIFSLKEEVGALAKVLRLFEENDINLTHIESRPSRLNKDEYEFFTY--LDKRT-KPVLGSIIKSLRNDI  102 (429)
T ss_dssp             CEEEEEEEECCTTHHHHHHHHHHTTTCCTTSEEEEECSSCTTEEEEEEC--BCGGG-HHHHHHHHHHHHHTT
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEEEE--ECCCC-CHHHHHHHHHHHHHH
T ss_conf             0899999687615899999999986936999636888788886269999--82678-478999999999875


No 103
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris}
Probab=59.98  E-value=8.8  Score=17.81  Aligned_cols=88  Identities=10%  Similarity=0.054  Sum_probs=43.9

Q ss_pred             CCCCCCCCCEEEEECCCCC-CHHHHHHHHCCCC--CEEEEEEEEECCHHHHHHHHHC-CC--------CEE------ECC
Q ss_conf             1244565538999708867-9899998620467--4158999997734667778860-99--------747------416
Q gi|254780911|r   77 IRNTKEATKTLILVSQPDH-CLNDLLYRWNIGT--LALNIVGVVSNHTTHKKLVENY-QL--------PFY------YLP  138 (288)
Q Consensus        77 i~~~~~~~riailvSg~gs-nL~~Ll~~~~~g~--L~~eI~~VISN~~d~~~lA~~~-gI--------P~~------~i~  138 (288)
                      ......|+|||||-||.+. .+++.+.+.-.-.  ..+++   +.=+....+|.+.. .|        ...      .+-
T Consensus       204 ~~~~~~kKrIaILTSGGDaPGmNaaIraVVr~a~~~G~eV---~Gi~~Gy~GLv~g~~~i~~L~~~~V~~i~~~GGTiLG  280 (989)
T 3opy_A          204 VKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAGIFYGCKV---YACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIG  280 (989)
T ss_dssp             ----CCSEEEEEEECSSCCTTHHHHHHHHHHHHHHTTEEE---EEECTHHHHHHSCSTTEEEECTTTTTTGGGCCSCSSC
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEE---EEECCCHHHHHCCCCCEEECCHHHHHHHHHCCCCEEE
T ss_conf             6676797089998867775558899999999998779999---9985465877269976577999998669848987530


Q ss_pred             --CCCCCHH-HHHHHHHHHHHHCCCEEEE-ECC
Q ss_conf             --8733527-7678999997333940999-827
Q gi|254780911|r  139 --MTEQNKI-ESEQKLINIIEKNNVELMI-LAR  167 (288)
Q Consensus       139 --~~~~~k~-~~e~~il~~l~~~~~Dliv-LAg  167 (288)
                        ..++.++ +.-.+..+.|+++++|.+| .-|
T Consensus       281 TsR~~~f~~~egr~ka~~nL~~~gId~LivIGG  313 (989)
T 3opy_A          281 TARCKEFRERWGRLQACYNMVSNGIDALVVCGG  313 (989)
T ss_dssp             CCCSSSTTSHHHHHHHHHHHHHTTCCEEEEEEC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             688986647768999999999869998999898


No 104
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A*
Probab=59.89  E-value=4.4  Score=19.87  Aligned_cols=10  Identities=20%  Similarity=-0.001  Sum_probs=4.3

Q ss_pred             CEEEEECCCC
Q ss_conf             3899970886
Q gi|254780911|r   85 KTLILVSQPD   94 (288)
Q Consensus        85 riailvSg~g   94 (288)
                      ||+||=||-|
T Consensus         2 kIgvfDSGiG   11 (255)
T 2jfz_A            2 KIGVFDSGVG   11 (255)
T ss_dssp             EEEEEESSST
T ss_pred             EEEEEECCCC
T ss_conf             8999928976


No 105
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032}
Probab=59.54  E-value=8.9  Score=17.76  Aligned_cols=85  Identities=12%  Similarity=0.153  Sum_probs=39.8

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             9899998620467415899999773466777---886099747416873-352776789999973339409998276754
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMILARYMQI  171 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~DlivLAgymri  171 (288)
                      .++++|.   ..  ..+.+.|.+.......+   |-++|++.+.  -+. ....+.-.++.++.++.+.-+.|  ||++-
T Consensus        56 ~~~ell~---~~--~iD~V~I~tp~~~h~~~~~~al~~gk~Vl~--EKP~a~~~~e~~~l~~~~~~~~~~~~v--~~~~R  126 (344)
T 3euw_A           56 SPDEVFA---RD--DIDGIVIGSPTSTHVDLITRAVERGIPALC--EKPIDLDIEMVRACKEKIGDGASKVML--GFNRR  126 (344)
T ss_dssp             SHHHHTT---CS--CCCEEEECSCGGGHHHHHHHHHHTTCCEEE--CSCSCSCHHHHHHHHHHHGGGGGGEEE--CCGGG
T ss_pred             CHHHHHC---CC--CCCEEEECCCCCCHHHHHHHHHHHCCCEEE--CCCCCHHHHHHHHHHHHHHHCCCCCCC--CCCCC
T ss_conf             9999964---89--988899715431103567998851375110--232200134566666655413332212--43122


Q ss_pred             CCHHHHH-------HCCCCEEEECC
Q ss_conf             8877863-------27784796133
Q gi|254780911|r  172 LSDHLCH-------KMTGRIINIHH  189 (288)
Q Consensus       172 l~~~~~~-------~~~~~iiNiHp  189 (288)
                      ..|.+..       ..-|++..+|.
T Consensus       127 ~~~~~~~~k~~i~~g~iG~i~~~~~  151 (344)
T 3euw_A          127 FDPSFAAINARVANQEIGNLEQLVI  151 (344)
T ss_dssp             GCHHHHHHHHHHHTTTTSSEEEEEE
T ss_pred             CCHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             6878999999875388550589999


No 106
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A
Probab=58.94  E-value=9.1  Score=17.69  Aligned_cols=20  Identities=15%  Similarity=0.242  Sum_probs=8.9

Q ss_pred             EEEECCHHHHHHHHHCCCCE
Q ss_conf             99977346677788609974
Q gi|254780911|r  115 GVVSNHTTHKKLVENYQLPF  134 (288)
Q Consensus       115 ~VISN~~d~~~lA~~~gIP~  134 (288)
                      .+++|.+++...++..+-|+
T Consensus       142 ~~~~~~~ea~~~~~~~g~P~  161 (451)
T 2yrx_A          142 AAFTSYEEAKAYIEQKGAPI  161 (451)
T ss_dssp             EEESCHHHHHHHHHHHCSSE
T ss_pred             EEEECHHHHHHHHHHCCCCE
T ss_conf             89978999999986049966


No 107
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1
Probab=57.00  E-value=1.6  Score=22.91  Aligned_cols=57  Identities=7%  Similarity=0.078  Sum_probs=35.3

Q ss_pred             EEEEEECCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEE
Q ss_conf             57753055688834444466518888999999999999999999999998769178868857
Q gi|254780911|r  215 TAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKT  276 (288)
Q Consensus       215 TvH~V~~~lD~GpII~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~kt  276 (288)
                      ||..+..+++.-.+    .+.|++++|+++|.+++.+.+ .+-+...+|+..+|++.++++|
T Consensus        11 tv~~~~k~l~~~t~----~l~V~~~~tV~~lK~~I~~~~-gip~~~qrLi~~G~~L~~d~~t   67 (102)
T 1v5o_A           11 TVYCVRRDLTEVTF----SLQVNPDFELSNFRVLCELES-GVPAEEAQIVYMEQLLTDDHCS   67 (102)
T ss_dssp             EEEECCCCCCCCEE----EEEECTTCBHHHHHHHHHHHT-CCCGGGBCEEETTEEECCSSSB
T ss_pred             EEEECCCCCCCCEE----EEEECCCCHHHHHHHHHHHHH-CCCHHHEEEEECCEEECCCCCC
T ss_conf             99964668999899----999788044999999997776-8490218987588684147522


No 108
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, thiamin thiazolone diphosphate, inhibitor; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X*
Probab=56.76  E-value=3.2  Score=20.87  Aligned_cols=72  Identities=13%  Similarity=0.181  Sum_probs=36.3

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEE----CCHHHHHHHHHCCCCEEECCCCCC----CHHH--------HHHHHHHHHHHCC
Q ss_conf             98999986204674158999997----734667778860997474168733----5277--------6789999973339
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVS----NHTTHKKLVENYQLPFYYLPMTEQ----NKIE--------SEQKLINIIEKNN  159 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VIS----N~~d~~~lA~~~gIP~~~i~~~~~----~k~~--------~e~~il~~l~~~~  159 (288)
                      .+..+....+..+-|.-+...-.    ..+.+..++++.|+|...-+..+.    +...        ......+.+.  +
T Consensus       189 ~i~~~~~~l~~a~~pvii~G~g~~~~~~~~~~~~lae~l~~pv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~--~  266 (528)
T 1q6z_A          189 DLDILVKALNSASNPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAAISQLLE--G  266 (528)
T ss_dssp             HHHHHHHHHHHCSSCEEEECHHHHHTTCHHHHHHHHHHHTCCEEECSSCSBCCSCTTSTTEEEECCSCHHHHHHHHT--T
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH--H
T ss_conf             99999999974658726614532023667678999997437730102345544688984234766777388877765--2


Q ss_pred             CEEEEECCCC
Q ss_conf             4099982767
Q gi|254780911|r  160 VELMILARYM  169 (288)
Q Consensus       160 ~DlivLAgym  169 (288)
                      .|+|++.|-.
T Consensus       267 ~D~vi~iG~~  276 (528)
T 1q6z_A          267 HDVVLVIGAP  276 (528)
T ss_dssp             CSEEEEESSC
T ss_pred             CCHHEEECCC
T ss_conf             2013022653


No 109
>3db2_A Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2}
Probab=56.76  E-value=9.9  Score=17.44  Aligned_cols=74  Identities=16%  Similarity=0.223  Sum_probs=35.1

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEEC-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             79899998620467415899999773466777---88609974741-687335277678999997333940999827675
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYL-PMTEQNKIESEQKLINIIEKNNVELMILARYMQ  170 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i-~~~~~~k~~~e~~il~~l~~~~~DlivLAgymr  170 (288)
                      +++.+++..   .  +.+.+.|.+.......+   |-++|.+.+.= |.. .+-++. +++.++.++.+.-+  ..||++
T Consensus        56 ~~~~~ll~~---~--~iD~V~i~tp~~~h~~~~~~al~~gk~V~~EKP~a-~~~~e~-~~l~~~a~~~~~~~--~v~~~~  126 (354)
T 3db2_A           56 ATMEALLAR---E--DVEMVIITVPNDKHAEVIEQCARSGKHIYVEKPIS-VSLDHA-QRIDQVIKETGVKF--LCGHSS  126 (354)
T ss_dssp             SSHHHHHHC---S--SCCEEEECSCTTSHHHHHHHHHHTTCEEEEESSSC-SSHHHH-HHHHHHHHHHCCCE--EEECGG
T ss_pred             CCHHHHHCC---C--CCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCCC-CCHHHH-HHHHHHHHHCCCCC--CCCEEE
T ss_conf             899999569---9--99889987977888888999997899799966864-323788-88888998607764--222100


Q ss_pred             CCCHHHH
Q ss_conf             4887786
Q gi|254780911|r  171 ILSDHLC  177 (288)
Q Consensus       171 il~~~~~  177 (288)
                      ...|.+.
T Consensus       127 r~~p~~~  133 (354)
T 3db2_A          127 RRLGALR  133 (354)
T ss_dssp             GGSHHHH
T ss_pred             EEHHHHH
T ss_conf             0014667


No 110
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii}
Probab=55.56  E-value=10  Score=17.31  Aligned_cols=207  Identities=14%  Similarity=0.098  Sum_probs=95.6

Q ss_pred             HHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCC-HHHHHHHHH-HHHCCCCC-CEECCCCCCCCCEEEEE--
Q ss_conf             68889999985798189734443243688999999972885-277798889-87400232-02012445655389997--
Q gi|254780911|r   16 ITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-MKLFIADFQ-PIVQQFSL-QYSIRNTKEATKTLILV--   90 (288)
Q Consensus        16 IVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~-~~~l~~~f~-~ia~~~~m-~~~i~~~~~~~riailv--   90 (288)
                      ..-.+...|-+.+.|..-..++.+.-..+-+- -+...+.+ .+.+...+. ++.+-++- ...+.....++.+..|+  
T Consensus        29 ~l~ei~~aLLeADV~~~vv~~~i~~ik~~~~~-~~~~~~~~~~~~i~kiv~~eL~~lLg~~~~~~~~~~~~p~VIllvGl  107 (432)
T 2v3c_C           29 VIKDIQRALIQADVNVKLVLKMSKEIERRALE-EKTPKGLSKKEHIIKIVYEELVKLLGEEAKKLELNPKKQNVILLVGI  107 (432)
T ss_dssp             HHHHHHHHHHHTCCCHHHHHHHTHHHHHHHSS-SCSSCSSCHHHHHHHHHHHHHHHHHCCSCCCCCCCSSSCCCEEEECC
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH-CCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCEEEEEECC
T ss_conf             99999999987789879999999999999840-63566688399999999999998736310110137899869998579


Q ss_pred             --CCCCCCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             --08867989999862046741589999977--3466----777886099747416873352776789999973339409
Q gi|254780911|r   91 --SQPDHCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVEL  162 (288)
Q Consensus        91 --Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dl  162 (288)
                        ||.-++..-|-..++..  .-.+.+|-++  |+.|    +.+|+..|+|++.-.....+..+.....++..+.+++=+
T Consensus       108 ~GsGKTTT~aKLA~~l~~~--g~kv~lvaaDt~R~aA~eQL~~~a~~~~v~~~~~~~~~~~p~~i~~~a~~~~~~~Dvvi  185 (432)
T 2v3c_C          108 QGSGKTTTAAKLARYIQKR--GLKPALIAADTYRPAAYEQLKQLAEKIHVPIYGDETRTKSPVDIVKEGMEKFKKADVLI  185 (432)
T ss_dssp             SSSSTTHHHHHHHHHHHHH--HCCEEEECCSCCCTTGGGSSHHHHHHSSCCEECCSSSCCSSSTTHHHHHHTTSSCSEEE
T ss_pred             CCCCCHHHHHHHHHHHHHC--CCCCEEEEECCCHHHHHHHHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             8776214899999999977--99742442103368899999999723797577786665408999999999962699899


Q ss_pred             EEECCCCCCCCHHHHHHCC--CCEEEECCCCC--CCCCCCCHHHHH--HHCCC-CEEEEEEEEEECCCCCC
Q ss_conf             9982767548877863277--84796133667--678999958999--74268-37622577530556888
Q gi|254780911|r  163 MILARYMQILSDHLCHKMT--GRIINIHHSFL--PSFKGANPYKQA--YEYGV-KIIGATAHYAICELDAG  226 (288)
Q Consensus       163 ivLAgymril~~~~~~~~~--~~iiNiHpslL--P~f~G~~~y~~A--~~~Gv-k~~G~TvH~V~~~lD~G  226 (288)
                      |=.||-+++ ..++.+...  .+++|-|..+|  .+--|.+...+|  +...+ .++|+-+--+|+.--.|
T Consensus       186 IDTAGRl~~-d~~Lm~EL~~i~~~~~P~e~llV~Da~~Gq~a~~~a~~F~~~~~~i~giIlTKlDg~akgG  255 (432)
T 2v3c_C          186 IDTAGRHKE-EKGLLEEMKQIKEITNPDEIILVIDGTIGQQAGIQAKAFKEAVGEIGSIIVTKLDGSAKGG  255 (432)
T ss_dssp             EECCCSCSS-HHHHHHHHHHTTSSSCCSEEEEEEEGGGGGGHHHHHHHHHTTSCSCEEEEEECSSSCSTTH
T ss_pred             EECCCCCCC-HHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCH
T ss_conf             866665512-0779999999987629750321021211146899899999985235525774103677524


No 111
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5
Probab=55.23  E-value=10  Score=17.28  Aligned_cols=25  Identities=12%  Similarity=0.133  Sum_probs=10.8

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHH
Q ss_conf             999997333940999827675488778
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHL  176 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~  176 (288)
                      ++.++.++.+  .+++.||++...|.+
T Consensus       105 ~l~~~a~~~~--~~~~v~~~~Rf~p~~  129 (323)
T 1xea_A          105 NLYELAEKHH--QPLYVGFNRRHIPLY  129 (323)
T ss_dssp             HHHHHHHHTT--CCEEEECGGGCCHHH
T ss_pred             CCCCCCCCCC--CCCCCCCCCCCCHHH
T ss_conf             2101111345--533233233269999


No 112
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A*
Probab=54.93  E-value=4.8  Score=19.66  Aligned_cols=70  Identities=10%  Similarity=-0.010  Sum_probs=32.9

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEEC---CH----HHHHHHHHCCCCEEECCCCCCCHHH-----------HHHHHHHHHHH
Q ss_conf             989999862046741589999977---34----6677788609974741687335277-----------67899999733
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSN---HT----THKKLVENYQLPFYYLPMTEQNKIE-----------SEQKLINIIEK  157 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN---~~----d~~~lA~~~gIP~~~i~~~~~~k~~-----------~e~~il~~l~~  157 (288)
                      .+..+++.++..+-+.   ++++.   +.    .+..+|+..|+|...-...+..-.+           ......  ...
T Consensus       193 ~~~~~~~~l~~a~rpv---ii~G~~~~~~~~~~~~~~la~~~~~pv~~t~~~~~~~~~~~~~~~g~~~~~~~~~~--~~~  267 (563)
T 2uz1_A          193 DLDQALALLRKAERPV---IVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFA--KAD  267 (563)
T ss_dssp             HHHHHHHHHHHCSSEE---EEECHHHHHHTCHHHHHHHHHHHCCCEEECGGGGGGGTTSCGGGEEEEGGGGGGTT--TTT
T ss_pred             HHHHHHHHHHHCCCCE---EEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHH--HHH
T ss_conf             9999999997179988---99867523001489999999985998897521123235775333464100257899--875


Q ss_pred             CCCEEEEECCCCC
Q ss_conf             3940999827675
Q gi|254780911|r  158 NNVELMILARYMQ  170 (288)
Q Consensus       158 ~~~DlivLAgymr  170 (288)
                      ..+|+|+..|...
T Consensus       268 ~~~Dlvl~~G~~~  280 (563)
T 2uz1_A          268 AAPDLVLMLGARF  280 (563)
T ss_dssp             CCCSEEEEESCCS
T ss_pred             HCCCEEEEECCCC
T ss_conf             3588688706532


No 113
>2prs_A High-affinity zinc uptake system protein ZNUA; protein consists of two (beta/ALFA)4 domains, metal transport; 1.70A {Escherichia coli} PDB: 2osv_A 2ps0_A 2ps3_A 2ps9_A 2ogw_A
Probab=54.86  E-value=11  Score=17.23  Aligned_cols=109  Identities=8%  Similarity=0.006  Sum_probs=61.5

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEEC-CC--CCCCHHHHHHHHHHHHHHCCCEEEEECCCCC-CC
Q ss_conf             89999862046741589999977346677788609974741-68--7335277678999997333940999827675-48
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYL-PM--TEQNKIESEQKLINIIEKNNVELMILARYMQ-IL  172 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i-~~--~~~~k~~~e~~il~~l~~~~~DlivLAgymr-il  172 (288)
                      |.+|...+++.--+..=.-+++-|+...-+++++|+....+ ..  ..+-....=.++.+.+++.++.+|+...+.. -.
T Consensus       158 l~~l~~~~~~~l~~~~~~~~i~~H~af~Y~~~~~gl~~~~~~~~~~~~~ps~~~l~~~~~~ik~~~i~~i~~e~~~~~~~  237 (284)
T 2prs_A          158 LASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAV  237 (284)
T ss_dssp             HHHHHHHHHHHHGGGTTCCEEEEESCCHHHHHHHTCCCCEEEESSTTSCCCHHHHHHHHHHHHHTTCCEEEECTTSCSHH
T ss_pred             HHHHHHHHHHHHCHHHCCCCCEECCHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHH
T ss_conf             99989999998342425773101605676899769847543135876678989999999987515984899858989199


Q ss_pred             CHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             877863277847961336676789999589997
Q gi|254780911|r  173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAY  205 (288)
Q Consensus       173 ~~~~~~~~~~~iiNiHpslLP~f~G~~~y~~A~  205 (288)
                      -..+.+...-++.+++|==-....|...|..-+
T Consensus       238 ~~~la~e~~v~~~~ldpl~~~~~~~~~~Y~~~m  270 (284)
T 2prs_A          238 VESVARGTSVRMGTLDPLGTNIKLGKTSYSEFL  270 (284)
T ss_dssp             HHHHTTTSCCEEEECCTTCTTSCCSTTHHHHHH
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCCCCHHHHHH
T ss_conf             999999809977984477667777704299999


No 114
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A
Probab=54.64  E-value=11  Score=17.21  Aligned_cols=28  Identities=18%  Similarity=0.226  Sum_probs=17.2

Q ss_pred             CEEEEEEEEECCHHHHHHHHHCCCCEEE
Q ss_conf             4158999997734667778860997474
Q gi|254780911|r  109 LALNIVGVVSNHTTHKKLVENYQLPFYY  136 (288)
Q Consensus       109 L~~eI~~VISN~~d~~~lA~~~gIP~~~  136 (288)
                      +|.--.-+++|-+++...+++.|-|...
T Consensus       115 ipt~~~~~~~~~~ea~~~~~~~g~P~VI  142 (424)
T 2yw2_A          115 IPTARYEVFTDFEKAKEYVEKVGAPIVV  142 (424)
T ss_dssp             CCBCCEEEESCHHHHHHHHHHHCSSEEE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             8963444556199999999864997899


No 115
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1}
Probab=53.39  E-value=11  Score=17.08  Aligned_cols=26  Identities=12%  Similarity=0.354  Sum_probs=11.0

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHH
Q ss_conf             999997333940999827675488778
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHL  176 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~  176 (288)
                      ++.+++++.+ ..+.+.+|++-..|.+
T Consensus       113 ~l~~~a~~~~-~~~~~v~~~~r~~p~~  138 (346)
T 3cea_A          113 EMAKVIKSHP-NQIFQSGFMRRYDDSY  138 (346)
T ss_dssp             HHHHHHHTCT-TSCEECCCGGGTCHHH
T ss_pred             HHHHHHHHCC-CEEEECCEEECCCHHH
T ss_conf             5678887528-7665413230179999


No 116
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*
Probab=53.17  E-value=11  Score=17.05  Aligned_cols=144  Identities=13%  Similarity=0.153  Sum_probs=76.2

Q ss_pred             CCCCCCEEEEE----CCCCCCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEEECCCCCCCHHHHHH
Q ss_conf             45655389997----08867989999862046741589999977--3466----77788609974741687335277678
Q gi|254780911|r   80 TKEATKTLILV----SQPDHCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFYYLPMTEQNKIESEQ  149 (288)
Q Consensus        80 ~~~~~riailv----Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~~i~~~~~~k~~~e~  149 (288)
                      ...++++..||    ||.-+.+.-|-.+.+..  +-.+.++-++  |+.+    +.+|+..|+|++..+.. .+..+.-.
T Consensus       125 ~~~~p~Vi~~vG~~G~GKTTt~aKlA~~~~~~--g~kv~l~~~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~-~d~~~v~~  201 (328)
T 3e70_C          125 KAEKPYVIMFVGFNGSGKTTTIAKLANWLKNH--GFSVVIAASDTFRAGAIEQLEEHAKRIGVKVIKHSYG-ADPAAVAY  201 (328)
T ss_dssp             SSCSSEEEEEECCTTSSHHHHHHHHHHHHHHT--TCCEEEEEECCSSTTHHHHHHHHHHHTTCEEECCCTT-CCHHHHHH
T ss_pred             CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHHCCCEECCCCC-CCHHHHHH
T ss_conf             36898699997687788654389999999966--9960576323245079999999988735761467899-99999999


Q ss_pred             HHHHHHHHCCCEEEE--ECCCCCCCCHHH--HHHCCCCEEEECCCCC--CCCCCCCHHHHH--HHCCCCEEEEEEEEEEC
Q ss_conf             999997333940999--827675488778--6327784796133667--678999958999--74268376225775305
Q gi|254780911|r  150 KLINIIEKNNVELMI--LARYMQILSDHL--CHKMTGRIINIHHSFL--PSFKGANPYKQA--YEYGVKIIGATAHYAIC  221 (288)
Q Consensus       150 ~il~~l~~~~~Dliv--LAgymril~~~~--~~~~~~~iiNiHpslL--P~f~G~~~y~~A--~~~Gvk~~G~TvH~V~~  221 (288)
                      +.++..+..+.|+|+  .||-++.=...+  +.++ .++++-|..+|  ++-.|.+...||  +...+.+.|+-.--+|+
T Consensus       202 ~a~~~a~~~~~D~vlIDTaGR~~~~~~l~~el~~i-~~~~~p~~~llV~da~~g~~~~~~~~~f~~~~~~~g~IlTKlD~  280 (328)
T 3e70_C          202 DAIQHAKARGIDVVLIDTAGRSETNRNLMDEMKKI-ARVTKPNLVIFVGDALAGNAIVEQARQFNEAVKIDGIILTKLDA  280 (328)
T ss_dssp             HHHHHHHHHTCSEEEEEECCSCCTTTCHHHHHHHH-HHHHCCSEEEEEEEGGGTTHHHHHHHHHHHHSCCCEEEEECGGG
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHH-HHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             99999998699989867877761309999999999-97629974776234212289999999986228998699970338


Q ss_pred             CCCCCC
Q ss_conf             568883
Q gi|254780911|r  222 ELDAGP  227 (288)
Q Consensus       222 ~lD~Gp  227 (288)
                      .--.|.
T Consensus       281 t~~~G~  286 (328)
T 3e70_C          281 DARGGA  286 (328)
T ss_dssp             CSCCHH
T ss_pred             CCCCCH
T ss_conf             986169


No 117
>2wje_A CPS4B, tyrosine-protein phosphatase CPSB; capsule biogenesis/degradation, manganese, hydrolase, exopolysaccharide synthesis; 1.90A {Streptococcus pneumoniae} PDB: 2wjd_A 2wjf_A
Probab=52.75  E-value=11  Score=17.01  Aligned_cols=38  Identities=18%  Similarity=0.160  Sum_probs=22.0

Q ss_pred             EEEECCCCCCCCCCCC------HHHHHHHCCCCE-EEEEEEEEEC
Q ss_conf             7961336676789999------589997426837-6225775305
Q gi|254780911|r  184 IINIHHSFLPSFKGAN------PYKQAYEYGVKI-IGATAHYAIC  221 (288)
Q Consensus       184 iiNiHpslLP~f~G~~------~y~~A~~~Gvk~-~G~TvH~V~~  221 (288)
                      -||.+...-+...|..      ..+.+.+.|+++ +|.=+|..+.
T Consensus       165 ein~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~i~igSDAH~~~~  209 (247)
T 2wje_A          165 QVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDG  209 (247)
T ss_dssp             EEEHHHHSCCCSSCCSCHHHHHHHHHHHHTTCCSEEECCBCCSSS
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             864244333456777459999999999978990999858998434


No 118
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1
Probab=52.68  E-value=7.4  Score=18.33  Aligned_cols=48  Identities=15%  Similarity=0.097  Sum_probs=28.7

Q ss_pred             CCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHH---------------HHHCCEEEEECCEE
Q ss_conf             88344444665188889999999999999999999999---------------98769178868857
Q gi|254780911|r  225 AGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVN---------------AHIQQRVFINKRKT  276 (288)
Q Consensus       225 ~GpII~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~---------------~~~e~rv~~~~~kt  276 (288)
                      .|..+   .+.|.+++|+.+|.+++.+.+.. -+..-|               ++..++.+.++++|
T Consensus        16 ~G~~~---~v~V~~~~TV~dLK~~I~~~~~i-~~~~Qr~~~~~~~~~~~~~~~Li~~G~~L~dd~~t   78 (105)
T 1v2y_A           16 DGEVM---PVVVVQNATVLDLKKAIQRYVQL-KQEREGGVQHISWSYVWRTYHLTSAGEKLTEDRKK   78 (105)
T ss_dssp             SSCEE---EEEECTTCBHHHHHHHHHHHHHH-HHHHTTCCCCCCHHHHHTTEEEESSSCEECCSSSB
T ss_pred             CCCEE---EEEECCCCHHHHHHHHHHHHHCC-CHHHHCCCCCCCCCCCCCCCEEEECCEECCCCCCC
T ss_conf             99999---88989989699999999998794-97882442245300024555798899999868886


No 119
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A*
Probab=52.50  E-value=5.4  Score=19.27  Aligned_cols=13  Identities=31%  Similarity=0.725  Sum_probs=5.9

Q ss_pred             HHHHHHCCCCEEE
Q ss_conf             7778860997474
Q gi|254780911|r  124 KKLVENYQLPFYY  136 (288)
Q Consensus       124 ~~lA~~~gIP~~~  136 (288)
                      ..+|+..++|...
T Consensus       232 ~~la~~~~~pv~~  244 (564)
T 2q28_A          232 REFIESAQIPFLP  244 (564)
T ss_dssp             HHHHHHHTCCEEE
T ss_pred             HHHHHHHCCCCCC
T ss_conf             9999975899644


No 120
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}
Probab=52.18  E-value=12  Score=16.95  Aligned_cols=29  Identities=24%  Similarity=-0.009  Sum_probs=14.9

Q ss_pred             EEEEEEEEECCHHHH--HH-HHHCCCCEEECC
Q ss_conf             158999997734667--77-886099747416
Q gi|254780911|r  110 ALNIVGVVSNHTTHK--KL-VENYQLPFYYLP  138 (288)
Q Consensus       110 ~~eI~~VISN~~d~~--~l-A~~~gIP~~~i~  138 (288)
                      +-++++|.+++-.+-  ++ |...+||..|+-
T Consensus       114 kPD~vlV~GDr~~~la~alaa~~~~Ipi~Hie  145 (403)
T 3ot5_A          114 NPDIVLVHGDTTTSFAAGLATFYQQKMLGHVE  145 (403)
T ss_dssp             CCSEEEEETTCHHHHHHHHHHHHTTCEEEEES
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             99999996888048999999998199789996


No 121
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A
Probab=51.69  E-value=12  Score=16.90  Aligned_cols=157  Identities=11%  Similarity=0.136  Sum_probs=79.3

Q ss_pred             HHCCCCCCEECCCCCCCCCEEEEEC--CCC--CCHHHHHHHHCCCCCEEEEEEEEEC--CHHH----HHHHHHCCCCEEE
Q ss_conf             7400232020124456553899970--886--7989999862046741589999977--3466----7778860997474
Q gi|254780911|r   67 IVQQFSLQYSIRNTKEATKTLILVS--QPD--HCLNDLLYRWNIGTLALNIVGVVSN--HTTH----KKLVENYQLPFYY  136 (288)
Q Consensus        67 ia~~~~m~~~i~~~~~~~riailvS--g~g--snL~~Ll~~~~~g~L~~eI~~VISN--~~d~----~~lA~~~gIP~~~  136 (288)
                      +...++-.... +...++++..||-  |.|  +...-|-..++...  -.+.+|-++  |+.|    +.+|+..|+|++.
T Consensus        82 L~~~l~~~~~~-~~~~~p~VIl~vG~~G~GKTTT~aKLA~~~~~~g--~kv~lva~Dt~R~aA~eQL~~~a~~~~vp~~~  158 (425)
T 2ffh_A           82 LKEALGGEARL-PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKG--RRPLLVAADTQRPAAREQLRLLGEKVGVPVLE  158 (425)
T ss_dssp             HHHHTTSSCCC-CCCCSSEEEEEECCTTSSHHHHHHHHHHHHHTTT--CCEEEEECCSSCHHHHHHHHHHHHHHTCCEEE
T ss_pred             HHHHCCCCCCC-CCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHCC--CEEEEEECCCCCCCHHHHHHHHHHHCCCCEEC
T ss_conf             98500554345-4568973899966788761008999999998639--83689843556756799999999870882122


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEE--ECCCCCCCCHHHHHHCC--CCEEEECCCC--CCCCCCCCHHHHH--HHCC
Q ss_conf             1687335277678999997333940999--82767548877863277--8479613366--7678999958999--7426
Q gi|254780911|r  137 LPMTEQNKIESEQKLINIIEKNNVELMI--LARYMQILSDHLCHKMT--GRIINIHHSF--LPSFKGANPYKQA--YEYG  208 (288)
Q Consensus       137 i~~~~~~k~~~e~~il~~l~~~~~Dliv--LAgymril~~~~~~~~~--~~iiNiHpsl--LP~f~G~~~y~~A--~~~G  208 (288)
                      .. ...+..+.-....+..+..+.|+|+  .||-++.=.. +.+...  .++++-|..+  |++--|.+...||  +...
T Consensus       159 ~~-~~~dp~~i~~~~~~~ak~~~~DviiIDTAGR~~~d~~-lm~EL~~i~~~~~p~e~~LVlda~~gq~~~~~a~~F~~~  236 (425)
T 2ffh_A          159 VM-DGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEP-LMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEK  236 (425)
T ss_dssp             CC-TTCCHHHHHHHHHHHHHHTTCSEEEEECCCCSSCCHH-HHHHHHHHHHHHCCSEEEEEEEGGGTTHHHHHHHHHHHH
T ss_pred             CC-CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHH-HHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             46-7777677899999999866998899966651253699-999999999861985699973055586789999998864


Q ss_pred             CCEEEEEEEEEECCCCCCCE
Q ss_conf             83762257753055688834
Q gi|254780911|r  209 VKIIGATAHYAICELDAGPI  228 (288)
Q Consensus       209 vk~~G~TvH~V~~~lD~GpI  228 (288)
                      +.++|+-.--+|+.--.|.+
T Consensus       237 ~~i~gvIlTKlD~takgG~a  256 (425)
T 2ffh_A          237 VGVTGLVLTKLDGDARGGAA  256 (425)
T ss_dssp             TCCCEEEEESGGGCSSCHHH
T ss_pred             CCCCCEEEECCCCCCCCHHH
T ss_conf             69985476324677751399


No 122
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1
Probab=51.48  E-value=0.76  Score=25.23  Aligned_cols=42  Identities=10%  Similarity=0.060  Sum_probs=25.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEE
Q ss_conf             4466518888999999999999999999999998769178868857
Q gi|254780911|r  231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKT  276 (288)
Q Consensus       231 Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~kt  276 (288)
                      +..+.|.++||+.+|.+++.++|    +...||+..+|++-++.+|
T Consensus        19 ~~~v~v~~~~TV~~lK~~i~~~~----~~~qrLi~~Gk~L~dd~~t   60 (95)
T 1wia_A           19 EELAVARPEDTVGTLKSKYFPGQ----ESQMKLIYQGRLLQDPART   60 (95)
T ss_dssp             EEEEEECSSSBHHHHHHHHSSST----TTTCEEEETTEECCCSSCB
T ss_pred             EEEEEECCCCHHHHHHHHHHCCC----HHHEEEEECCEEECCCCCC
T ss_conf             99999898686999999986699----6668999899992478768


No 123
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua}
Probab=51.48  E-value=12  Score=16.88  Aligned_cols=84  Identities=8%  Similarity=0.144  Sum_probs=44.8

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             79899998620467415899999773466777---886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      ++++++|..   .  ..+++.|.+.......+   |-++|.+.+.=  +.  .+-++ -.++.+..++.+.-+  ..+|+
T Consensus        55 ~~~~ell~~---~--~iD~V~i~tp~~~h~~~~~~al~~gkhv~~E--KP~a~~~~e-~~~l~~~~~~~~~~~--~v~~~  124 (359)
T 3e18_A           55 ESYEAVLAD---E--KVDAVLIATPNDSHKELAISALEAGKHVVCE--KPVTMTSED-LLAIMDVAKRVNKHF--MVHQN  124 (359)
T ss_dssp             SCHHHHHHC---T--TCCEEEECSCGGGHHHHHHHHHHTTCEEEEE--SSCCSSHHH-HHHHHHHHHHHTCCE--EEECG
T ss_pred             CCHHHHHCC---C--CCCEEEECCCCHHHHHHHHHHHHCCCEEEEE--CCCCCHHHH-HHHHHHHHHHCCCCC--CCCCC
T ss_conf             999999559---9--9898998788055235678888539819995--786420878-878899997527654--22222


Q ss_pred             CCCCHHHHHH-------CCCCEEEEC
Q ss_conf             5488778632-------778479613
Q gi|254780911|r  170 QILSDHLCHK-------MTGRIINIH  188 (288)
Q Consensus       170 ril~~~~~~~-------~~~~iiNiH  188 (288)
                      +...|.+...       .=|++..+.
T Consensus       125 ~r~~p~~~~~k~~i~~g~iG~i~~i~  150 (359)
T 3e18_A          125 RRWDEDFLIIKEMFEQKTIGEMFHLE  150 (359)
T ss_dssp             GGGCHHHHHHHHHHHHTTTSSEEEEE
T ss_pred             CCCCCCCHHHHHHHHHCCCCCEEEEE
T ss_conf             11475220243321221478448999


No 124
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7
Probab=51.35  E-value=9.8  Score=17.46  Aligned_cols=60  Identities=15%  Similarity=0.337  Sum_probs=45.3

Q ss_pred             EEEEEEEEECCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEEEECCCCCCCC
Q ss_conf             622577530556888344444665188889999999999999999999999987691788688579808886763
Q gi|254780911|r  212 IGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY  286 (288)
Q Consensus       212 ~G~TvH~V~~~lD~GpII~Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~ktvvf~~~~~~~  286 (288)
                      --+|++|..  .-.-||+-|.++.|+.+++.+.+.+-.+   +++     +   .+.|++|=|-  .|-|+|.+.
T Consensus        12 ~KV~v~fk~--iG~aPilk~~k~ki~~~~~f~~vi~FLr---k~L-----k---~~slflYin~--sFaP~pDe~   71 (96)
T 1wz3_A           12 QKIVVHLRA--TGGAPILKQSKFKVSGSDKFANVIDFLR---RQL-----H---SDSLFVYVNS--AFSPNPDES   71 (96)
T ss_dssp             CEEEEEEEE--CTTCCCCSCCEEEEETTSBTHHHHHHHH---HHH-----T---CSSCEEEEEE--EECCCTTSB
T ss_pred             CEEEEEEEE--CCCCCCCCCCEEEECCCCCHHHHHHHHH---HHH-----C---CCCEEEEECC--CCCCCHHHH
T ss_conf             769999985--6898644364599788878899999999---986-----7---8828999887--307985789


No 125
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open active site loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A*
Probab=50.73  E-value=7.8  Score=18.16  Aligned_cols=16  Identities=13%  Similarity=0.112  Sum_probs=10.8

Q ss_pred             HHHHHHHCCCCEEECC
Q ss_conf             6777886099747416
Q gi|254780911|r  123 HKKLVENYQLPFYYLP  138 (288)
Q Consensus       123 ~~~lA~~~gIP~~~i~  138 (288)
                      +..+++..++|...-+
T Consensus       242 l~~la~~l~~Pv~~~~  257 (565)
T 2nxw_A          242 VAELAQRLGVPVVTTF  257 (565)
T ss_dssp             HHHHHHHHCSCEEECG
T ss_pred             HHHHHHHHCCCEEECC
T ss_conf             9999998679802034


No 126
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli}
Probab=50.45  E-value=8.2  Score=18.00  Aligned_cols=96  Identities=13%  Similarity=0.173  Sum_probs=48.2

Q ss_pred             CCCCCCCCEEEEECCCC--CCHHHHHHHHCCCCCEE-EEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHH---HHHHH
Q ss_conf             24456553899970886--79899998620467415-89999977346677788609974741687335277---67899
Q gi|254780911|r   78 RNTKEATKTLILVSQPD--HCLNDLLYRWNIGTLAL-NIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIE---SEQKL  151 (288)
Q Consensus        78 ~~~~~~~riailvSg~g--snL~~Ll~~~~~g~L~~-eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~---~e~~i  151 (288)
                      ...+++++|+||=||-|  +=|..|..+     +|. ++. -         +++..+.|     ....++++   +-.++
T Consensus        16 ~~~~~~p~IgvfDSGvGGLtVl~~l~~~-----lP~~~~i-Y---------~~D~a~~P-----YG~ks~~~i~~~~~~~   75 (285)
T 2jfn_A           16 TPSEPRPTVLVFDSGVGGLSVYDEIRHL-----LPDLHYI-Y---------AFDNVAFP-----YGEKSEAFIVERVVAI   75 (285)
T ss_dssp             ----CEEEEEEEESSSTHHHHHHHHHHH-----STTSEEE-E---------EECTTTCC-----TTTSCHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHH-----CCCCCEE-E---------EECCCCCC-----CCCCCHHHHHHHHHHH
T ss_conf             8789999589983883589999999987-----8999989-9---------95478799-----8999999999999999


Q ss_pred             HHH-HHHCCCEEEEECCCCC--CCCHHHHHHCCCCEEEECCCCCC
Q ss_conf             999-7333940999827675--48877863277847961336676
Q gi|254780911|r  152 INI-IEKNNVELMILARYMQ--ILSDHLCHKMTGRIINIHHSFLP  193 (288)
Q Consensus       152 l~~-l~~~~~DlivLAgymr--il~~~~~~~~~~~iiNiHpslLP  193 (288)
                      .+. ++++++|+||+|=---  ..-+.+-+.|+-.+|++=|+.-|
T Consensus        76 ~~~ll~k~g~~~IViACNTasa~a~~~L~~~~~~piigiip~~~~  120 (285)
T 2jfn_A           76 VTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP  120 (285)
T ss_dssp             HHHHHHHSCCSEEEECCHHHHHHHHHHHHHHCSSCEECCCCCHHH
T ss_pred             HHHHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCCEECCCHHHHH
T ss_conf             999986067768996064778998999998739981234489999


No 127
>1zvp_A Hypothetical protein VC0802; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Vibrio cholerae} SCOP: d.58.18.9 d.58.18.9
Probab=50.10  E-value=12  Score=16.82  Aligned_cols=23  Identities=9%  Similarity=0.251  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             67899999733394099982767
Q gi|254780911|r  147 SEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus       147 ~e~~il~~l~~~~~DlivLAgym  169 (288)
                      .-+++...|.+.++-.-+.++|-
T Consensus        87 l~A~is~~La~~~is~~~vst~~  109 (133)
T 1zvp_A           87 LTAAFATKLAEHGISANVIAGYY  109 (133)
T ss_dssp             HHHHHHHHHHHTTCCCEEEECSS
T ss_pred             HHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             69999899987799759977330


No 128
>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Geobacillus stearothermophilus} SCOP: c.89.1.1 PDB: 4pfk_A* 6pfk_A 1mto_A*
Probab=49.31  E-value=13  Score=16.65  Aligned_cols=25  Identities=8%  Similarity=0.060  Sum_probs=21.7

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHH
Q ss_conf             9649999985998766888999998
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLS   25 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La   25 (288)
                      |++.-+..++-|.||+=+.+.+++-
T Consensus         1 mkrIaIltsGG~~pG~Na~i~~~v~   25 (319)
T 3pfk_A            1 MKRIGVLTSGGDSPGMNAAIRSVVR   25 (319)
T ss_dssp             CCEEEEEEESSCCTTHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9889998868875779999999999


No 129
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A*
Probab=49.30  E-value=8.6  Score=17.86  Aligned_cols=96  Identities=10%  Similarity=0.064  Sum_probs=47.0

Q ss_pred             CCCCCCHHHHHHHHCCCCCEEEEEEEEECC--HHHHHHHHHCCCCEEECCCCC----CC--------HHHHHHHHHHHHH
Q ss_conf             088679899998620467415899999773--466777886099747416873----35--------2776789999973
Q gi|254780911|r   91 SQPDHCLNDLLYRWNIGTLALNIVGVVSNH--TTHKKLVENYQLPFYYLPMTE----QN--------KIESEQKLINIIE  156 (288)
Q Consensus        91 Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN~--~d~~~lA~~~gIP~~~i~~~~----~~--------k~~~e~~il~~l~  156 (288)
                      +....++..++......+-+.-+...-+.+  +.+..+++..++|....+..+    ++        ...........+.
T Consensus       185 ~~~~~~~~~~~~~l~~a~~pvi~~G~~~~~~~~el~~~ae~~~~pv~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~  264 (549)
T 3eya_A          185 TPEEEELRKLAQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHVEYDNPYDVGMTGLIGFSSGFHTMM  264 (549)
T ss_dssp             ECCHHHHHHHHHHHHTCCSEEEEECGGGTTCHHHHHHHHHHHTCCEEECGGGHHHHSSSCTTBCCCCSTTSCHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             98999999999998507898899816655269999999986579832202346668887864467667767478877652


Q ss_pred             HCCCEEEEECCCCCCCCHHHHHHCCCCEEEECCC
Q ss_conf             3394099982767548877863277847961336
Q gi|254780911|r  157 KNNVELMILARYMQILSDHLCHKMTGRIINIHHS  190 (288)
Q Consensus       157 ~~~~DlivLAgymril~~~~~~~~~~~iiNiHps  190 (288)
                        +.|++++-|- + ++......+..|+|.|...
T Consensus       265 --~~d~~l~iG~-~-~~~~~~~~~~~kvi~id~d  294 (549)
T 3eya_A          265 --NADTLVLLGT-Q-FPYRAFYPTDAKIIQIDIN  294 (549)
T ss_dssp             --HCSEEEEESC-C-CCCGGGSCSSSEEEEEESC
T ss_pred             --CCCEEEEEEE-C-CCCCCCCCCCCCEEEEECC
T ss_conf             --2666999840-3-6754556788828999799


No 130
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV}
Probab=49.18  E-value=13  Score=16.63  Aligned_cols=26  Identities=15%  Similarity=0.038  Sum_probs=11.9

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHHH
Q ss_conf             9999973339409998276754887786
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHLC  177 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~~  177 (288)
                      +|.++.+++++-  ++-+|++...|.+.
T Consensus       127 ~l~~~a~~~~~~--~~v~~~~R~~p~~~  152 (398)
T 3dty_A          127 NLRELSHKHNRI--VGVTYGYAGHQLIE  152 (398)
T ss_dssp             HHHHHHHHTTCC--EEECCGGGGSHHHH
T ss_pred             HHHHHHHHCCCE--EEEEEECCCCHHHH
T ss_conf             999988633966--99985013572789


No 131
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A
Probab=48.43  E-value=13  Score=16.56  Aligned_cols=44  Identities=14%  Similarity=0.415  Sum_probs=34.4

Q ss_pred             CCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCC
Q ss_conf             886798999986204674158999997734667778860997474168
Q gi|254780911|r   92 QPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPM  139 (288)
Q Consensus        92 g~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~  139 (288)
                      |.-+|++-|..|.  |. ++.. +||++..+-...|+..+.||.-|+.
T Consensus       215 GKesCFerI~~RF--G~-k~ty-vvIGDG~dEe~AAk~l~~PFwrI~s  258 (274)
T 3geb_A          215 GKESCFERIMQRF--GR-KAVY-VVIGDGVEEEQGAKKHNMPFWRISC  258 (274)
T ss_dssp             CHHHHHHHHHHHH--CT-TSEE-EEEESSHHHHHHHHHTTCCEEECCS
T ss_pred             CHHHHHHHHHHHH--CC-CCEE-EEECCCHHHHHHHHHCCCCEEEECC
T ss_conf             6899999999986--89-8569-9978976799999962998588027


No 132
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis}
Probab=48.30  E-value=1.5  Score=23.11  Aligned_cols=76  Identities=14%  Similarity=0.124  Sum_probs=35.0

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEEC---CHHHHHHHHHCCCCEEECCCCCC-----CHHH----HHHH--HHHHHHHCCC
Q ss_conf             7989999862046741589999977---34667778860997474168733-----5277----6789--9999733394
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSN---HTTHKKLVENYQLPFYYLPMTEQ-----NKIE----SEQK--LINIIEKNNV  160 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN---~~d~~~lA~~~gIP~~~i~~~~~-----~k~~----~e~~--il~~l~~~~~  160 (288)
                      ..+..+.+.....+-+.=|+.-...   .+.+..+|+..++|...-+....     +...    +...  -.........
T Consensus       231 ~~~~~~~~~l~~akrpvii~G~~~~~~~~~~~~~lae~~~~pv~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  310 (604)
T 2x7j_A          231 ESLSDVAEMLAEAEKGMIVCGELHSDADKENIIALSKALQYPILADPLSNLRNGVHDKSTVIDAYDSFLKDDELKRKLRP  310 (604)
T ss_dssp             GGGHHHHHHHHHCSSEEEEECCCCCHHHHHHHHHHHHHHTCCEEECGGGTTTBSSSCCTTEECCHHHHTTSHHHHHHHCC
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHCCC
T ss_conf             99999999997278989996573306568898878987526541112236666788874203345422126888852465


Q ss_pred             EEEEECCCCC
Q ss_conf             0999827675
Q gi|254780911|r  161 ELMILARYMQ  170 (288)
Q Consensus       161 DlivLAgymr  170 (288)
                      |+++..|..-
T Consensus       311 d~vi~~g~~~  320 (604)
T 2x7j_A          311 DVVIRFGPMP  320 (604)
T ss_dssp             SEEEEESSCC
T ss_pred             EEEEEECCCC
T ss_conf             1999935777


No 133
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum 3D7} SCOP: c.2.1.4 c.23.12.3
Probab=47.88  E-value=14  Score=16.50  Aligned_cols=58  Identities=9%  Similarity=0.024  Sum_probs=44.0

Q ss_pred             CCEEEEEEEEEC----CHHH-HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHH-----HCCCEEEEECC
Q ss_conf             741589999977----3466-777886099747416873352776789999973-----33940999827
Q gi|254780911|r  108 TLALNIVGVVSN----HTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIE-----KNNVELMILAR  167 (288)
Q Consensus       108 ~L~~eI~~VISN----~~d~-~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~-----~~~~DlivLAg  167 (288)
                      .+-|+|...-||    +++. ..|++..|||.+  -++.++.++|...+.+.|.     +.+||+|+=-|
T Consensus        68 ~~GAeV~~~~cNp~STQDdvAAAL~~~~Gi~Vf--A~kget~eey~~~~~~~L~~~~~~d~~P~iiiDDG  135 (479)
T 1v8b_A           68 KLGAQIRWCSCNIYSTADYAAAAVSTLENVTVF--AWKNETLEEYWWCVESALTWGDGDDNGPDMIVDDG  135 (479)
T ss_dssp             HTTCEEEEECSSSSCCCHHHHHHHTTSTTEEEE--CCTTCCHHHHHHHHHHHHCCSSSSSCSCSEEEESS
T ss_pred             HCCCEEEEEECCCCCCCHHHHHHHHHHCCCEEE--EECCCCHHHHHHHHHHHHHCCCCCCCCCCEEEECC
T ss_conf             869869998689764468999999861793699--97899989999999998617888778997898055


No 134
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A*
Probab=47.87  E-value=8.5  Score=17.90  Aligned_cols=68  Identities=6%  Similarity=0.044  Sum_probs=31.2

Q ss_pred             HHHHHHHHHCCCCEEECCCCC----CCH--------HHHHHHHHHHHHHCCCEEEEECCCC--CCCCHHHHHHCCCCEEE
Q ss_conf             466777886099747416873----352--------7767899999733394099982767--54887786327784796
Q gi|254780911|r  121 TTHKKLVENYQLPFYYLPMTE----QNK--------IESEQKLINIIEKNNVELMILARYM--QILSDHLCHKMTGRIIN  186 (288)
Q Consensus       121 ~d~~~lA~~~gIP~~~i~~~~----~~k--------~~~e~~il~~l~~~~~DlivLAgym--ril~~~~~~~~~~~iiN  186 (288)
                      +.+..+|+..|+|...-+..+    ++.        ..........+.  +.|+++.-|.-  ..-+.........++|.
T Consensus       223 ~~l~~lae~~~~PV~~t~~~~g~~~~~~~~~~g~~g~~~~~~~~~~~~--~~dlii~~G~~l~~~~~~~~~~~~~~~~i~  300 (589)
T 2pgn_A          223 EALLKLAEMVGVPVVTTSTGAGVFPETHALAMGSAGFCGWKSANDMMA--AADFVLVLGSRLSDWGIAQGYITKMPKFVH  300 (589)
T ss_dssp             HHHHHHHHHHTCCEEECTTTTTSSCTTSTTEEEECSTTSCHHHHHHHH--HCSEEEEESCCCCTTTTTTTTTCCCCSEEE
T ss_pred             HHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH--HCCEEEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             999999999797978545677766860013567767767899999986--306067732557755566765568862489


Q ss_pred             ECCC
Q ss_conf             1336
Q gi|254780911|r  187 IHHS  190 (288)
Q Consensus       187 iHps  190 (288)
                      +...
T Consensus       301 i~~d  304 (589)
T 2pgn_A          301 VDTD  304 (589)
T ss_dssp             EESC
T ss_pred             EECC
T ss_conf             8258


No 135
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum ms-1}
Probab=47.85  E-value=14  Score=16.50  Aligned_cols=74  Identities=9%  Similarity=0.039  Sum_probs=41.5

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHH---HHHHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             798999986204674158999997734667---77886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHK---KLVENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      +++.+++..     -+++.+.|.+......   ..|-++|++.+.  -+.  .+-++. .++.++.++.++  .+..||+
T Consensus        59 ~~~~ell~~-----~~~D~V~I~tp~~~H~~~~~~al~~gk~V~~--EKPl~~~~~e~-~~l~~~~~~~~~--~~~v~~~  128 (315)
T 3c1a_A           59 SDWRSVVSA-----PEVEAVIIATPPATHAEITLAAIASGKAVLV--EKPLTLDLAEA-EAVAAAAKATGV--MVWVEHT  128 (315)
T ss_dssp             SSTHHHHTC-----TTCCEEEEESCGGGHHHHHHHHHHTTCEEEE--ESSSCSCHHHH-HHHHHHHHHHCC--CEEEECG
T ss_pred             CCHHHHHCC-----CCCCEEEECCCHHHHHHHHHHHHHHCCCHHC--CCCCCCHHHHH-HHHHHHHHHCCC--CCCCCCC
T ss_conf             999999559-----9999899928788879999999961322113--89821114678-888888764143--3312532


Q ss_pred             CCCCHHHHH
Q ss_conf             548877863
Q gi|254780911|r  170 QILSDHLCH  178 (288)
Q Consensus       170 ril~~~~~~  178 (288)
                      +-..|.+..
T Consensus       129 ~r~~~~~~~  137 (315)
T 3c1a_A          129 QLFNPAWEA  137 (315)
T ss_dssp             GGGCHHHHH
T ss_pred             CCCCHHHHH
T ss_conf             234878999


No 136
>1pq4_A Periplasmic binding protein component of AN ABC type zinc uptake transporter; ZNUA, loop, metal-binding, metal binding protein; 1.90A {Synechocystis SP} SCOP: c.92.2.2 PDB: 2ov3_A 2ov1_A
Probab=47.84  E-value=14  Score=16.50  Aligned_cols=51  Identities=14%  Similarity=0.250  Sum_probs=27.4

Q ss_pred             EEEECCHHHHHHHHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             999773466777886099747416873-352776789999973339409998
Q gi|254780911|r  115 GVVSNHTTHKKLVENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMIL  165 (288)
Q Consensus       115 ~VISN~~d~~~lA~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~DlivL  165 (288)
                      .+++-|+...-+++++|+....+-... +.....=+++.+.+++.++.+|+.
T Consensus       192 ~~v~~H~a~~Y~~~~~gl~~~~~~~~~~eps~~~l~~~~~~ik~~~i~~if~  243 (291)
T 1pq4_A          192 KFIVFHPSWAYFARDYNLVQIPIEVEGQEPSAQELKQLIDTAKENNLTMVFG  243 (291)
T ss_dssp             EEEESSCCCHHHHHHTTCEEEESCBTTBCCCHHHHHHHHHHHHTTTCCEEEE
T ss_pred             CCCCCCCHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             7545573478999966981665125788999899999999999749988997


No 137
>3cx3_A Lipoprotein; zinc-binding, transport, lipid binding protein, metal binding protein; 2.40A {Streptococcus pneumoniae}
Probab=47.80  E-value=14  Score=16.49  Aligned_cols=50  Identities=12%  Similarity=0.234  Sum_probs=20.9

Q ss_pred             EEECCHHHHHHHHHCCCCEEECC-CCC--CCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             99773466777886099747416-873--352776789999973339409998
Q gi|254780911|r  116 VVSNHTTHKKLVENYQLPFYYLP-MTE--QNKIESEQKLINIIEKNNVELMIL  165 (288)
Q Consensus       116 VISN~~d~~~lA~~~gIP~~~i~-~~~--~~k~~~e~~il~~l~~~~~DlivL  165 (288)
                      +|+-|+...-+++++|+....+. ...  +-....=.++.+.+++.++.+|+.
T Consensus       180 ~v~~h~a~~Y~~~~~gl~~~~~~~~~~~~~ps~~~l~~l~~~ik~~~v~~if~  232 (284)
T 3cx3_A          180 FVTQHTAFSYLAKRFGLNQLGIAGISPEQEPSPRQLTEIQEFVKTYKVKTIFT  232 (284)
T ss_dssp             EEEEESCCHHHHHHTTCCEEEEECSSTTCCCCSHHHHHHHHHHHHTTCCCEEE
T ss_pred             EEEECCHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             58866127999998799444411125655422889999999998559978998


No 138
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6
Probab=47.67  E-value=13  Score=16.73  Aligned_cols=16  Identities=6%  Similarity=0.272  Sum_probs=9.3

Q ss_pred             HHHCCCCEEECCCCCC
Q ss_conf             8860997474168733
Q gi|254780911|r  127 VENYQLPFYYLPMTEQ  142 (288)
Q Consensus       127 A~~~gIP~~~i~~~~~  142 (288)
                      .++.++|.++++-+.+
T Consensus        85 ~~~~~~~~~~i~GNHD  100 (260)
T 2yvt_A           85 IGELGVKTFVVPGKND  100 (260)
T ss_dssp             HHTTCSEEEEECCTTS
T ss_pred             HHHCCCCEEEECCCCC
T ss_conf             9855996388628861


No 139
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A*
Probab=47.66  E-value=5.5  Score=19.20  Aligned_cols=47  Identities=21%  Similarity=0.298  Sum_probs=25.0

Q ss_pred             HHHHHHHHCCCCEEECCCCCC----C---------HHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             667778860997474168733----5---------277678999997333940999827675
Q gi|254780911|r  122 THKKLVENYQLPFYYLPMTEQ----N---------KIESEQKLINIIEKNNVELMILARYMQ  170 (288)
Q Consensus       122 d~~~lA~~~gIP~~~i~~~~~----~---------k~~~e~~il~~l~~~~~DlivLAgymr  170 (288)
                      .+..+|+..++|...-+....    +         ...........+.  ++|+++..|.+.
T Consensus       247 ~l~~lae~~~~Pv~~t~~~~~~~~~~~p~~~g~~~~~~~~~~~~~~~~--~~D~ii~iG~~~  306 (570)
T 2vbf_A          247 TVTQFVSETKLPITTLNFGKSAVDESLPSFLGIYNGKLSEISLKNFVE--SADFILMLGVKL  306 (570)
T ss_dssp             HHHHHHHHHCCCEEECSTTTTSSCTTSTTEEEECCGGGSCHHHHHHHH--HCSEEEEESCCC
T ss_pred             HHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCEEEEEECCC
T ss_conf             899987621786340354356556788777765445545533112455--774256874115


No 140
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase; 2.09A {Bartonella henselae str} PDB: 3enn_A 3emk_A
Probab=47.02  E-value=14  Score=16.41  Aligned_cols=140  Identities=12%  Similarity=0.082  Sum_probs=70.1

Q ss_pred             EEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHC-CCEEEE-
Q ss_conf             999708867989999862046741589999977346677788609974741687335277678999997333-940999-
Q gi|254780911|r   87 LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN-NVELMI-  164 (288)
Q Consensus        87 ailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~-~~Dliv-  164 (288)
                      .++++|.++.+..=+-+ +--+-.++|.++=.|.+.+..++++.|-....+..+-.+.++.++-+-++.+++ .+|.+| 
T Consensus        29 ~alVTGas~GIG~aia~-~la~~Ga~V~i~~r~~~~l~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~g~iDiLVn  107 (266)
T 3grp_A           29 KALVTGATGGIGEAIAR-CFHAQGAIVGLHGTREDKLKEIAADLGKDVFVFSANLSDRKSIKQLAEVAEREMEGIDILVN  107 (266)
T ss_dssp             EEEESSTTSHHHHHHHH-HHHHTTCEEEEEESCHHHHHHHHHHHCSSEEEEECCTTSHHHHHHHHHHHHHHHTSCCEEEE
T ss_pred             EEEEECCCCHHHHHHHH-HHHHCCCEEEEEECCHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             89993878689999999-99987999999979999999999983997799990179999999999999998099839998


Q ss_pred             ECCCCCC----------------------------CCHHHHHHCCCCEEEECC--CCCCCCCCCCHH---HHHHHCCC--
Q ss_conf             8276754----------------------------887786327784796133--667678999958---99974268--
Q gi|254780911|r  165 LARYMQI----------------------------LSDHLCHKMTGRIINIHH--SFLPSFKGANPY---KQAYEYGV--  209 (288)
Q Consensus       165 LAgymri----------------------------l~~~~~~~~~~~iiNiHp--slLP~f~G~~~y---~~A~~~Gv--  209 (288)
                      .||....                            +-|.+.++=.|+||||=-  +..| ++|..+|   +.|+..=.  
T Consensus       108 nAg~~~~~~~~~~~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IInisS~~~~~~-~~~~~~Y~asKaal~~ltk~  186 (266)
T 3grp_A          108 NAGITRDGLFVRMQDQDWDDVLAVNLTAASTLTRELIHSMMRRRYGRIINITSIVGVVG-NPGQTNYCAAKAGLIGFSKA  186 (266)
T ss_dssp             CCCCC-----CCCHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCC--------CHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-CCCCHHHHHHHHHHHHHHHH
T ss_conf             99679998735489999999999862589999999999998759928999877665478-99977999999999999999


Q ss_pred             -----CEEEEEEEEEECCCCCCCE
Q ss_conf             -----3762257753055688834
Q gi|254780911|r  210 -----KIIGATAHYAICELDAGPI  228 (288)
Q Consensus       210 -----k~~G~TvH~V~~~lD~GpI  228 (288)
                           .-.|.+|.-|.++.=.-|.
T Consensus       187 lA~ela~~gIrVN~I~PG~v~T~~  210 (266)
T 3grp_A          187 LAQEIASRNITVNCIAPGFIKSAM  210 (266)
T ss_dssp             HHHHHGGGTEEEEEEEECSBCSHH
T ss_pred             HHHHHCCCCEEEEEEEECCCCCCC
T ss_conf             999966249289999608888720


No 141
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3afa_C 3a6n_C 2cv5_C* 3c1b_C* 3c1c_C* 3lja_C 1zbb_C 3kxb_C 2fj7_C 1m19_C 1m18_C 1m1a_C 1p34_C 1p3a_C 1p3b_C ...
Probab=46.46  E-value=4.2  Score=20.02  Aligned_cols=18  Identities=28%  Similarity=0.420  Sum_probs=13.5

Q ss_pred             CCCEEEECCCCCCCCCCC
Q ss_conf             784796133667678999
Q gi|254780911|r  181 TGRIINIHHSFLPSFKGA  198 (288)
Q Consensus       181 ~~~iiNiHpslLP~f~G~  198 (288)
                      .|-+=||||+|||+=.+.
T Consensus       106 GGV~P~Ih~~Ll~kk~~~  123 (129)
T 1tzy_A          106 GGVLPNIQAVLLPKKTDS  123 (129)
T ss_dssp             CCCCCCCCGGGSCC----
T ss_pred             CCCCCCCCHHHCCCCCCC
T ss_conf             871775067665886666


No 142
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A*
Probab=46.39  E-value=14  Score=16.45  Aligned_cols=42  Identities=10%  Similarity=0.073  Sum_probs=17.8

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECC--HHHHHHHHHCCCCEEEC
Q ss_conf             9899998620467415899999773--46677788609974741
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNH--TTHKKLVENYQLPFYYL  137 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~--~d~~~lA~~~gIP~~~i  137 (288)
                      .+..+.+.....+=|.=++.+-...  .....+++..++|...-
T Consensus       194 ~i~~~~~~L~~akrPvIv~G~~~~~~~~~~~~~~~~~~~pv~~t  237 (590)
T 1v5e_A          194 DIDAAVELLNNSKRPVIYAGIGTMGHGPAVQELARKIKAPVITT  237 (590)
T ss_dssp             HHHHHHHHHHHCSSEEEEECGGGTTCHHHHHHHHHHHTCCEEEC
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCCCCEEC
T ss_conf             99999999985799789996064323699999986236860100


No 143
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes}
Probab=46.33  E-value=10  Score=17.39  Aligned_cols=75  Identities=16%  Similarity=0.204  Sum_probs=37.5

Q ss_pred             HHHHHHHHCCCCEEECCCCC-----CCH----HHHHH--HHHHHHHHCCCEEEEECCCCCCCC--HHHHHHCC-CCEEEE
Q ss_conf             66777886099747416873-----352----77678--999997333940999827675488--77863277-847961
Q gi|254780911|r  122 THKKLVENYQLPFYYLPMTE-----QNK----IESEQ--KLINIIEKNNVELMILARYMQILS--DHLCHKMT-GRIINI  187 (288)
Q Consensus       122 d~~~lA~~~gIP~~~i~~~~-----~~k----~~~e~--~il~~l~~~~~DlivLAgymril~--~~~~~~~~-~~iiNi  187 (288)
                      .+..+|+..++|...-+...     ...    ..+..  .-.......+.|+++..|.+-.-.  ..+...++ .++|.+
T Consensus       241 ~l~~lae~l~~pv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~aD~vl~lG~~~~~~~~~~~~~~~~~~~~i~v  320 (578)
T 3lq1_A          241 PMVDLAKKLGWPILADPLSGLRSYGALDEVVIDQYDAFLKEAEIIDKLTPEVVIRFGSMPVSKPLKNWLEQLSDIRFYVV  320 (578)
T ss_dssp             HHHHHHHHHTCCEEECGGGSTTSBSSCCSSEECCHHHHTTSHHHHHHTCCSEEEEESSCCSCHHHHHHHHHCCSSEEEEE
T ss_pred             HHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             99999985177603213346666776544335642100468988624587889997886655444565545542048996


Q ss_pred             CCCCCCCCCCC
Q ss_conf             33667678999
Q gi|254780911|r  188 HHSFLPSFKGA  198 (288)
Q Consensus       188 HpslLP~f~G~  198 (288)
                      ++.  |...+.
T Consensus       321 d~~--~~~~~~  329 (578)
T 3lq1_A          321 DPG--AAWKDP  329 (578)
T ss_dssp             CTT--CCCCCT
T ss_pred             CCC--HHHCCC
T ss_conf             485--211366


No 144
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein structure initiative; 2.66A {Mycobacterium tuberculosis CDC1551} SCOP: c.2.1.1
Probab=46.19  E-value=14  Score=16.33  Aligned_cols=94  Identities=6%  Similarity=0.154  Sum_probs=50.7

Q ss_pred             EEEEECCCCC-CHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEE
Q ss_conf             8999708867-989999862046741589999977346677788609974741687335277678999997333940999
Q gi|254780911|r   86 TLILVSQPDH-CLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMI  164 (288)
Q Consensus        86 iailvSg~gs-nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dliv  164 (288)
                      =-|++.|.++ .-...+...+.  +.+.+..+.++.+. ...+++.|... .++.++   +++.+++.+.....++|+++
T Consensus        40 ~~VlV~ga~g~vG~~~iq~a~~--~g~~vi~~~~~~~~-~~~~k~~Ga~~-vi~~~~---~~~~~~i~~~t~~~g~D~v~  112 (198)
T 1pqw_A           40 ERVLIHSATGGVGMAAVSIAKM--IGARIYTTAGSDAK-REMLSRLGVEY-VGDSRS---VDFADEILELTDGYGVDVVL  112 (198)
T ss_dssp             CEEEETTTTSHHHHHHHHHHHH--HTCEEEEEESSHHH-HHHHHTTCCSE-EEETTC---STHHHHHHHHTTTCCEEEEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHH--CCCEEEEECCCHHH-HHHHCCCCCEE-EEECCC---CCHHHHHHHHHCCCCEEEEE
T ss_conf             8589985756686999998874--49648986265799-98740568708-998999---78999999984898727998


Q ss_pred             ECCCCCCCCHHHHH--HCCCCEEEE
Q ss_conf             82767548877863--277847961
Q gi|254780911|r  165 LARYMQILSDHLCH--KMTGRIINI  187 (288)
Q Consensus       165 LAgymril~~~~~~--~~~~~iiNi  187 (288)
                      -.---..+.. .++  +..|+++++
T Consensus       113 d~vg~~~~~~-~~~~l~~~G~~v~~  136 (198)
T 1pqw_A          113 NSLAGEAIQR-GVQILAPGGRFIEL  136 (198)
T ss_dssp             ECCCTHHHHH-HHHTEEEEEEEEEC
T ss_pred             ECCCHHHHHH-HHHHHCCCCEEEEE
T ss_conf             3576899999-99986699789999


No 145
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3
Probab=45.93  E-value=14  Score=16.30  Aligned_cols=81  Identities=9%  Similarity=0.045  Sum_probs=45.5

Q ss_pred             EEEEECCCCC-CHHHHHHHHCCCCCEEEEEEEEECCH---HHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             8999708867-98999986204674158999997734---6677788609974741687335277678999997333940
Q gi|254780911|r   86 TLILVSQPDH-CLNDLLYRWNIGTLALNIVGVVSNHT---THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVE  161 (288)
Q Consensus        86 iailvSg~gs-nL~~Ll~~~~~g~L~~eI~~VISN~~---d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~D  161 (288)
                      -.++.+|.|| .++.++...-...=+.+-++|++|-.   ....+|+.+|+....+...+..+.-.-+++.+.+.+.+++
T Consensus        60 ~~i~~~gsgT~a~e~~~~~l~~~~~~gd~vlv~~~G~~~~~~~~~a~~~g~~~~~~~~~~~g~~~~~~~i~~~l~~~~~~  139 (385)
T 2bkw_A           60 QPFVLAGSGTLGWDIFASNFILSKAPNKNVLVVSTGTFSDRFADCLRSYGAQVDVVRPLKIGESVPLELITEKLSQNSYG  139 (385)
T ss_dssp             EEEEEESCTTHHHHHHHHHHSCTTCSCCEEEEECSSHHHHHHHHHHHHTTCEEEEECCSSTTSCCCHHHHHHHHHHSCCS
T ss_pred             EEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHCCCCE
T ss_conf             29999086899999999986114589998999847677699999999609713322567789989999999987659962


Q ss_pred             EEEEC
Q ss_conf             99982
Q gi|254780911|r  162 LMILA  166 (288)
Q Consensus       162 livLA  166 (288)
                      +|.+.
T Consensus       140 ~v~~~  144 (385)
T 2bkw_A          140 AVTVT  144 (385)
T ss_dssp             EEEEE
T ss_pred             EEEEE
T ss_conf             99996


No 146
>2is8_A Molybdopterin biosynthesis enzyme, MOAB; globular alpha/beta fold, structural genomics, NPPSFA; 1.64A {Thermus thermophilus HB8}
Probab=45.29  E-value=15  Score=16.23  Aligned_cols=68  Identities=4%  Similarity=0.028  Sum_probs=40.2

Q ss_pred             HHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCC----CCHHHHHHCCCCEEEEC
Q ss_conf             466777886099747416873352776789999973339409998276754----88778632778479613
Q gi|254780911|r  121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQI----LSDHLCHKMTGRIINIH  188 (288)
Q Consensus       121 ~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAgymri----l~~~~~~~~~~~iiNiH  188 (288)
                      +-+..+-++.|.......+-.+++++-.+.+.+.+...+.|+|+..|=.-.    ++++-+..+-+|.+..+
T Consensus        24 ~~l~~~L~~~G~~v~~~~iv~Dd~~~i~~~l~~~~~~~~~DlVittGG~g~~~~D~t~~ai~~~~~~~~~g~   95 (164)
T 2is8_A           24 LAIREVLAGGPFEVAAYELVPDEPPMIKKVLRLWADREGLDLILTNGGTGLAPRDRTPEATRELLDREVPGL   95 (164)
T ss_dssp             HHHHHHHTTSSEEEEEEEEECSCHHHHHHHHHHHHHTSCCSEEEEESCCSSSTTCCHHHHHHTTCSEECHHH
T ss_pred             HHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCCCCH
T ss_conf             999999996899898999979888999999999984549868996786138998565888999856657655


No 147
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2
Probab=45.12  E-value=15  Score=16.22  Aligned_cols=50  Identities=14%  Similarity=0.036  Sum_probs=25.9

Q ss_pred             HHHHHHCCCCEEEECCCCCCCCCCCCHH---HHHHHC-------CCCEEEEEEEEEECCC
Q ss_conf             7786327784796133667678999958---999742-------6837622577530556
Q gi|254780911|r  174 DHLCHKMTGRIINIHHSFLPSFKGANPY---KQAYEY-------GVKIIGATAHYAICEL  223 (288)
Q Consensus       174 ~~~~~~~~~~iiNiHpslLP~f~G~~~y---~~A~~~-------Gvk~~G~TvH~V~~~l  223 (288)
                      |.+.++-.++|||+=-+-.-.++|..+|   +.|+..       -..-.|.+|.-|.++.
T Consensus       144 ~~m~~~~~g~Ii~is~~~~~~~~~~~~Y~asKaal~~ltk~lA~ela~~gIrVN~I~PG~  203 (303)
T 1yxm_A          144 SSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGV  203 (303)
T ss_dssp             HHTHHHHCEEEEEECCCCTTCCTTCHHHHHHHHHHHHHHHHHHHHTGGGTEEEEEEEECS
T ss_pred             HHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCC
T ss_conf             765125996799996752258987399999999999999999999635093899985188


No 148
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C
Probab=44.15  E-value=5.1  Score=19.45  Aligned_cols=17  Identities=35%  Similarity=0.569  Sum_probs=13.1

Q ss_pred             CCCEEEECCCCCCCCCC
Q ss_conf             78479613366767899
Q gi|254780911|r  181 TGRIINIHHSFLPSFKG  197 (288)
Q Consensus       181 ~~~iiNiHpslLP~f~G  197 (288)
                      .|-+=||||+|||+=.|
T Consensus       103 GGv~P~Ih~~ll~KK~~  119 (120)
T 2f8n_G          103 GGVLPNIHPELLAKKRG  119 (120)
T ss_dssp             CCCCCCCCGGGSCCC--
T ss_pred             CCCCCCCCHHHCCCCCC
T ss_conf             96158859877377668


No 149
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A*
Probab=43.98  E-value=15  Score=16.10  Aligned_cols=53  Identities=15%  Similarity=0.059  Sum_probs=30.6

Q ss_pred             CCCCCCCEEEEECCC-CCCHHHHHHHHCCCCCEEEEEEEEECCH-HHHHHHHHCCCCE
Q ss_conf             445655389997088-6798999986204674158999997734-6677788609974
Q gi|254780911|r   79 NTKEATKTLILVSQP-DHCLNDLLYRWNIGTLALNIVGVVSNHT-THKKLVENYQLPF  134 (288)
Q Consensus        79 ~~~~~~riailvSg~-gsnL~~Ll~~~~~g~L~~eI~~VISN~~-d~~~lA~~~gIP~  134 (288)
                      ..++|.|++|...|. |.  ..++.+...- =+++|+.|.+-.+ .+..+++++|++.
T Consensus        79 ~~~~~i~v~iiG~G~~g~--~~~~~~~~~~-~~~~lvav~d~~~~~a~~~~~~~~~~~  133 (433)
T 1h6d_A           79 PEDRRFGYAIVGLGKYAL--NQILPGFAGC-QHSRIEALVSGNAEKAKIVAAEYGVDP  133 (433)
T ss_dssp             CCCCCEEEEEECCSHHHH--HTHHHHTTTC-SSEEEEEEECSCHHHHHHHHHHTTCCG
T ss_pred             CCCCCEEEEEEECHHHHH--HHHHHHHHHC-CCCEEEEEEECCHHHHHHHHHHHCCCC
T ss_conf             999806899990819999--9999999729-997899999299999999999719983


No 150
>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} SCOP: c.89.1.1 PDB: 2pfk_A
Probab=43.61  E-value=16  Score=16.06  Aligned_cols=31  Identities=10%  Similarity=0.158  Sum_probs=22.6

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHH---HCCCCE
Q ss_conf             9649999985998766888999998---579818
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLS---TQGCNI   31 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La---~~g~NI   31 (288)
                      |++.=+..++-|-||+=|.+.+++-   .+|..+
T Consensus         2 ~krIgIltsGG~~pG~Na~i~~~v~~a~~~g~~v   35 (320)
T 1pfk_A            2 IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEV   35 (320)
T ss_dssp             CCEEEEEECSSCCTTHHHHHHHHHHHHHHTTCEE
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEE
T ss_conf             8649998658886778999999999998779999


No 151
>1y5e_A Molybdenum cofactor biosynthesis protein B; structural genomics, protein structure initiative, PSI, MCSG, midwest center for structural genomics; 1.90A {Bacillus cereus} SCOP: c.57.1.1
Probab=43.48  E-value=16  Score=16.05  Aligned_cols=67  Identities=7%  Similarity=0.073  Sum_probs=45.6

Q ss_pred             ECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCC----CCCCHHHHHHCCCCE
Q ss_conf             7734667778860997474168733527767899999733394099982767----548877863277847
Q gi|254780911|r  118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYM----QILSDHLCHKMTGRI  184 (288)
Q Consensus       118 SN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAgym----ril~~~~~~~~~~~i  184 (288)
                      +|-+-+..+.+++|.......+-.++++...+++.+.+...+.|+|+..|=.    +=++++.++....+.
T Consensus        31 ~nGp~L~~~l~~~G~~v~~~~iv~Dd~~~i~~~~~~~~~~~~~dvIiT~GGtg~g~~D~t~~~~~~~~~~~  101 (169)
T 1y5e_A           31 KSGQLLHELLKEAGHKVTSYEIVKDDKESIQQAVLAGYHKEDVDVVLTNGGTGITKRDVTIEAVSALLDKE  101 (169)
T ss_dssp             HHHHHHHHHHHHHTCEEEEEEEECSSHHHHHHHHHHHHTCTTCSEEEEECCCSSSTTCCHHHHHHTTCSEE
T ss_pred             CHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCHHHHHHHHCCCC
T ss_conf             50999999999779977898745897999999999998656983899734414775342799997611343


No 152
>2f48_A Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} SCOP: c.89.1.1 PDB: 1kzh_A*
Probab=42.04  E-value=16  Score=15.90  Aligned_cols=112  Identities=11%  Similarity=0.011  Sum_probs=50.9

Q ss_pred             CHHHHHHHHHHHHCCCCCCE----ECCCCCCCCCEEEEECCCCC-CHHHHHHHH----CCCCCEEEEEEEE---------
Q ss_conf             52777988898740023202----01244565538999708867-989999862----0467415899999---------
Q gi|254780911|r   56 CMKLFIADFQPIVQQFSLQY----SIRNTKEATKTLILVSQPDH-CLNDLLYRW----NIGTLALNIVGVV---------  117 (288)
Q Consensus        56 ~~~~l~~~f~~ia~~~~m~~----~i~~~~~~~riailvSg~gs-nL~~Ll~~~----~~g~L~~eI~~VI---------  117 (288)
                      +.+++.+.|..+...--..+    .-....+++||+|+.||... .+++.+...    +.-.-..++-.+.         
T Consensus        41 ~~~~~~~~fp~~~~~p~~~~~~~~~~~~~~~~~~IgIl~sGG~aPG~N~vI~gvv~~~~~~~~~~~v~G~~~G~~GL~~~  120 (555)
T 2f48_A           41 DRQALKEFFKNTYGLPIISFTEGESSLSFSKALNIGIILSGGPAPGGHNVISGVFDAIKKFNPNSKLFGFKGGPLGLLEN  120 (555)
T ss_dssp             CHHHHHHHTTTTTTCCCEEEEESCCCCSCCSCCEEEEEEBSSCCTTHHHHHHHHHHHHHHHCTTCEEEEETTTTHHHHTT
T ss_pred             CHHHHHHHCHHHCCCCCEEEECCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHCCC
T ss_conf             88999985501049960687558888877888769997807874889999999999999858998999982544875789


Q ss_pred             ----ECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             ----77346677788609974741687335277678999997333940999827
Q gi|254780911|r  118 ----SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       118 ----SN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                          =+.++...+...-|-...--...+...++.-.++.+.++++++|.+|.-|
T Consensus       121 ~~i~Lt~~~v~~~~n~GG~~l~~s~r~~~~~~e~~~~~~~~l~~~~Id~LviIG  174 (555)
T 2f48_A          121 DKIELTESLINSYRNTGGFDIVSSGRTKIETEEHYNKALFVAKENNLNAIIIIG  174 (555)
T ss_dssp             CEEEECHHHHHHHTTCCSSTTTCCBCCCCCSHHHHHHHHHHHHHTTCSEEEEEE
T ss_pred             CEEECCHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             999999899845871799284179999977778999999999863898899978


No 153
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovarkurstaki str}
Probab=42.01  E-value=16  Score=15.90  Aligned_cols=98  Identities=15%  Similarity=0.146  Sum_probs=47.6

Q ss_pred             HHHHHHCCCCEEEECCC---CCCCCCCCCHHH---HHH---------HCCCCEEEEEEEEEECCCCCCCEEEE-------
Q ss_conf             77863277847961336---676789999589---997---------42683762257753055688834444-------
Q gi|254780911|r  174 DHLCHKMTGRIINIHHS---FLPSFKGANPYK---QAY---------EYGVKIIGATAHYAICELDAGPIIEQ-------  231 (288)
Q Consensus       174 ~~~~~~~~~~iiNiHps---lLP~f~G~~~y~---~A~---------~~Gvk~~G~TvH~V~~~lD~GpII~Q-------  231 (288)
                      |.+.++=.++||||=-+   -.|.+++..+|-   .|+         |.+  --|.+|.-|.++.=..|...+       
T Consensus       131 ~~m~~~~~G~IIniss~~~~~~~g~~~~~~Y~asKaal~~ltk~lA~ela--~~gIrVN~I~PG~i~T~~~~~~~~~~~~  208 (264)
T 3i4f_A          131 PVMRKQNFGRIINYGFQGADSAPGWIYRSAFAAAKVGLVSLTKTVAYEEA--EYGITANMVCPGDIIGEMKEATIQEARQ  208 (264)
T ss_dssp             HHHHHHTCEEEEEECCTTGGGCCCCTTCHHHHHHHHHHHHHHHHHHHHHG--GGTEEEEEEEECCCCGGGGSCCHHHHHH
T ss_pred             HHCCCCCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHC--CCCEEEEEEEECCCCCCCCCCCCHHHHH
T ss_conf             64033578638999700034789986630789999999999999999857--1184999996388968543113788999


Q ss_pred             ---EEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC--------EEEEECCEEEECCCCCCC
Q ss_conf             ---466518888999999999999999999999998769--------178868857980888676
Q gi|254780911|r  232 ---DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQ--------RVFINKRKTIVFPAYPNN  285 (288)
Q Consensus       232 ---~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~--------rv~~~~~ktvvf~~~~~~  285 (288)
                         ...|...--++|+            .+.++.+.+.+        -+.++|+-+++-+.+...
T Consensus       209 ~~~~~~pl~R~g~ped------------iA~~v~fL~S~~s~~itG~~i~VDGG~sl~~~~~~~~  261 (264)
T 3i4f_A          209 LKEHNTPIGRSGTGED------------IARTISFLCEDDSDMITGTIIEVTGAVDVIHREGHHH  261 (264)
T ss_dssp             C--------CCCCHHH------------HHHHHHHHHSGGGTTCCSCEEEESCSCCCCC------
T ss_pred             HHHHCCCCCCCCCHHH------------HHHHHHHHHCCCCCCCCCCEEEECCCCEECCCCCCCC
T ss_conf             9971899889849999------------9999999958610597687899699977067999777


No 154
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana}
Probab=42.00  E-value=1.8  Score=22.55  Aligned_cols=43  Identities=9%  Similarity=-0.057  Sum_probs=29.2

Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCEE
Q ss_conf             66518888999999999999999999999998769178868857
Q gi|254780911|r  233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKT  276 (288)
Q Consensus       233 ~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~~~~kt  276 (288)
                      .+.|++.||+.+|.+++.+.+.. -+...+++..||..+.+++|
T Consensus        24 ~l~V~~~dTV~~lK~~I~~~~gi-p~~~QrLiy~Gk~~L~D~~t   66 (84)
T 2kk8_A           24 ELEVDYRDTLLVVKQKIERSQHI-PVSKQTLIVDGIVILREDLT   66 (84)
T ss_dssp             EEEECTTSBHHHHHHHHHHHHTC-CGGGEEEEETTEECCCSSSB
T ss_pred             EEEECCCCHHHHHHHHHHHHHCC-CCCCEEEEECCEEECCCCCC
T ss_conf             99989948699999999987198-97668999999847469988


No 155
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi}
Probab=42.00  E-value=16  Score=15.89  Aligned_cols=14  Identities=7%  Similarity=0.095  Sum_probs=7.1

Q ss_pred             CCCCEEEEECCCCC
Q ss_conf             65538999708867
Q gi|254780911|r   82 EATKTLILVSQPDH   95 (288)
Q Consensus        82 ~~~riailvSg~gs   95 (288)
                      .++||.++||++-|
T Consensus         3 ~~mkIlL~C~~G~S   16 (109)
T 2l2q_A            3 GSMNILLVCGAGMS   16 (109)
T ss_dssp             CCEEEEEESSSSCS
T ss_pred             CCCEEEEECCCCCC
T ss_conf             75289888789757


No 156
>3kts_A Glycerol uptake operon antiterminator regulatory protein; structural genomics, PSI-2, protein structure initiative; HET: UNL; 2.75A {Listeria monocytogenes str}
Probab=41.93  E-value=17  Score=15.89  Aligned_cols=108  Identities=15%  Similarity=0.183  Sum_probs=61.9

Q ss_pred             ECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEE-EECCC
Q ss_conf             70886798999986204674158999997734667778860997474168733527767899999733394099-98276
Q gi|254780911|r   90 VSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELM-ILARY  168 (288)
Q Consensus        90 vSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dli-vLAgy  168 (288)
                      +.|-++-=.++=+-++    ....-++||.++..-..|++.|+.+..= .==-+...++ ..++.++..+||+| ||-|.
T Consensus        64 I~GL~~d~~av~fL~~----~~~~dGIISTk~~~I~~Ak~~Gl~tIqR-~FliDS~al~-~~~~~i~~~~PD~VEiLPG~  137 (192)
T 3kts_A           64 VNGLKNDDYAIDFLCT----EICPDGIISTRGNAIMKAKQHKMLAIQR-LFMIDSSAYN-KGVALIQKVQPDCIELLPGI  137 (192)
T ss_dssp             EETCCCSHHHHHHHHH----TTCCSEEEESCHHHHHHHHHTTCEEEEE-EECCSHHHHH-HHHHHHHHHCCSEEEEECTT
T ss_pred             CCCCCCCHHHHHHHHH----HCCCCEEEECCHHHHHHHHHCCCEEEEE-EEEEEHHHHH-HHHHHHHHCCCCEEEECCHH
T ss_conf             6777888899999998----4289989978899999999779907976-6344276899-99999854798999988667


Q ss_pred             CCCCCHHHHHHCCCCEEEECCCCCCCCCCC-----CHHHHHHHCCCCEEEEE
Q ss_conf             754887786327784796133667678999-----95899974268376225
Q gi|254780911|r  169 MQILSDHLCHKMTGRIINIHHSFLPSFKGA-----NPYKQAYEYGVKIIGAT  215 (288)
Q Consensus       169 mril~~~~~~~~~~~iiNiHpslLP~f~G~-----~~y~~A~~~Gvk~~G~T  215 (288)
                      |    |.++.....++ +     .|-+.|.     .-...|+.+|.  +|+|
T Consensus       138 ~----p~~I~~i~~~~-~-----~PiIAGGLI~~kedV~~aL~aGA--~aVS  177 (192)
T 3kts_A          138 I----PEQVQKMTQKL-H-----IPVIAGGLIETSEQVNQVIASGA--IAVT  177 (192)
T ss_dssp             C----HHHHHHHHHHH-C-----CCEEEESSCCSHHHHHHHHTTTE--EEEE
T ss_pred             H----HHHHHHHHHHC-C-----CCEEEECCCCCHHHHHHHHHCCC--EEEE
T ss_conf             8----99999999746-9-----99997667288999999998599--7998


No 157
>1z2m_A ISG15, interferon, alpha-inducible protein (clone IFI- 15K); ubiquitin cross reactive protein, signaling protein; 2.50A {Homo sapiens} SCOP: d.15.1.1 d.15.1.1
Probab=41.55  E-value=17  Score=15.85  Aligned_cols=43  Identities=19%  Similarity=0.196  Sum_probs=28.3

Q ss_pred             EEEEEEEEECCCCCC-CEEEE------EEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             622577530556888-34444------46651888899999999999999
Q gi|254780911|r  212 IGATAHYAICELDAG-PIIEQ------DVVRVTHAQTIEDYIAIGKNIEA  254 (288)
Q Consensus       212 ~G~TvH~V~~~lD~G-pII~Q------~~~~v~~~dt~~~l~~~~~~~E~  254 (288)
                      -|+|+|++-...+.. .|..+      -.+.|+++||+.+|.+++.+.+.
T Consensus        67 ~~s~i~l~~~~~s~~~~I~Vk~~~gk~~~~~V~~~~tV~~LK~~I~~~~g  116 (155)
T 1z2m_A           67 PGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEG  116 (155)
T ss_dssp             TTCEEEEEECCCCCCEEEEEECTTSCEEEEEECTTSBHHHHHHHHHHHHT
T ss_pred             CCCEEEEEEECCCCCCEEEEEECCCCEEEEEECCCCCHHHHHHHHHHHHC
T ss_conf             99889999852789836999967998899997898909999999999978


No 158
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa}
Probab=41.04  E-value=17  Score=15.80  Aligned_cols=82  Identities=12%  Similarity=0.006  Sum_probs=36.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHCC-CCCEEEEEEEEEC-CHH----H---HHHHHHCCCCEEECCCCCCCHHHHHHHHH
Q ss_conf             6553899970886798999986204-6741589999977-346----6---77788609974741687335277678999
Q gi|254780911|r   82 EATKTLILVSQPDHCLNDLLYRWNI-GTLALNIVGVVSN-HTT----H---KKLVENYQLPFYYLPMTEQNKIESEQKLI  152 (288)
Q Consensus        82 ~~~riailvSg~gsnL~~Ll~~~~~-g~L~~eI~~VISN-~~d----~---~~lA~~~gIP~~~i~~~~~~k~~~e~~il  152 (288)
                      .-+||.|.+.+..+...+|=++..- ....+++.++-.. .++    +   ..-.+..+.+...--..   .......++
T Consensus         6 ~~k~ILV~vd~s~~~~~al~~A~~lA~~~~a~l~~l~v~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~---~~~~~~~I~   82 (290)
T 3mt0_A            6 AIRSILVVIEPDQLEGLALKRAQLIAGVTQSHLHLLVCEKRRDHSAALNDLAQELREEGYSVSTNQAW---KDSLHQTII   82 (290)
T ss_dssp             TCCEEEEECCSSCSCCHHHHHHHHHHHHHCCEEEEEEECSSSCCHHHHHHHHHHHHHTTCCEEEEEEC---SSSHHHHHH
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEC---CCCHHHHHH
T ss_conf             56869999789877999999999999985997999998044899999999999999649955899841---798799999


Q ss_pred             HHHHHCCCEEEEEC
Q ss_conf             99733394099982
Q gi|254780911|r  153 NIIEKNNVELMILA  166 (288)
Q Consensus       153 ~~l~~~~~DlivLA  166 (288)
                      +..++.++|+|++.
T Consensus        83 ~~a~~~~~dlvv~g   96 (290)
T 3mt0_A           83 AEQQAEGCGLIIKQ   96 (290)
T ss_dssp             HHHHHHTCSEEEEE
T ss_pred             HHHHHCCCCCEEEC
T ss_conf             99996599733644


No 159
>1toa_A Tromp-1, protein (periplasmic binding protein TROA); zinc binding protein, ABC transporter; 1.80A {Treponema pallidum} SCOP: c.92.2.2 PDB: 1k0f_A
Probab=40.89  E-value=17  Score=15.78  Aligned_cols=20  Identities=15%  Similarity=0.286  Sum_probs=8.4

Q ss_pred             EEECCHHHHHHHHHCCCCEE
Q ss_conf             99773466777886099747
Q gi|254780911|r  116 VVSNHTTHKKLVENYQLPFY  135 (288)
Q Consensus       116 VISN~~d~~~lA~~~gIP~~  135 (288)
                      +++.|+...-+++++|+...
T Consensus       200 ~v~~H~a~~Yf~~~ygl~~~  219 (313)
T 1toa_A          200 LVTAHDAFGYFSRAYGFEVK  219 (313)
T ss_dssp             EEEEESCCHHHHHHHTCEEE
T ss_pred             EEECCHHHHHHHHHCCCCEE
T ss_conf             01026679999997699724


No 160
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C*
Probab=40.56  E-value=6.3  Score=18.82  Aligned_cols=18  Identities=28%  Similarity=0.375  Sum_probs=13.2

Q ss_pred             CCCEEEECCCCCCCCCCC
Q ss_conf             784796133667678999
Q gi|254780911|r  181 TGRIINIHHSFLPSFKGA  198 (288)
Q Consensus       181 ~~~iiNiHpslLP~f~G~  198 (288)
                      .|-+=||||+|||+=.+.
T Consensus       104 GGv~P~Ih~~ll~kk~~~  121 (123)
T 2nqb_C          104 GGVLPNIQAVLLPKKTEK  121 (123)
T ss_dssp             CCCCCCCCGGGSSCC---
T ss_pred             CCCCCCCCHHHCCCCCCC
T ss_conf             872764267656886556


No 161
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A*
Probab=40.47  E-value=17  Score=15.74  Aligned_cols=40  Identities=13%  Similarity=0.287  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHCCCEEEEECCCCC--CCCHHHHHHCCCCEEEE
Q ss_conf             78999997333940999827675--48877863277847961
Q gi|254780911|r  148 EQKLINIIEKNNVELMILARYMQ--ILSDHLCHKMTGRIINI  187 (288)
Q Consensus       148 e~~il~~l~~~~~DlivLAgymr--il~~~~~~~~~~~iiNi  187 (288)
                      -.++++.+.+.++|+||.|-=--  ..-+.+-+.|+-.+|.+
T Consensus        63 ~~~~~~~l~~~~~~~IViACNTasa~al~~lr~~~~~piig~  104 (273)
T 2oho_A           63 TWELVNFLLTQNVKMIVFACNTATAVAWEEVKAALDIPVLGV  104 (273)
T ss_dssp             HHHHHHHHHTTTCSEEEECCHHHHHHHHHHHHHHCSSCEEES
T ss_pred             HHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHCCCCEEEC
T ss_conf             999999999606784999828588875999986479877625


No 162
>2ez9_A Pyruvate oxidase; TPP enzyme, reaction intermediate analogue, oxidoreductase; HET: TDK FAD; 1.60A {Lactobacillus plantarum} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1y9d_A* 1pow_A* 1pox_A*
Probab=40.32  E-value=17  Score=15.72  Aligned_cols=37  Identities=11%  Similarity=0.071  Sum_probs=19.4

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEEC-----CHHHHHHHHHCCCCEEE
Q ss_conf             89999862046741589999977-----34667778860997474
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSN-----HTTHKKLVENYQLPFYY  136 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN-----~~d~~~lA~~~gIP~~~  136 (288)
                      +..+.......+-|.   +++..     .+.+..+|++.|+|...
T Consensus       202 i~~~~~~l~~a~rPv---ii~G~g~~~a~~~l~~lae~l~~PV~~  243 (603)
T 2ez9_A          202 VTRLTQTLLAAERPL---IYYGIGARKAGKELEQLSKTLKIPLMS  243 (603)
T ss_dssp             HHHHHHHHHHCSSEE---EEECGGGTTCHHHHHHHHHHHTCCEEE
T ss_pred             HHHHHHHHHHCCCCE---EECCCCHHHHHHHHHHHHHHHCCCEEE
T ss_conf             999999987545876---506875548999999999997999997


No 163
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A*
Probab=39.87  E-value=18  Score=15.67  Aligned_cols=37  Identities=14%  Similarity=0.185  Sum_probs=18.1

Q ss_pred             HHHHHHHHCCCEEEEECCCCCCCCHHHHHH-------CCCCEEEEC
Q ss_conf             999997333940999827675488778632-------778479613
Q gi|254780911|r  150 KLINIIEKNNVELMILARYMQILSDHLCHK-------MTGRIINIH  188 (288)
Q Consensus       150 ~il~~l~~~~~DlivLAgymril~~~~~~~-------~~~~iiNiH  188 (288)
                      ++.++.++.+.  ++..||++...|.+...       -=|+|+.+.
T Consensus       133 ~l~~~~~~~~~--~~~v~~~~r~~~~~~~~~~~i~~g~iG~i~~~~  176 (444)
T 2ixa_A          133 DYVKVSEQTGV--PLMALENVCYRRDVMAILNMVRKGMFGELVHGT  176 (444)
T ss_dssp             HHHHHHHHHCC--CEEECCGGGGCHHHHHHHHHHHTTTTCSEEEEE
T ss_pred             HHHHHHHHHCC--CCEECCCCCCCHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             99999998399--960110444587999999999869987338999


No 164
>3gi1_A LBP, laminin-binding protein of group A streptococci; zinc-binding receptor, metal-binding, helical backbone, alpha/beta domains; 2.45A {Streptococcus pyogenes} PDB: 3hjt_A
Probab=39.24  E-value=18  Score=15.61  Aligned_cols=70  Identities=11%  Similarity=0.153  Sum_probs=35.8

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCC-CC--CCHHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             8999986204674158999997734667778860997474168-73--3527767899999733394099982
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPM-TE--QNKIESEQKLINIIEKNNVELMILA  166 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~-~~--~~k~~~e~~il~~l~~~~~DlivLA  166 (288)
                      |.+|...++..--+..=..+++.|+...-+++++|+....+.. ..  +-....=+++.+.+++.++.+|+.-
T Consensus       163 l~~l~~~~~~~~~~~~~~~~v~~H~a~~Y~~~~~gl~~~~~~~~~~~~eps~~~l~~l~~~ik~~~i~~if~e  235 (286)
T 3gi1_A          163 AEQLTEEYTQKFKKVRSKTFVTQHTAFSYLAKRFGLKQLGISGISPEQEPSPRQLKEIQDFVKEYNVKTIFAE  235 (286)
T ss_dssp             HHHHHHHHHHHHTTCSCCEEEEEESCCHHHHHHTTCEEEEEECSCC---CCHHHHHHHHHHHHHTTCCEEEEC
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9999999999754313352588676468999983985144212467778987789999999997599899984


No 165
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}
Probab=39.21  E-value=18  Score=15.61  Aligned_cols=78  Identities=12%  Similarity=0.080  Sum_probs=40.2

Q ss_pred             CCCCHHHHHHCCCCEEEECCC-CCCCCCCCCHH---HHHHHC-------CCCEEEEEEEEEECCCCCCCEEEEEEEECC-
Q ss_conf             548877863277847961336-67678999958---999742-------683762257753055688834444466518-
Q gi|254780911|r  170 QILSDHLCHKMTGRIINIHHS-FLPSFKGANPY---KQAYEY-------GVKIIGATAHYAICELDAGPIIEQDVVRVT-  237 (288)
Q Consensus       170 ril~~~~~~~~~~~iiNiHps-lLP~f~G~~~y---~~A~~~-------Gvk~~G~TvH~V~~~lD~GpII~Q~~~~v~-  237 (288)
                      |-+-|.+.++-.|+||||=-. -...++|..+|   +.|+..       -..-.|.+|.-|.++.=.-|...+...+.. 
T Consensus       126 ~~~~p~m~~~~~G~IinisS~~~~~~~~~~~~Y~asKaal~~lt~sla~El~~~gIrVn~i~PG~v~T~~~~~~~~~~~~  205 (250)
T 3nyw_A          126 KTVTEIMKVQKNGYIFNVASRAAKYGFADGGIYGSTKFALLGLAESLYRELAPLGIRVTTLCPGWVNTDMAKKAGTPFKD  205 (250)
T ss_dssp             HHHHHHHHHHTCEEEEEECC-------CCTTHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEESSBCSHHHHHTTCCSCG
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHCCCCCC
T ss_conf             99899998779958999778454668999747999999999999999998552091999997298987588740778866


Q ss_pred             -CCCCHHHHHH
Q ss_conf             -8889999999
Q gi|254780911|r  238 -HAQTIEDYIA  247 (288)
Q Consensus       238 -~~dt~~~l~~  247 (288)
                       .--++++++.
T Consensus       206 ~~~~~PedvA~  216 (250)
T 3nyw_A          206 EEMIQPDDLLN  216 (250)
T ss_dssp             GGSBCHHHHHH
T ss_pred             CCCCCHHHHHH
T ss_conf             67779999999


No 166
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis}
Probab=38.97  E-value=18  Score=15.58  Aligned_cols=15  Identities=20%  Similarity=0.379  Sum_probs=7.5

Q ss_pred             HHHHHCCCEEEEECC
Q ss_conf             997333940999827
Q gi|254780911|r  153 NIIEKNNVELMILAR  167 (288)
Q Consensus       153 ~~l~~~~~DlivLAg  167 (288)
                      +.+.+.++|-+||+=
T Consensus       174 ~~l~~~~~d~lVLGC  188 (276)
T 2dwu_A          174 LPLTKEDIDTLILGC  188 (276)
T ss_dssp             HHHHTSCCSEEEECS
T ss_pred             CCHHCCCCCEEEECC
T ss_conf             711126998799857


No 167
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1
Probab=38.82  E-value=6.6  Score=18.69  Aligned_cols=17  Identities=29%  Similarity=0.405  Sum_probs=12.7

Q ss_pred             CCCEEEECCCCCCCCCC
Q ss_conf             78479613366767899
Q gi|254780911|r  181 TGRIINIHHSFLPSFKG  197 (288)
Q Consensus       181 ~~~iiNiHpslLP~f~G  197 (288)
                      .|-+=||||+|||+=.+
T Consensus       125 GGV~P~Ih~~LlpKk~~  141 (149)
T 2f8n_K          125 GGVLPNIQAVLLPKKTE  141 (149)
T ss_dssp             CCCCCCCCGGGSCC---
T ss_pred             CCCCCCCCHHHCCCCCC
T ss_conf             87376518866587655


No 168
>1b0z_A Protein (phosphoglucose isomerase); autocrinefactor, neuroleukin, crystallography motility; 2.30A {Geobacillus stearothermophilus} SCOP: c.80.1.2 PDB: 1c7q_A* 1c7r_A* 2pgi_A
Probab=38.22  E-value=19  Score=15.50  Aligned_cols=56  Identities=14%  Similarity=0.190  Sum_probs=33.3

Q ss_pred             CCCEEEEECCCCCCHHHHHHH-----HCC---CCCE-EEEEEEEECCH--HHHHHHHHCCCCEEECC
Q ss_conf             553899970886798999986-----204---6741-58999997734--66777886099747416
Q gi|254780911|r   83 ATKTLILVSQPDHCLNDLLYR-----WNI---GTLA-LNIVGVVSNHT--THKKLVENYQLPFYYLP  138 (288)
Q Consensus        83 ~~riailvSg~gsnL~~Ll~~-----~~~---g~L~-~eI~~VISN~~--d~~~lA~~~gIP~~~i~  138 (288)
                      +.-..|.+||.|++++-+...     |-.   |.-. .+-.+|+++.+  .+..+|++.+++.+.+|
T Consensus       130 ~~t~~iviSKSg~T~ETl~~~~~~~~~l~~~~~~~~~~~~~~vit~~~~~~l~~~a~~~~~~if~~~  196 (445)
T 1b0z_A          130 KDLSINVISKSGTTTEPAIAFRIFRDYMEKKYGKEEARKRIYVTTDRTKGALKKLADQEGYETFVIP  196 (445)
T ss_dssp             CCEEEEEECSSSCCHHHHHHHHHHHHHHHHHHCHHHHGGGEEEEECSSCSHHHHHHHHHTCEEEECC
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCHHHHHCEEEECCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             6776999989989878999999999999985383665506465325457788865444233213167


No 169
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1
Probab=37.45  E-value=6.4  Score=18.77  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=10.5

Q ss_pred             CCEEEECCCCCCC
Q ss_conf             8479613366767
Q gi|254780911|r  182 GRIINIHHSFLPS  194 (288)
Q Consensus       182 ~~iiNiHpslLP~  194 (288)
                      |-+=||||+|||+
T Consensus       109 GV~P~Ih~~ll~k  121 (128)
T 1f66_C          109 GVIPHIHKSLIGK  121 (128)
T ss_dssp             CCCCCCCGGGC--
T ss_pred             CCCCCCCHHHCCC
T ss_conf             6667508977588


No 170
>2o1e_A YCDH; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.60A {Bacillus subtilis}
Probab=37.45  E-value=19  Score=15.42  Aligned_cols=14  Identities=7%  Similarity=-0.235  Sum_probs=6.1

Q ss_pred             EEEEEEEEEECCCC
Q ss_conf             76225775305568
Q gi|254780911|r  211 IIGATAHYAICELD  224 (288)
Q Consensus       211 ~~G~TvH~V~~~lD  224 (288)
                      -.|+.+=|+++..+
T Consensus       237 ~~~v~~if~e~~~~  250 (312)
T 2o1e_A          237 EHNVKVIYFEEIAS  250 (312)
T ss_dssp             SSCCCEEECSSCCC
T ss_pred             HCCCCEEEEECCCC
T ss_conf             83997899828989


No 171
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris}
Probab=37.36  E-value=19  Score=15.41  Aligned_cols=84  Identities=10%  Similarity=0.039  Sum_probs=38.0

Q ss_pred             CCCCCEEEEECCCCC-CHHHHHHHHCCCC--CEEEEEEEEECCHHHHHHHHHCCCCEE----------------ECCCC-
Q ss_conf             565538999708867-9899998620467--415899999773466777886099747----------------41687-
Q gi|254780911|r   81 KEATKTLILVSQPDH-CLNDLLYRWNIGT--LALNIVGVVSNHTTHKKLVENYQLPFY----------------YLPMT-  140 (288)
Q Consensus        81 ~~~~riailvSg~gs-nL~~Ll~~~~~g~--L~~eI~~VISN~~d~~~lA~~~gIP~~----------------~i~~~-  140 (288)
                      ..++||+|+.||... .+++.+.+.-...  ..+++   +.=+....+|.+.......                .+-.. 
T Consensus       179 p~~KrIaIlTSGGdaPGmNaaIr~vv~~a~~~g~~V---~Gi~~Gy~GL~~g~~~~i~~l~~~~v~~~~~~GGt~LGSsR  255 (941)
T 3opy_B          179 PVRKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKV---FCIHEGYEGLVRGGEKYIKETQWHDVRGWLVEGGTNIGTAR  255 (941)
T ss_dssp             -CCCCEEEEECSSCCTTHHHHHHHHHHHHHHTTCCE---EEETTHHHHHHHCSTTTEEEECGGGGTTTTTCCSCSSCCCC
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEE---EEECCCHHHHCCCCCCCCCCCCHHHHHHHHHCCCEEEECCC
T ss_conf             767689998978786438899999999998689899---99853458761498655433899998327627972640488


Q ss_pred             -CCCHH-HHHHHHHHHHHHCCCEEEEECC
Q ss_conf             -33527-7678999997333940999827
Q gi|254780911|r  141 -EQNKI-ESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       141 -~~~k~-~~e~~il~~l~~~~~DlivLAg  167 (288)
                       +..++ +.-.++.+.|+++++|.+|.-|
T Consensus       256 ~~~~~~~~~~~~~~~~L~~~~Id~LvvIG  284 (941)
T 3opy_B          256 CKEFRERSGRLKACKNMIDMGIDALIVCG  284 (941)
T ss_dssp             CSGGGSHHHHHHHHHHHHHHTCCEEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             98767877899999999986999899989


No 172
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A*
Probab=36.59  E-value=20  Score=15.33  Aligned_cols=10  Identities=20%  Similarity=0.534  Sum_probs=4.0

Q ss_pred             HCCCEEEEEC
Q ss_conf             3394099982
Q gi|254780911|r  157 KNNVELMILA  166 (288)
Q Consensus       157 ~~~~DlivLA  166 (288)
                      +.++|-+||+
T Consensus       176 ~~~iD~lILG  185 (269)
T 3ist_A          176 STKIDTVILG  185 (269)
T ss_dssp             GSCCCEEEEC
T ss_pred             CCCCCEEEEC
T ss_conf             5688879974


No 173
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}
Probab=36.39  E-value=20  Score=15.31  Aligned_cols=106  Identities=8%  Similarity=0.017  Sum_probs=51.6

Q ss_pred             HHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHCCCCE----------EEECCCCCCCCCCCCHHHHHHHCCCCEEE
Q ss_conf             27767899999733394099982767548877863277847----------96133667678999958999742683762
Q gi|254780911|r  144 KIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI----------INIHHSFLPSFKGANPYKQAYEYGVKIIG  213 (288)
Q Consensus       144 k~~~e~~il~~l~~~~~DlivLAgymril~~~~~~~~~~~i----------iNiHpslLP~f~G~~~y~~A~~~Gvk~~G  213 (288)
                      +.+.-.++++.+.+.....++..+  .-..+......+.++          +--|.+++-...|.+....|+..|+-+++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~v~~~~~~~~~~~l~~~~~~i~~gG~~t~~Eal~~G~P~v~  322 (402)
T 3ia7_A          245 HPEFFRACAQAFADTPWHVVMAIG--GFLDPAVLGPLPPNVEAHQWIPFHSVLAHARACLTHGTTGAVLEAFAAGVPLVL  322 (402)
T ss_dssp             CHHHHHHHHHHHTTSSCEEEEECC--TTSCGGGGCSCCTTEEEESCCCHHHHHTTEEEEEECCCHHHHHHHHHTTCCEEE
T ss_pred             CHHHHHHHHHHHHHCCCEEEEEEC--CCCCHHHHHCCCCCEEEEECCCHHHHHHCCCEEEEECCCCHHHHHHHCCCCEEE
T ss_conf             899999999998746957999618--988755662079978995116726653100136652355669999980999899


Q ss_pred             EEEEEEECCCCCCCEEEE--EEEECCCCC-CHHHHHHHHHHH
Q ss_conf             257753055688834444--466518888-999999999999
Q gi|254780911|r  214 ATAHYAICELDAGPIIEQ--DVVRVTHAQ-TIEDYIAIGKNI  252 (288)
Q Consensus       214 ~TvH~V~~~lD~GpII~Q--~~~~v~~~d-t~~~l~~~~~~~  252 (288)
                      .-. +-++..+....+.+  ....+++++ |+++|++.+.++
T Consensus       323 iP~-~~~dq~~na~~l~~~G~g~~~~~~~~~~~~La~ai~~l  363 (402)
T 3ia7_A          323 VPH-FATEAAPSAERVIELGLGSVLRPDQLEPASIREAVERL  363 (402)
T ss_dssp             CGG-GCGGGHHHHHHHHHTTSEEECCGGGCSHHHHHHHHHHH
T ss_pred             ECC-CCCCHHHHHHHHHHCCCEEECCCCCCCHHHHHHHHHHH
T ss_conf             559-86629999999998798898060369999999999999


No 174
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9
Probab=35.99  E-value=7.2  Score=18.41  Aligned_cols=46  Identities=13%  Similarity=0.129  Sum_probs=22.6

Q ss_pred             HHHHHHHHHCCCCEEECCCCCC-------------CHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             4667778860997474168733-------------52776789999973339409998276
Q gi|254780911|r  121 TTHKKLVENYQLPFYYLPMTEQ-------------NKIESEQKLINIIEKNNVELMILARY  168 (288)
Q Consensus       121 ~d~~~lA~~~gIP~~~i~~~~~-------------~k~~~e~~il~~l~~~~~DlivLAgy  168 (288)
                      ..+..+|+..|+|.......+.             ..........+.+.  +.|++++.|-
T Consensus       227 ~~l~~lae~~~~pv~~t~~~~g~~~~~~~~~~g~~~~~~~~~~~~~~l~--~~dlil~~g~  285 (552)
T 1ovm_A          227 HALQKWVKEVPMAHATMLMGKGIFDERQAGFYGTYSGSASTGAVKEAIE--GADTVLCVGT  285 (552)
T ss_dssp             HHHHHHHHHSCCEEEECGGGTTSSCTTSTTCCCCCCGGGSCHHHHHHHH--TSSEEEEESC
T ss_pred             HHHHHHHHHCCCCCEECCCCCEEECCCCCCCCCCCCCCCCCHHHHHHHH--CCCCCEEECC
T ss_conf             9999999861687111145530102676423565566667789999971--6442113022


No 175
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1
Probab=35.66  E-value=10  Score=17.42  Aligned_cols=19  Identities=32%  Similarity=0.525  Sum_probs=13.8

Q ss_pred             CCCEEEECCCCCCCCCCCC
Q ss_conf             7847961336676789999
Q gi|254780911|r  181 TGRIINIHHSFLPSFKGAN  199 (288)
Q Consensus       181 ~~~iiNiHpslLP~f~G~~  199 (288)
                      .|-+=||||+|||+=.+..
T Consensus       106 GGV~P~I~~~llpkk~~~~  124 (131)
T 1id3_C          106 GGVLPNIHQNLLPKKSAKA  124 (131)
T ss_dssp             CCCCCCCCGGGSCCSCCSC
T ss_pred             CCCCCCCCHHHCCCCCCCC
T ss_conf             9737641786668765666


No 176
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*
Probab=35.33  E-value=21  Score=15.20  Aligned_cols=56  Identities=16%  Similarity=0.137  Sum_probs=30.9

Q ss_pred             CCCCHHHHHHCCCCEEEECC--CCCC-CCCCCCHHH---HHH---------HCCCCEEEEEEEEEECCCCCCC
Q ss_conf             54887786327784796133--6676-789999589---997---------4268376225775305568883
Q gi|254780911|r  170 QILSDHLCHKMTGRIINIHH--SFLP-SFKGANPYK---QAY---------EYGVKIIGATAHYAICELDAGP  227 (288)
Q Consensus       170 ril~~~~~~~~~~~iiNiHp--slLP-~f~G~~~y~---~A~---------~~Gvk~~G~TvH~V~~~lD~Gp  227 (288)
                      |-.-|.+.++=.|+||||--  ++.+ .+++..+|-   .|+         |-+  -.|.+|.-|.++.=.-|
T Consensus       125 ~~~~~~m~~~~~G~IInisS~~~~~~~~~~~~~~Y~asKaal~~ltk~lA~el~--~~gIrVN~I~PG~i~T~  195 (254)
T 2wsb_A          125 RAFGRAMVARGAGAIVNLGSMSGTIVNRPQFASSYMASKGAVHQLTRALAAEWA--GRGVRVNALAPGYVATE  195 (254)
T ss_dssp             HHHHHHHHHHTCEEEEEECCGGGTSCCSSSCBHHHHHHHHHHHHHHHHHHHHHG--GGTEEEEEEEECCBCSH
T ss_pred             HHHHHCCCCCCCCCEEEEECHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC--CCCCEEEEEEECCCCCH
T ss_conf             863110224699409999314333678863117899999999999999999963--02928999960878776


No 177
>2ho3_A Oxidoreductase, GFO/IDH/MOCA family; reductive methylation, structural genomics, PSI 2, protein structure initiative; HET: MLY; 2.00A {Streptococcus pneumoniae} PDB: 2ho5_A
Probab=35.01  E-value=21  Score=15.16  Aligned_cols=83  Identities=17%  Similarity=0.167  Sum_probs=43.6

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHH---HHHHHCCCCEEEC-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             798999986204674158999997734667---7788609974741-687335277678999997333940999827675
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHK---KLVENYQLPFYYL-PMTEQNKIESEQKLINIIEKNNVELMILARYMQ  170 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~---~lA~~~gIP~~~i-~~~~~~k~~~e~~il~~l~~~~~DlivLAgymr  170 (288)
                      +.++.|.+    .  +.+++.|.+-+....   ..|-++|.+.+.= |.. .+.++.+ ++.++.++.+  ..++.||++
T Consensus        53 ~~~e~l~~----~--~iD~V~I~tp~~~H~~~~~~al~~gkhV~~EKP~a-~~~~e~~-~l~~~a~~~~--~~~~v~~~~  122 (325)
T 2ho3_A           53 DQLEVFFK----S--SFDLVYIASPNSLHFAQAKAALSAGKHVILEKPAV-SQPQEWF-DLIQTAEKNN--CFIFEAARN  122 (325)
T ss_dssp             SCHHHHHT----S--SCSEEEECSCGGGHHHHHHHHHHTTCEEEEESSCC-SSHHHHH-HHHHHHHHTT--CCEEEECTT
T ss_pred             CHHHHHHC----C--CCCEEEEECCCCHHHHHHHHHHHCCCCHHCCCCCC-CCCCHHH-HHHHHHHHCC--CCCCCCCCC
T ss_conf             85999718----9--99899995896031599999986345122279831-1110246-7777887617--654222000


Q ss_pred             CCCHHHHHH---C-CCCEEEE
Q ss_conf             488778632---7-7847961
Q gi|254780911|r  171 ILSDHLCHK---M-TGRIINI  187 (288)
Q Consensus       171 il~~~~~~~---~-~~~iiNi  187 (288)
                      ...|.+...   . .+++.++
T Consensus       123 r~~p~~~~lk~~i~~g~ig~~  143 (325)
T 2ho3_A          123 YHEKAFTTIKNFLADXQVLGA  143 (325)
T ss_dssp             TTCHHHHHHHHHHTTSCEEEE
T ss_pred             HHHHHHHHHHHHHHHHCCCCE
T ss_conf             012999999999984046633


No 178
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp}
Probab=34.73  E-value=21  Score=15.13  Aligned_cols=14  Identities=21%  Similarity=0.515  Sum_probs=5.6

Q ss_pred             HHHHHCCCEEEEEC
Q ss_conf             99733394099982
Q gi|254780911|r  153 NIIEKNNVELMILA  166 (288)
Q Consensus       153 ~~l~~~~~DlivLA  166 (288)
                      +.+.+.++|-+||+
T Consensus       172 ~~l~~~~id~lVLG  185 (268)
T 3out_A          172 SYFHDKNIQALILG  185 (268)
T ss_dssp             GGGTTSCCSEEEEC
T ss_pred             CHHHCCCCCEEEEC
T ss_conf             74442898889991


No 179
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B
Probab=33.98  E-value=22  Score=15.05  Aligned_cols=85  Identities=9%  Similarity=0.085  Sum_probs=49.8

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCE
Q ss_conf             65538999708867989999862046741589999977346677788609974741687335277678999997333940
Q gi|254780911|r   82 EATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVE  161 (288)
Q Consensus        82 ~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~D  161 (288)
                      ++.|+||+..+- +          .|... +     +|-+-+..+.++.|.......+-.++.+.....+.+.+...+.|
T Consensus         9 ~p~rvavitvsD-~----------rg~~~-D-----~nGp~L~~~l~~~G~~v~~~~iv~Dd~~~~~~~l~~~~~~~~~d   71 (172)
T 1mkz_A            9 IPTRIAILTVSN-R----------RGEED-D-----TSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQ   71 (172)
T ss_dssp             CCCEEEEEEECS-S----------CCGGG-C-----HHHHHHHHHHHHTTCEEEEEEEECSCHHHHHHHHHHHHHSSSCC
T ss_pred             CCCEEEEEEEEC-C----------CCCCC-C-----CHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCC
T ss_conf             686899999848-9----------88676-6-----73999999999859957763105885799999999987625676


Q ss_pred             EEEECCCC----CCCCHHHHHHCCCC
Q ss_conf             99982767----54887786327784
Q gi|254780911|r  162 LMILARYM----QILSDHLCHKMTGR  183 (288)
Q Consensus       162 livLAgym----ril~~~~~~~~~~~  183 (288)
                      +|+..|=.    +-++++.+...-.+
T Consensus        72 lIiTtGGtg~g~~D~t~ea~~~~~~~   97 (172)
T 1mkz_A           72 VVLITGGTGLTEGDQAPEALLPLFDR   97 (172)
T ss_dssp             EEEEESCCSSSTTCCHHHHHGGGCSE
T ss_pred             EEEECCCEECCCCCCCHHHHHHHHHH
T ss_conf             15852531347776679999886665


No 180
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 3ng1_A 1ffh_A 2ng1_A*
Probab=33.72  E-value=22  Score=15.03  Aligned_cols=149  Identities=11%  Similarity=0.090  Sum_probs=77.0

Q ss_pred             CCCCCCCEEEEEC----CCCCCHHHHHHHHCCCCCEEEEEEEEECCHHH----HHHHHHCCCCEEECCCCCCCHHHHHHH
Q ss_conf             4456553899970----88679899998620467415899999773466----777886099747416873352776789
Q gi|254780911|r   79 NTKEATKTLILVS----QPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH----KKLVENYQLPFYYLPMTEQNKIESEQK  150 (288)
Q Consensus        79 ~~~~~~riailvS----g~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~----~~lA~~~gIP~~~i~~~~~~k~~~e~~  150 (288)
                      ....++++.+|+-    |.-+++.-|-...+......-++..-+.|..+    +.+|+..|+|++.... ..+.......
T Consensus        93 ~~~~~~~i~~lvG~~G~GKTTt~aKLA~~~~~~g~kv~li~~Dt~R~~A~eQL~~~a~~~~v~~~~~~~-~~~~~~~~~~  171 (295)
T 1ls1_A           93 PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMD-GESPESIRRR  171 (295)
T ss_dssp             CCCCSSEEEEEECCTTTTHHHHHHHHHHHHHHTTCCEEEEECCSSCHHHHHHHHHHHHHHTCCEEECCT-TCCHHHHHHH
T ss_pred             CCCCCCEEEEEECCCCCCCEEHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECC-CCCHHHHHHH
T ss_conf             456896499996778898521199999999877984457741455533899999999864963895068-8766899999


Q ss_pred             HHHHHHHCCCEE--EEECCCCCCCCHHH--HHHCCCCEEEECCCC--CCCCCCCCHHHHHHH--CCCCEEEEEEEEEECC
Q ss_conf             999973339409--99827675488778--632778479613366--767899995899974--2683762257753055
Q gi|254780911|r  151 LINIIEKNNVEL--MILARYMQILSDHL--CHKMTGRIINIHHSF--LPSFKGANPYKQAYE--YGVKIIGATAHYAICE  222 (288)
Q Consensus       151 il~~l~~~~~Dl--ivLAgymril~~~~--~~~~~~~iiNiHpsl--LP~f~G~~~y~~A~~--~Gvk~~G~TvH~V~~~  222 (288)
                      ..+..+..+.|+  |=.||.++.=...+  +..+. +.+|-|.-+  |++--|.+..++|..  .-+.+.|+=.--+|+.
T Consensus       172 ~~~~~~~~~~d~vlIDTaGr~~~~~~l~~el~~i~-~~~~p~~~~LVl~a~~~~~~~~~~~~f~~~~~~~~~I~TKlDet  250 (295)
T 1ls1_A          172 VEEKARLEARDLILVDTAGRLQIDEPLMGELARLK-EVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGD  250 (295)
T ss_dssp             HHHHHHHHTCCEEEEECCCCSSCCHHHHHHHHHHH-HHHCCSEEEEEEEGGGTHHHHHHHHHHHHHTCCCEEEEECGGGC
T ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH-HHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             99998752886699956663020688999999999-85198558998538887306999999986359975999701378


Q ss_pred             CCCCCEE
Q ss_conf             6888344
Q gi|254780911|r  223 LDAGPII  229 (288)
Q Consensus       223 lD~GpII  229 (288)
                      -.-|.++
T Consensus       251 ~~~G~~l  257 (295)
T 1ls1_A          251 ARGGAAL  257 (295)
T ss_dssp             SSCHHHH
T ss_pred             CCCCHHH
T ss_conf             8630999


No 181
>3hh8_A Metal ABC transporter substrate-binding lipoprotein; metal binding, cell membrane, copper, copper transport, ION transport; 1.87A {Streptococcus pyogenes serotype M1} PDB: 1psz_A
Probab=32.88  E-value=23  Score=14.93  Aligned_cols=56  Identities=18%  Similarity=0.205  Sum_probs=36.1

Q ss_pred             EEEEEEEEECCHHHHHHHHHCCCCEEECCC---CCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             158999997734667778860997474168---73352776789999973339409998
Q gi|254780911|r  110 ALNIVGVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMIL  165 (288)
Q Consensus       110 ~~eI~~VISN~~d~~~lA~~~gIP~~~i~~---~~~~k~~~e~~il~~l~~~~~DlivL  165 (288)
                      +..-..+++.|+...-+++.+|++...+..   ..+-....=+++.+.+++.++..|+.
T Consensus       180 ~~~~~~~v~~h~a~~Yf~~~ygl~~~~~~~~~~~~e~s~~~l~~l~~~ik~~~v~~if~  238 (294)
T 3hh8_A          180 AENKKLIVTSEGCFKYFSKAYGVPSAYIWEINTEEEGTPDQISSLIEKLKVIKPSALFV  238 (294)
T ss_dssp             CGGGCCEEEEESCCHHHHHHHTCCEEEEESSCCSCCCCHHHHHHHHHHHHHSCCSCEEE
T ss_pred             CCCCEEEEEECHHHHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             45550332106077999998698140344667755468899999999998739978997


No 182
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E
Probab=32.26  E-value=23  Score=14.87  Aligned_cols=58  Identities=21%  Similarity=0.146  Sum_probs=30.9

Q ss_pred             CCCCCHHHHHHCCCCEEEECCC--CCCCCCCCCHH---HHHHHCC-------CCEEEEEEEEEECCCCCCC
Q ss_conf             7548877863277847961336--67678999958---9997426-------8376225775305568883
Q gi|254780911|r  169 MQILSDHLCHKMTGRIINIHHS--FLPSFKGANPY---KQAYEYG-------VKIIGATAHYAICELDAGP  227 (288)
Q Consensus       169 mril~~~~~~~~~~~iiNiHps--lLP~f~G~~~y---~~A~~~G-------vk~~G~TvH~V~~~lD~Gp  227 (288)
                      +|..-|.+.++-.++|||+--.  .. .++|..+|   +.|+..=       ..-.|.+|.-|.++.=.-|
T Consensus       122 ~~~~~~~m~~~~~g~Iv~isS~~~~~-~~~~~~~Y~asKaal~~lt~~la~e~~~~gIrvN~I~PG~v~T~  191 (248)
T 3op4_A          122 SKAVLRGMMKKRQGRIINVGSVVGTM-GNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETD  191 (248)
T ss_dssp             HHHHHHHHHHHTCEEEEEECCHHHHH-CCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBSST
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHCC-CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             99999999976997899981634478-99995899999999999789889986324908999951989773


No 183
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A*
Probab=32.23  E-value=20  Score=15.28  Aligned_cols=121  Identities=12%  Similarity=0.067  Sum_probs=52.5

Q ss_pred             CCCCEEEEECCCCCC-HHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             655389997088679-8999986204674158999997734667778860997474168733527767899999733394
Q gi|254780911|r   82 EATKTLILVSQPDHC-LNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNV  160 (288)
Q Consensus        82 ~~~riailvSg~gsn-L~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~  160 (288)
                      ...+++|+  |.|.- +.++-.+..   +.+....+++..+....+++..+-  +++...+++   .+ +.++.....+.
T Consensus       164 ~g~~VlV~--GaG~vG~~avq~ak~---~g~~~v~~~~~~~~~~~~~~~ga~--~v~~~~~~~---~~-~~~~~~~~~~~  232 (343)
T 2dq4_A          164 SGKSVLIT--GAGPIGLMAAMVVRA---SGAGPILVSDPNPYRLAFARPYAD--RLVNPLEED---LL-EVVRRVTGSGV  232 (343)
T ss_dssp             TTSCEEEE--CCSHHHHHHHHHHHH---TTCCSEEEECSCHHHHGGGTTTCS--EEECTTTSC---HH-HHHHHHHSSCE
T ss_pred             CCCEEEEE--CCCHHHHHHHHHHHH---CCCCEEEEECCCHHHHHHHHHCCC--EEEECCCCC---HH-HHHHHHCCCCC
T ss_conf             95999998--988899999999997---399389994583789999984998--998178753---02-33676349864


Q ss_pred             EEEEECCCCC-CCCHHH-HHHCCCCEEEECCCCCCCC-CCCCHHHHHHHCCCCEEEEEE
Q ss_conf             0999827675-488778-6327784796133667678-999958999742683762257
Q gi|254780911|r  161 ELMILARYMQ-ILSDHL-CHKMTGRIINIHHSFLPSF-KGANPYKQAYEYGVKIIGATA  216 (288)
Q Consensus       161 DlivLAgymr-il~~~~-~~~~~~~iiNiHpslLP~f-~G~~~y~~A~~~Gvk~~G~Tv  216 (288)
                      |.++-+.--. -+...+ +-+..++++-+-   +|+- .......+.+.++..+.|..-
T Consensus       233 d~v~~~~g~~~~~~~~~~~l~~gg~~~~~g---~~~~~~~~~~~~~~~~~~~~~~~~~~  288 (343)
T 2dq4_A          233 EVLLEFSGNEAAIHQGLMALIPGGEARILG---IPSDPIRFDLAGELVMRGITAFGIAG  288 (343)
T ss_dssp             EEEEECSCCHHHHHHHHHHEEEEEEEEECC---CCSSCEEECHHHHTGGGTCEEEECCS
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCEEEEE---CCCCCCCCCCHHHHHHCCEEEEEECC
T ss_conf             148983367322454789862798269982---35897555547788744539998127


No 184
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae}
Probab=32.10  E-value=23  Score=14.85  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=13.3

Q ss_pred             CCEEEEEEECCCCCCHHH-HHHHHHHHCC
Q ss_conf             964999998599876688-8999998579
Q gi|254780911|r    1 MSSYILTITCPSNEEITS-IIPDYLSTQG   28 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA-~VT~~La~~g   28 (288)
                      |.+-||.+ +.   |-|+ .+...|++.+
T Consensus        22 m~kkIlvl-Ga---G~vg~~~a~~L~~~~   46 (467)
T 2axq_A           22 MGKNVLLL-GS---GFVAQPVIDTLAAND   46 (467)
T ss_dssp             -CEEEEEE-CC---STTHHHHHHHHHTST
T ss_pred             CCCCEEEE-CC---CHHHHHHHHHHHHCC
T ss_conf             48828999-98---789999999997089


No 185
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482}
Probab=31.71  E-value=24  Score=14.80  Aligned_cols=13  Identities=0%  Similarity=0.138  Sum_probs=7.2

Q ss_pred             CCCEEEEECCCCC
Q ss_conf             3940999827675
Q gi|254780911|r  158 NNVELMILARYMQ  170 (288)
Q Consensus       158 ~~~DlivLAgymr  170 (288)
                      .++|++.+.-+..
T Consensus       106 ~~aDYv~~gPvf~  118 (210)
T 3ceu_A          106 HFYDYVFMSPIYD  118 (210)
T ss_dssp             GGSSEEEECCCC-
T ss_pred             HCCCEEEECCCCC
T ss_conf             5799689605678


No 186
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, structural genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 1li4_A* 1a7a_A*
Probab=31.23  E-value=24  Score=14.75  Aligned_cols=56  Identities=7%  Similarity=0.124  Sum_probs=37.3

Q ss_pred             CEEEEEEEEEC----CHHHH-HHHHHCCCCEEECCCCCCCHHHHHHHHHHHHH----HCCCEEEEECC
Q ss_conf             41589999977----34667-77886099747416873352776789999973----33940999827
Q gi|254780911|r  109 LALNIVGVVSN----HTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIE----KNNVELMILAR  167 (288)
Q Consensus       109 L~~eI~~VISN----~~d~~-~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~----~~~~DlivLAg  167 (288)
                      +.|++.+.-||    +++.. .|++ .|||.+  .++..+.+++...+.+.|.    +.+||+|+=-|
T Consensus        66 ~GA~V~~~~~Np~STqDdvaAaL~~-~Gi~Vf--A~~g~~~eey~~~~~~~L~~~~~~~~P~liiDDG  130 (436)
T 3h9u_A           66 LGAEVRWASCNIFSTQDHAAAAIAK-RGIPVF--AWKGETEEEYMWCMKQTLKGFSGDGYPNMLLDDG  130 (436)
T ss_dssp             TTCEEEEECSSTTTCCHHHHHHHHH-TTCCEE--ECTTCCHHHHHHHHHHTTSCBTTTBCCSEEEESS
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHH-CCCEEE--EECCCCHHHHHHHHHHHHHCCCCCCCEEEEEECC
T ss_conf             6988999558975323899999997-697799--8469998999999997631327888725898310


No 187
>1qzu_A Hypothetical protein MDS018; alpha-beta sandwich, lyase; HET: FMN; 2.91A {Homo sapiens} SCOP: c.34.1.1
Probab=30.76  E-value=24  Score=14.70  Aligned_cols=97  Identities=15%  Similarity=0.123  Sum_probs=46.7

Q ss_pred             CCCCCCCEEEEECCCCCCHH--HHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCC--EEECCCCC--CCHHHHHHHHH
Q ss_conf             44565538999708867989--99986204674158999997734667778860997--47416873--35277678999
Q gi|254780911|r   79 NTKEATKTLILVSQPDHCLN--DLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLP--FYYLPMTE--QNKIESEQKLI  152 (288)
Q Consensus        79 ~~~~~~riailvSg~gsnL~--~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP--~~~i~~~~--~~k~~~e~~il  152 (288)
                      ..++|+||++.+||.-.+..  +|+.+... .-.++|.+|.|.  .+..+.....+.  ...-+...  .+.......-+
T Consensus        15 ~~~~k~~ILl~vtGsIAayk~~~lv~~L~~-~~g~~V~vv~T~--sA~~FVtp~~l~~~~~~~~~~~~~~~~~~~~~~Hi   91 (206)
T 1qzu_A           15 LMERKFHVLVGVTGSVAALKLPLLVSKLLD-IPGLEVAVVTTE--RAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHI   91 (206)
T ss_dssp             -CCSSEEEEEEECSSGGGGTHHHHHHHHC----CEEEEEEECT--GGGGSSCGGGSCSCEECHHHHHHTCSSTTSCCHHH
T ss_pred             CCCCCCEEEEEEECHHHHHHHHHHHHHHHH-HCCCEEEEEECH--HHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCHHH
T ss_conf             336886699997048999989999999986-569789999886--89955595632556047754110123446642355


Q ss_pred             HHHHHCCCEEEEECCCCCCCCHHHHHHCCCCE
Q ss_conf             99733394099982767548877863277847
Q gi|254780911|r  153 NIIEKNNVELMILARYMQILSDHLCHKMTGRI  184 (288)
Q Consensus       153 ~~l~~~~~DlivLAgymril~~~~~~~~~~~i  184 (288)
                      ++.  ...|+++.|    =.|.+++.++.+.+
T Consensus        92 ~La--~~aDl~vVa----PATANtiaK~A~Gi  117 (206)
T 1qzu_A           92 DLR--RWADLLLVA----PLDANTLGKVASGI  117 (206)
T ss_dssp             HHH--TTCSEEEEE----EECHHHHHHHHTTC
T ss_pred             HCC--CCCCEEEEC----CCCHHHHHHHHCCC
T ss_conf             304--315889983----26588999985776


No 188
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis}
Probab=30.41  E-value=25  Score=14.66  Aligned_cols=15  Identities=13%  Similarity=0.539  Sum_probs=7.0

Q ss_pred             HHHHHHCCCEEEEEC
Q ss_conf             999733394099982
Q gi|254780911|r  152 INIIEKNNVELMILA  166 (288)
Q Consensus       152 l~~l~~~~~DlivLA  166 (288)
                      ++.+.+.++|-+||+
T Consensus       169 l~~l~~~~~d~lILG  183 (267)
T 2gzm_A          169 LQPLKNTDIDTLILG  183 (267)
T ss_dssp             HHHHHHSCCSEEEEC
T ss_pred             HHHHHHCCCCEEEEC
T ss_conf             989873899889974


No 189
>2pfs_A USP, universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.25A {Nitrosomonas europaea atcc 19718}
Probab=30.23  E-value=25  Score=14.64  Aligned_cols=41  Identities=17%  Similarity=0.225  Sum_probs=25.1

Q ss_pred             HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             77788609974741687335277678999997333940999827
Q gi|254780911|r  124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       124 ~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      ..+++.++++....-...   ......+++..++.++||||+..
T Consensus        77 ~~~~~~~~~~~~~~~~~~---g~~~~~I~~~a~~~~~dliV~G~  117 (150)
T 2pfs_A           77 SQIGNTLGIDPAHRWLVW---GEPREEIIRIAEQENVDLIVVGS  117 (150)
T ss_dssp             HHHHHHHTCCGGGEEEEE---SCHHHHHHHHHHHTTCSEEEEEE
T ss_pred             HHHHHHCCCCCCEEEEEE---CCHHHHHHHHHHHCCCCEEEEEC
T ss_conf             998985499752799981---88899999999863876798727


No 190
>2pjk_A 178AA long hypothetical molybdenum cofactor biosynthesis protein B; 3D-structure, structural genomics, NPPSFA; HET: PEG; 1.90A {Sulfolobus tokodaii} PDB: 3iwt_A*
Probab=30.09  E-value=25  Score=14.62  Aligned_cols=95  Identities=11%  Similarity=0.127  Sum_probs=55.3

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             45655389997088679899998620467415899999773466777886099747416873352776789999973339
Q gi|254780911|r   80 TKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNN  159 (288)
Q Consensus        80 ~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~  159 (288)
                      ..++.|++|+..|.. +....+   ..|.+.      =+|-+-+..+-+++|+.......-.++.++..+++.+.+...+
T Consensus        12 ~~~~~r~~Iitvgd~-~~~~~~---~~g~i~------D~ng~~L~~~L~~~G~~v~~~~~v~Dd~~~i~~al~~~~~~~~   81 (178)
T 2pjk_A           12 APKSLNFYVITISTS-RYEKLL---KKEPIV------DESGDIIKQLLIENGHKIIGYSLVPDDKIKILKAFTDALSIDE   81 (178)
T ss_dssp             -CCCCEEEEEEECHH-HHHHHH---TTCCCC------CHHHHHHHHHHHHTTCEEEEEEEECSCHHHHHHHHHHHHTCTT
T ss_pred             CCCCCEEEEEEECCC-CCCCCC---CCCCCC------CCHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHCCC
T ss_conf             898878999998478-876654---679875------5569999999998899898987859999999999999986548


Q ss_pred             CEEEEECCCCCC----CCHHHHHHCCCCE
Q ss_conf             409998276754----8877863277847
Q gi|254780911|r  160 VELMILARYMQI----LSDHLCHKMTGRI  184 (288)
Q Consensus       160 ~DlivLAgymri----l~~~~~~~~~~~i  184 (288)
                      .|+|+..|=+-.    ++++.+.++..+.
T Consensus        82 ~dlVittGG~g~~~~D~t~~~~~~~~~~~  110 (178)
T 2pjk_A           82 VDVIISTGGTGYSPTDITVETIRKLFDRE  110 (178)
T ss_dssp             CCEEEEESCCSSSTTCCHHHHHGGGCSEE
T ss_pred             CCEEECCCCCCCCCCCCHHHHHHHHCCEE
T ss_conf             86783258776777511299998734524


No 191
>1w2i_A Acylphosphatase; hydrolase, thermophilic, stability, amyloid; 1.5A {Pyrococcus horikoshii} SCOP: d.58.10.1 PDB: 1v3z_A 2w4d_A
Probab=30.06  E-value=25  Score=14.62  Aligned_cols=70  Identities=10%  Similarity=0.032  Sum_probs=50.9

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             99972885277798889874002320201244565538999708867989999862046741589999977
Q gi|254780911|r   49 ISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN  119 (288)
Q Consensus        49 i~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN  119 (288)
                      +.+.+...==-|+.-....|.+++..=.+++.+.- .+-+.+.|....+..++..++.|.-.+.|.-+-..
T Consensus         8 i~v~G~VQGVGFR~~v~~~A~~l~l~G~V~N~~dG-~Vei~~qG~~~~i~~f~~~l~~gp~~a~V~~i~~~   77 (91)
T 1w2i_A            8 LKIYGRVQGVGFRWSMQREARKLGVNGWVRNLPDG-SVEAVLEGDEERVEALIGWAHQGPPLARVTRVEVK   77 (91)
T ss_dssp             EEEEEECSSSSHHHHHHHHHHHHTCEEEEEECTTS-CEEEEEEEEHHHHHHHHHHTTTCSTTCEEEEEEEE
T ss_pred             EEEEEEEECCCCHHHHHHHHHHCCCEEEEEECCCC-EEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             99999786837769999999984998999999699-79999973999999999999669897399899999


No 192
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A*
Probab=29.98  E-value=25  Score=14.61  Aligned_cols=16  Identities=19%  Similarity=0.277  Sum_probs=7.4

Q ss_pred             HHHHHHHCCCCEEEEE
Q ss_conf             9999985798189734
Q gi|254780911|r   20 IPDYLSTQGCNILDIS   35 (288)
Q Consensus        20 VT~~La~~g~NI~~~~   35 (288)
                      +...+.+..+-|.|++
T Consensus        14 ~~~~l~~~k~ilFDlD   29 (306)
T 2oyc_A           14 LRDVLGRAQGVLFDCD   29 (306)
T ss_dssp             HHHHHHHCSEEEECSB
T ss_pred             HHHHHHCCCEEEEECC
T ss_conf             9999973999999488


No 193
>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A
Probab=29.91  E-value=25  Score=14.60  Aligned_cols=44  Identities=11%  Similarity=0.193  Sum_probs=30.4

Q ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEECCCCCC----CCHHHHHHCCCCE
Q ss_conf             3352776789999973339409998276754----8877863277847
Q gi|254780911|r  141 EQNKIESEQKLINIIEKNNVELMILARYMQI----LSDHLCHKMTGRI  184 (288)
Q Consensus       141 ~~~k~~~e~~il~~l~~~~~DlivLAgymri----l~~~~~~~~~~~i  184 (288)
                      ++++++-...+.+.+.+.++|+|+..|=+-.    ++++.+...-+|-
T Consensus        60 pDd~~~I~~~l~~~~~~~~~DlViTTGGtg~~~~D~T~ea~~~~~~~~  107 (189)
T 1jlj_A           60 PDEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIERE  107 (189)
T ss_dssp             CSCHHHHHHHHHHHHHTSCCSEEEEESCCSSSTTCCHHHHHHHHCSEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHCCCEE
T ss_conf             897899999999987523776899767556677885987864215534


No 194
>3f0h_A Aminotransferase; RER070207000802, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE LLP; 1.70A {Eubacterium rectale}
Probab=29.86  E-value=25  Score=14.60  Aligned_cols=54  Identities=11%  Similarity=0.198  Sum_probs=31.9

Q ss_pred             CEEEEECCCCCC-HHHHHHHHCCCCCEEEEEEEEEC-C--HHHHHHHHHCCCCEEECCCCC
Q ss_conf             389997088679-89999862046741589999977-3--466777886099747416873
Q gi|254780911|r   85 KTLILVSQPDHC-LNDLLYRWNIGTLALNIVGVVSN-H--TTHKKLVENYQLPFYYLPMTE  141 (288)
Q Consensus        85 riailvSg~gsn-L~~Ll~~~~~g~L~~eI~~VISN-~--~d~~~lA~~~gIP~~~i~~~~  141 (288)
                      .-+|+.+|.|+. +++.+...-.   +.+=++|++| +  .....+|+.+|++...++...
T Consensus        71 ~~~i~~~gsgT~a~ea~~~~l~~---~gd~vlv~~~G~f~~~~~~ia~~~G~~v~~i~~~~  128 (376)
T 3f0h_A           71 SKAVFMTCSSTGSMEAVVMNCFT---KKDKVLVIDGGSFGHRFVQLCEIHEIPYVALKLEH  128 (376)
T ss_dssp             CEEEEESSCHHHHHHHHHHHHCC---TTCCEEEEESSHHHHHHHHHHHHTTCCEEEEECCT
T ss_pred             CEEEEEECCHHHHHHHHHHHHCC---CCCEEEEEECCHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             75999908799999999998479---95989999598889999999998199744631689


No 195
>1q5x_A Regulator of RNAse E activity A; 3-layer sandwich, alpha-beta structure, parallel beta sheet, antiparallel beta sheet, hydrolase inhibitor; 2.00A {Escherichia coli} SCOP: c.8.7.1
Probab=29.55  E-value=13  Score=16.52  Aligned_cols=30  Identities=17%  Similarity=-0.089  Sum_probs=11.4

Q ss_pred             EEEECCCCCCHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             999708867989999862046741589999977
Q gi|254780911|r   87 LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN  119 (288)
Q Consensus        87 ailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN  119 (288)
                      |+=++-.++|.. +..+.++. =+.+| +|+..
T Consensus        36 a~Tv~~~~d~~~-~~~ai~~~-~~G~V-lVvd~   65 (161)
T 1q5x_A           36 IITVKCFEDNGL-LYDLLEQN-GRGRV-LVVDG   65 (161)
T ss_dssp             EEEEECSSBCHH-HHHHHTSC-CTTEE-EEEEC
T ss_pred             EEEEEECCCHHH-HHHHHHCC-CCCEE-EEEEC
T ss_conf             999997385799-99999623-97829-99989


No 196
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis}
Probab=29.43  E-value=26  Score=14.55  Aligned_cols=18  Identities=17%  Similarity=0.344  Sum_probs=11.7

Q ss_pred             HHHHHHHHHCCCEEEEEC
Q ss_conf             899999733394099982
Q gi|254780911|r  149 QKLINIIEKNNVELMILA  166 (288)
Q Consensus       149 ~~il~~l~~~~~DlivLA  166 (288)
                      ..+++...+.++|+||+.
T Consensus       101 ~~i~~~a~~~~~DLiV~G  118 (319)
T 3olq_A          101 EAIIEEVITDKHDLLIKM  118 (319)
T ss_dssp             HHHHHHHHHHTCSEEEEE
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999996598889741


No 197
>1t9k_A Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} SCOP: c.124.1.5
Probab=29.10  E-value=26  Score=14.51  Aligned_cols=64  Identities=8%  Similarity=0.067  Sum_probs=39.3

Q ss_pred             CCCCCCHHHHHHHHCCCCCEEEEEEEEE-CCHHHHH--H----HHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEE
Q ss_conf             0886798999986204674158999997-7346677--7----8860997474168733527767899999733394099
Q gi|254780911|r   91 SQPDHCLNDLLYRWNIGTLALNIVGVVS-NHTTHKK--L----VENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELM  163 (288)
Q Consensus        91 Sg~gsnL~~Ll~~~~~g~L~~eI~~VIS-N~~d~~~--l----A~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dli  163 (288)
                      ++.|+.|..|..+++.|..   +.+++. .+|...+  +    ..+.|||+.+++.+         .+--++...++|+|
T Consensus       164 ~~~gTal~~i~~a~~~gk~---~~V~v~EtrP~~qG~~lta~~L~~~GI~~tlI~D~---------a~~~~m~~~~Vd~V  231 (347)
T 1t9k_A          164 VDYGTALGVIRAAVESGKR---IRVFADETRPYLQGARLTAWELMKDGIEVYVITDN---------MAGWLMKRGLIDAV  231 (347)
T ss_dssp             SSSCSHHHHHHHHHHTTCC---EEEEEECCTTTTHHHHTHHHHHHTTTCEEEEECGG---------GHHHHHHTTCCSEE
T ss_pred             ECCCCHHHHEEEEEECCCE---EEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEECC---------HHHHHHHHCCCCEE
T ss_conf             1343201023677506954---79996268876631688999986548228999654---------88888653440078


Q ss_pred             EEC
Q ss_conf             982
Q gi|254780911|r  164 ILA  166 (288)
Q Consensus       164 vLA  166 (288)
                      ++.
T Consensus       232 ivG  234 (347)
T 1t9k_A          232 VVG  234 (347)
T ss_dssp             EEC
T ss_pred             EEC
T ss_conf             850


No 198
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural genomics, JCSG, PSI, protein structure initiative; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1
Probab=28.92  E-value=26  Score=14.49  Aligned_cols=79  Identities=16%  Similarity=0.198  Sum_probs=45.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEE
Q ss_conf             55389997088679899998620467415899999773466777886099747416873352776789999973339409
Q gi|254780911|r   83 ATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVEL  162 (288)
Q Consensus        83 ~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dl  162 (288)
                      ...++|..+|....+ ....+..   +.+....+++..+.-..++++.|-. +.+..++.+-++.-+++.+.-...++|.
T Consensus       196 ~~~vlv~G~G~vG~~-~~~la~~---~~~~~v~v~~~~~~k~~~~~~lGa~-~vid~~~~~~~~~~~~i~~~t~g~g~D~  270 (380)
T 1vj0_A          196 GKTVVIQGAGPLGLF-GVVIARS---LGAENVIVIAGSPNRLKLAEEIGAD-LTLNRRETSVEERRKAIMDITHGRGADF  270 (380)
T ss_dssp             TCEEEEECCSHHHHH-HHHHHHH---TTBSEEEEEESCHHHHHHHHHTTCS-EEEETTTSCHHHHHHHHHHHTTTSCEEE
T ss_pred             CCEEEECCCCCHHHH-HHHHHHH---CCCCEEEEEECCHHHHHHHHHCCCE-EEEECCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             999999488724379-9999986---0686399997988999999974984-9982787998999999999738967629


Q ss_pred             EEEC
Q ss_conf             9982
Q gi|254780911|r  163 MILA  166 (288)
Q Consensus       163 ivLA  166 (288)
                      |+=+
T Consensus       271 vid~  274 (380)
T 1vj0_A          271 ILEA  274 (380)
T ss_dssp             EEEC
T ss_pred             EEEC
T ss_conf             9989


No 199
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Vibrio parahaemolyticus AQ3810}
Probab=28.87  E-value=26  Score=14.48  Aligned_cols=32  Identities=19%  Similarity=0.161  Sum_probs=24.5

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEE
Q ss_conf             96499999859987668889999985798189734
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDIS   35 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~   35 (288)
                      |+..  .+++-. .||=.+++..|+++|+++.=.+
T Consensus         1 MkiV--lITGas-sGIG~a~A~~la~~G~~V~l~~   32 (230)
T 3guy_A            1 MSLI--VITGAS-SGLGAELAKLYDAEGKATYLTG   32 (230)
T ss_dssp             --CE--EEESTT-SHHHHHHHHHHHHTTCCEEEEE
T ss_pred             CCEE--EEECCC-CHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9999--991877-1999999999998799899998


No 200
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A
Probab=28.79  E-value=18  Score=15.62  Aligned_cols=15  Identities=13%  Similarity=0.355  Sum_probs=10.8

Q ss_pred             CCEEEEEEEEECCHH
Q ss_conf             741589999977346
Q gi|254780911|r  108 TLALNIVGVVSNHTT  122 (288)
Q Consensus       108 ~L~~eI~~VISN~~d  122 (288)
                      ..++.+.+|.+||..
T Consensus        73 ~~~ipv~~i~GNHD~   87 (333)
T 1ii7_A           73 EHSIPVFAIEGNHDR   87 (333)
T ss_dssp             TTTCCEEEECCTTTC
T ss_pred             HCCCCEEEECCCCCC
T ss_conf             689959996466662


No 201
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reductase family; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp}
Probab=28.31  E-value=27  Score=14.42  Aligned_cols=27  Identities=11%  Similarity=0.123  Sum_probs=15.5

Q ss_pred             EEECCCCCCHHHHHHHHHHHCCCCEEEE
Q ss_conf             9985998766888999998579818973
Q gi|254780911|r    7 TITCPSNEEITSIIPDYLSTQGCNILDI   34 (288)
Q Consensus         7 ti~CpD~~GIVA~VT~~La~~g~NI~~~   34 (288)
                      .+++-- .||=.+++..|++.|+++.=.
T Consensus         7 lITGas-sGIG~aia~~la~~G~~V~~~   33 (235)
T 3l6e_A            7 IVTGAG-SGLGRALTIGLVERGHQVSMM   33 (235)
T ss_dssp             EEESTT-SHHHHHHHHHHHHTTCEEEEE
T ss_pred             EEECCC-CHHHHHHHHHHHHCCCEEEEE
T ss_conf             998874-599999999999879989999


No 202
>1o4w_A PIN (PILT N-terminus) domain; AF0591, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Archaeoglobus fulgidus} SCOP: c.120.1.1
Probab=27.99  E-value=27  Score=14.38  Aligned_cols=45  Identities=13%  Similarity=0.082  Sum_probs=33.4

Q ss_pred             CCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCC
Q ss_conf             08867989999862046741589999977346677788609974741687
Q gi|254780911|r   91 SQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMT  140 (288)
Q Consensus        91 Sg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~  140 (288)
                      +..+++-..|+..++...     ..|++|-.+++..|+..|||..++.-+
T Consensus        94 ~~~~~~Dd~Il~~a~~~~-----~~v~T~Dk~Lr~~a~~~GVpvi~l~~k  138 (147)
T 1o4w_A           94 ETESEGDPSLIEAAEKYG-----CILITNDKELKRKAKQRGIPVGYLKED  138 (147)
T ss_dssp             CCSSCSHHHHHHHHHHHT-----CEEECCCHHHHHHHHHTTCCEECCCCC
T ss_pred             CCCCCHHHHHHHHHHHCC-----CEEEECCHHHHHHHHHCCCCEEEEECC
T ss_conf             778634699999999749-----289967899999998679988999278


No 203
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6
Probab=27.80  E-value=27  Score=14.36  Aligned_cols=13  Identities=15%  Similarity=-0.026  Sum_probs=7.2

Q ss_pred             CEEEEEEEEECCH
Q ss_conf             4158999997734
Q gi|254780911|r  109 LALNIVGVVSNHT  121 (288)
Q Consensus       109 L~~eI~~VISN~~  121 (288)
                      .+..+.+|.+||+
T Consensus        62 ~~~pv~~v~GNHD   74 (228)
T 1uf3_A           62 AHLPTAYVPGPQD   74 (228)
T ss_dssp             GCSCEEEECCTTS
T ss_pred             CCCCEEEEECCCC
T ss_conf             5775899968998


No 204
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A
Probab=27.28  E-value=28  Score=14.30  Aligned_cols=98  Identities=14%  Similarity=0.144  Sum_probs=45.8

Q ss_pred             CCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCCCCHHHHHHHH-HHHHHHCCCEEEEECCC
Q ss_conf             8679899998620467415899999773466777---8860997474168733527767899-99973339409998276
Q gi|254780911|r   93 PDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTEQNKIESEQKL-INIIEKNNVELMILARY  168 (288)
Q Consensus        93 ~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~~~k~~~e~~i-l~~l~~~~~DlivLAgy  168 (288)
                      ..++..+|++-++..  +++.+.|=+..+-+.++   -+..|||.+ =|.++..+-|.++.. -++++++++-   -|.|
T Consensus        52 ~~~d~~~i~~~~~~~--~idlvivgpe~pL~~Gl~D~l~~~gi~vf-GP~~~aA~lE~sK~fak~~m~~~~IP---ta~~  125 (431)
T 3mjf_A           52 AATDIAGLLAFAQSH--DIGLTIVGPEAPLVIGVVDAFRAAGLAIF-GPTQAAAQLEGSKAFTKDFLARHNIP---SAEY  125 (431)
T ss_dssp             CTTCHHHHHHHHHHT--TEEEEEECSHHHHHTTHHHHHHHTTCCEE-SCCHHHHHHHHCHHHHHHHHHHTTCS---BCCE
T ss_pred             CCCCHHHHHHHHHHC--CCCEEEECCCHHHHHHHHHHHHHCCCCEE-CCCHHHHHHHHHHHHHHHHHHHCCCC---CCCE
T ss_conf             866999999999982--99989989748988779999974799333-87788878776199999998752658---8746


Q ss_pred             CCCCC----HHHHHHCCCCEEEECCCCCCCCCC
Q ss_conf             75488----778632778479613366767899
Q gi|254780911|r  169 MQILS----DHLCHKMTGRIINIHHSFLPSFKG  197 (288)
Q Consensus       169 mril~----~~~~~~~~~~iiNiHpslLP~f~G  197 (288)
                      -..-+    .+|++.++..+ =|-|+-|-+-+|
T Consensus       126 ~~~~~~~~a~~~~~~~~~p~-VIK~dgla~GKG  157 (431)
T 3mjf_A          126 QNFTDVEAALAYVRQKGAPI-VIKADGLAAGKG  157 (431)
T ss_dssp             EEESCHHHHHHHHHHHCSSE-EEEESSSCTTCS
T ss_pred             EEECCHHHHHHHHHCCCCCE-EEEECCCCCCCC
T ss_conf             99589999998752569877-997166678776


No 205
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotide, structural genomics, NPPSFA; 2.80A {Thermus thermophilus HB8}
Probab=27.04  E-value=28  Score=14.27  Aligned_cols=20  Identities=15%  Similarity=0.187  Sum_probs=8.0

Q ss_pred             EEEECCHHHHHHHHHCCCCE
Q ss_conf             99977346677788609974
Q gi|254780911|r  115 GVVSNHTTHKKLVENYQLPF  134 (288)
Q Consensus       115 ~VISN~~d~~~lA~~~gIP~  134 (288)
                      .+++|.+++...+++.+-|.
T Consensus       120 ~~~~~~~ea~~~~~~~~~P~  139 (417)
T 2ip4_A          120 RVFREPLEALAYLEEVGVPV  139 (417)
T ss_dssp             EEESSHHHHHHHHHHHCSSE
T ss_pred             EEEECHHHHHHHHHHCCCCE
T ss_conf             49935899999999769988


No 206
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A*
Probab=26.64  E-value=29  Score=14.22  Aligned_cols=85  Identities=15%  Similarity=0.145  Sum_probs=40.8

Q ss_pred             CHHHHHHHHCCCCCEEEEEEEEECCHHHHH---HHHHCCCCEEECCCCC-CCHHHHHHHHHHHHHHCCCEEEEECCCCCC
Q ss_conf             989999862046741589999977346677---7886099747416873-352776789999973339409998276754
Q gi|254780911|r   96 CLNDLLYRWNIGTLALNIVGVVSNHTTHKK---LVENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMILARYMQI  171 (288)
Q Consensus        96 nL~~Ll~~~~~g~L~~eI~~VISN~~d~~~---lA~~~gIP~~~i~~~~-~~k~~~e~~il~~l~~~~~DlivLAgymri  171 (288)
                      .+.+++..   .  +.+++.|-+.......   .|-++|++.+.  -+. ....+.-.++.++..+.+ ..++..||++-
T Consensus        57 ~~~~ll~~---~--~~D~V~i~tp~~~H~~~~~~al~~gkhv~~--EKP~a~~~~e~~~l~~~a~~~~-~~~~~v~~~~R  128 (344)
T 3mz0_A           57 NDDSLLAD---E--NVDAVLVTSWGPAHESSVLKAIKAQKYVFC--EKPLATTAEGCMRIVEEEIKVG-KRLVQVGFMRR  128 (344)
T ss_dssp             SHHHHHHC---T--TCCEEEECSCGGGHHHHHHHHHHTTCEEEE--CSCSCSSHHHHHHHHHHHHHHS-SCCEEECCGGG
T ss_pred             CHHHHHCC---C--CCCEEEECCCCCCHHHHHHHHHHCCCCEEE--CCCCCCCCHHHHHHHHHHHHHC-CCEEEEEEEEE
T ss_conf             99999559---9--988899626521159999999854997264--6874212004789999987520-43057542122


Q ss_pred             CCHHHHH-------HCCCCEEEEC
Q ss_conf             8877863-------2778479613
Q gi|254780911|r  172 LSDHLCH-------KMTGRIINIH  188 (288)
Q Consensus       172 l~~~~~~-------~~~~~iiNiH  188 (288)
                      ..|.+..       ...+++.++|
T Consensus       129 ~~p~~~~~k~~i~~g~~g~~~~~~  152 (344)
T 3mz0_A          129 YDSGYVQLKEALDNHVIGEPLMIH  152 (344)
T ss_dssp             GSHHHHHHHHHHHTTTTSSEEEEE
T ss_pred             ECHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             013789999987641257532210


No 207
>1gtf_A Trp RNA-binding attenuation protein (trap); RNA binding protein/RNA, transcription attenuation, RNA-binding protein, Trp RNA; HET: TRP; 1.75A {Bacillus stearothermophilus} SCOP: b.82.5.1 PDB: 1c9s_A* 1gtn_A* 1qaw_A* 1utd_A* 1utf_A* 1utv_A* 2zp8_A* 2zcz_A* 2zp9_A* 2zd0_A* 2ext_A* 2exs_A* 1wap_A*
Probab=26.21  E-value=17  Score=15.89  Aligned_cols=30  Identities=40%  Similarity=0.478  Sum_probs=22.2

Q ss_pred             HHHHCCCCEEEEEE-----EEEECCCCCCCE-EEEE
Q ss_conf             99742683762257-----753055688834-4444
Q gi|254780911|r  203 QAYEYGVKIIGATA-----HYAICELDAGPI-IEQD  232 (288)
Q Consensus       203 ~A~~~Gvk~~G~Tv-----H~V~~~lD~GpI-I~Q~  232 (288)
                      +|.|.||.++|.|-     ---+|.||.|.+ |+|-
T Consensus        11 kA~enGV~viGLTRG~dTkFhHtEKLDkgEVmiaQF   46 (74)
T 1gtf_A           11 KALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQF   46 (74)
T ss_dssp             EESSTTEEEEEEECSSSCCEEEEEEECTTCEEEEEC
T ss_pred             EECCCCEEEEEECCCCCCCCCCHHHCCCCCEEEEEE
T ss_conf             971088389976037765302121047772999984


No 208
>3mah_A Aspartokinase; aspartate kinase, structural genomics, MCSG, transferase, PSI-2, protein structure initiative; 2.31A {Porphyromonas gingivalis}
Probab=25.98  E-value=29  Score=14.14  Aligned_cols=35  Identities=0%  Similarity=-0.058  Sum_probs=28.8

Q ss_pred             EEEEEECC---CCCCHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             99999859---987668889999985798189734443
Q gi|254780911|r    4 YILTITCP---SNEEITSIIPDYLSTQGCNILDISQFN   38 (288)
Q Consensus         4 ~iLti~Cp---D~~GIVA~VT~~La~~g~NI~~~~Q~~   38 (288)
                      ..+++.++   +++|+.+++.+.++++|.||.-+.|..
T Consensus        19 ~~i~i~~~~~~~~~g~~~~if~~l~~~~I~vd~i~~s~   56 (157)
T 3mah_A           19 TVIKVKSSNKLLSWHFMRKLFEIFEFYQEPVDMVATSE   56 (157)
T ss_dssp             EEEEEEECTTSCHHHHHHHHHHHHHHTTCCCSCEECCS
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999568978844399999999998199889996587


No 209
>3ffy_A Putative tetrapyrrole (corrin/porphyrin) methylase; structural genomics, APC62130.1, methyltransferase, PSI-2; 2.00A {Bacteroides fragilis nctc 9343} PDB: 3fq6_A
Probab=25.89  E-value=29  Score=14.22  Aligned_cols=26  Identities=19%  Similarity=0.201  Sum_probs=17.5

Q ss_pred             HHHHHHHHCCCCCEEEEEEEEECCHH
Q ss_conf             89999862046741589999977346
Q gi|254780911|r   97 LNDLLYRWNIGTLALNIVGVVSNHTT  122 (288)
Q Consensus        97 L~~Ll~~~~~g~L~~eI~~VISN~~d  122 (288)
                      +.+++...+...+.+|+++||+..+|
T Consensus        90 ~~ei~~~~~~~~~KGE~viVI~g~~e  115 (115)
T 3ffy_A           90 LSELIEHFTATDPRGEIVIVLAGIDD  115 (115)
T ss_dssp             HHHHHHHHHHSCCCSSEEEEECCC--
T ss_pred             HHHHHHHHHCCCCCEEEEEEEECCCC
T ss_conf             99999986448986069999965889


No 210
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: NAD; 2.50A {Legionella pneumophila subsp}
Probab=25.88  E-value=30  Score=14.13  Aligned_cols=60  Identities=13%  Similarity=0.194  Sum_probs=22.8

Q ss_pred             CCCCCCCCEEEEECCC-CCCHHHHHHHHCCCCCE-EEEEEEEECCHHHHHHHHHCCCCEEECCCC
Q ss_conf             2445655389997088-67989999862046741-589999977346677788609974741687
Q gi|254780911|r   78 RNTKEATKTLILVSQP-DHCLNDLLYRWNIGTLA-LNIVGVVSNHTTHKKLVENYQLPFYYLPMT  140 (288)
Q Consensus        78 ~~~~~~~riailvSg~-gsnL~~Ll~~~~~g~L~-~eI~~VISN~~d~~~lA~~~gIP~~~i~~~  140 (288)
                      +...-++||+|+..|. |++...+|.+...  .. .+| .|+.-+++...++.+.|++|.....+
T Consensus         8 ~~~~f~~kILiIG~GsVG~~vl~lL~rh~d--~~~~~i-tVid~~~~~~~~~~~~g~~~~~~~ld   69 (480)
T 2ph5_A            8 KKILFKNRFVILGFGCVGQALMPLIFEKFD--IKPSQV-TIIAAEGTKVDVAQQYGVSFKLQQIT   69 (480)
T ss_dssp             TCBCCCSCEEEECCSHHHHHHHHHHHHHBC--CCGGGE-EEEESSCCSCCHHHHHTCEEEECCCC
T ss_pred             EEEEECCCEEEECCCHHHHHHHHHHHHCCC--CCCCEE-EEECCCHHHHHHHHHCCCCEEEEECC
T ss_conf             277527988998987758999999985426--787649-99766555788887528843676338


No 211
>1oya_A OLD yellow enzyme; oxidoreductase (flavoprotein); HET: FMN; 2.00A {Saccharomyces pastorianus} SCOP: c.1.4.1 PDB: 1oyb_A* 1oyc_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A*
Probab=25.76  E-value=25  Score=14.58  Aligned_cols=25  Identities=8%  Similarity=-0.186  Sum_probs=13.1

Q ss_pred             EEEEEECCHHHHHHHHHCCCCEEEC
Q ss_conf             9999977346677788609974741
Q gi|254780911|r  113 IVGVVSNHTTHKKLVENYQLPFYYL  137 (288)
Q Consensus       113 I~~VISN~~d~~~lA~~~gIP~~~i  137 (288)
                      |.-+|.....+..+|++.|.....|
T Consensus       167 I~~ii~~f~~aA~~A~~AGfDGVEI  191 (400)
T 1oya_A          167 IKQYIKEYVQAAKNSIAAGADGVEI  191 (400)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCSEEEE
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999999999999998749786887


No 212
>1ulr_A Putative acylphosphatase; hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: d.58.10.1
Probab=25.70  E-value=30  Score=14.10  Aligned_cols=60  Identities=15%  Similarity=0.121  Sum_probs=46.4

Q ss_pred             HHHHHHHHHHCCCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             7798889874002320201244565538999708867989999862046741589999977
Q gi|254780911|r   59 LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN  119 (288)
Q Consensus        59 ~l~~~f~~ia~~~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN  119 (288)
                      -|+.-....|.+++..=.+++.+.- .+-+++.|....+.+++..++.|.-.+.|.-|-..
T Consensus        16 GFR~~~~~~A~~l~l~G~V~N~~dG-~Vei~~qG~~~~v~~f~~~l~~gp~~a~V~~i~~~   75 (88)
T 1ulr_A           16 GYRAFAQKKALELGLSGYAENLPDG-RVEVVAEGPKEALELFLHHLKQGPRLARVEAVEVQ   75 (88)
T ss_dssp             SHHHHHHHHHHHTTCEEEEEECTTS-CEEEEEESCHHHHHHHHHHHHHCSTTCEEEEEEEE
T ss_pred             CCHHHHHHHHHHCCCEEEEEECCCC-CEEEEEEECHHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             6889999999980998999999999-89999995999999999999739997299999999


No 213
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}
Probab=25.48  E-value=30  Score=14.08  Aligned_cols=146  Identities=10%  Similarity=0.056  Sum_probs=66.0

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCCEEEEE---EEE---ECC----CCHHHHHHHHHHHHCC
Q ss_conf             964999998599876688899999857981897344432436889999---999---728----8527779888987400
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR---ISF---VFN----TCMKLFIADFQPIVQQ   70 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q~~D~~~~~FFmR---i~f---~~~----~~~~~l~~~f~~ia~~   70 (288)
                      |++|-+.+.|+...|=-+-+-.++ +....+.+. .++..+.....+.   ..+   +..    ................
T Consensus         5 ~k~~~I~lvG~~~vGKSSLin~l~-~~~~~~~~~-~~~t~~~~~~~~~~~~~~~~~~d~~g~~~~~~~~~~~~~~~~~~~   82 (188)
T 2wjg_A            5 MKSYEIALIGNPNVGKSTIFNALT-GENVYIGNW-PGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYII   82 (188)
T ss_dssp             CCEEEEEEECSTTSSHHHHHHHHH-TTCEEEEEC-TTSCCEEEEEEEEETTEEEEEEECCCCSCCSSSSHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH-CCCCEEECC-CCCEECCCCEEEEEECCCCEEECCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             654589999999987999999996-899636335-761002200255662021002304763222110025778888876


Q ss_pred             CCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHH----------HHHHHHCCCCEEECCCC
Q ss_conf             23202012445655389997088679899998620467415899999773466----------77788609974741687
Q gi|254780911|r   71 FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH----------KKLVENYQLPFYYLPMT  140 (288)
Q Consensus        71 ~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~----------~~lA~~~gIP~~~i~~~  140 (288)
                                ....-+++++.-..+...++.......+.+..+. ++.|+-|+          ..+++..|+|++.++..
T Consensus        83 ----------~~~~~~v~~~~d~~~~~~~~~~~~~l~~~~~~~i-iV~NK~Dl~~~~~~~~~~~~l~~~~~~~~~~vSAk  151 (188)
T 2wjg_A           83 ----------NEKPDLVVNIVDATALERNLYLTLQLMEMGANLL-LALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAA  151 (188)
T ss_dssp             ----------HHCCSEEEEEEEGGGHHHHHHHHHHHHTTTCCEE-EEEECHHHHHHTTCCCCHHHHHHHHTSCEEECBGG
T ss_pred             ----------HCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCC-EEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             ----------4046389984144320236788877665212562-48874000020426999999998659958999867


Q ss_pred             C-CCHHHHHHHHHHHHHHCC
Q ss_conf             3-352776789999973339
Q gi|254780911|r  141 E-QNKIESEQKLINIIEKNN  159 (288)
Q Consensus       141 ~-~~k~~~e~~il~~l~~~~  159 (288)
                      . .+=++.-+++.+.+++..
T Consensus       152 ~g~gi~~L~~~i~~~l~~~~  171 (188)
T 2wjg_A          152 KKMGIEELKKAISIAVKDKK  171 (188)
T ss_dssp             GTBSHHHHHHHHHHHHTTC-
T ss_pred             CCCCHHHHHHHHHHHHHHCC
T ss_conf             89899999999999865436


No 214
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A*
Probab=25.03  E-value=31  Score=14.02  Aligned_cols=19  Identities=0%  Similarity=-0.029  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHCCCCCCEE
Q ss_conf             7779888987400232020
Q gi|254780911|r   58 KLFIADFQPIVQQFSLQYS   76 (288)
Q Consensus        58 ~~l~~~f~~ia~~~~m~~~   76 (288)
                      ..+...+++.+++++.+..
T Consensus        17 ~~~~~g~~~~a~~~G~~~~   35 (288)
T 1gud_A           17 VDMKKGIEDEAKTLGVSVD   35 (288)
T ss_dssp             HHHHHHHHHHHHHHTCCEE
T ss_pred             HHHHHHHHHHHHHCCCEEE
T ss_conf             9999999999997499799


No 215
>1zzg_A Glucose-6-phosphate isomerase; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.95A {Thermus thermophilus HB8}
Probab=24.81  E-value=31  Score=13.99  Aligned_cols=80  Identities=13%  Similarity=0.169  Sum_probs=44.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHH-----HCC---C-CCEEEEEEEE
Q ss_conf             999997288527779888987400232020124456553899970886798999986-----204---6-7415899999
Q gi|254780911|r   47 MRISFVFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYR-----WNI---G-TLALNIVGVV  117 (288)
Q Consensus        47 mRi~f~~~~~~~~l~~~f~~ia~~~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~-----~~~---g-~L~~eI~~VI  117 (288)
                      .++-|-.+.+.+.+...+..+             +.+.-..|.+||.|++++-+...     +-.   + ...-.+.+|-
T Consensus        93 ~~~~f~~n~d~~~~~~~l~~l-------------~~~~tl~iviSKSg~T~Et~~~~~~~~~~l~~~~~~~~~~~~v~iT  159 (415)
T 1zzg_A           93 VRFHYLDHVEPEPILRLLRTL-------------DPRKTLVNAVSKSGSTAETLAGLAVFLKWLKAHLGEDWRRHLVVTT  159 (415)
T ss_dssp             CEEEEECSCCHHHHHHHHHHS-------------CGGGEEEEEEESSSCCHHHHHHHHHHHHHHHHHHGGGGGGGEEEEE
T ss_pred             CCEEEECCCCHHHHHHHHHCC-------------CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             708994689989999999628-------------9422799998189898789999999999987520138876557774


Q ss_pred             ECCHH-HHHHHHHCCCCEEECCC
Q ss_conf             77346-67778860997474168
Q gi|254780911|r  118 SNHTT-HKKLVENYQLPFYYLPM  139 (288)
Q Consensus       118 SN~~d-~~~lA~~~gIP~~~i~~  139 (288)
                      ++.+. +..+|+..++..+.+|.
T Consensus       160 ~~~~~~l~~~a~~~~~~~f~~p~  182 (415)
T 1zzg_A          160 DPKEGPLRAFAEREGLKAFAIPK  182 (415)
T ss_dssp             CSSSSHHHHHHHHHTCEEEECCT
T ss_pred             HCCHHHHHHHHHHCCCCEEECCC
T ss_conf             12089999987645742885577


No 216
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana}
Probab=24.74  E-value=3.8  Score=20.36  Aligned_cols=39  Identities=13%  Similarity=0.012  Sum_probs=20.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEEE
Q ss_conf             4665188889999999999999999999999987691788
Q gi|254780911|r  232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFI  271 (288)
Q Consensus       232 ~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~~  271 (288)
                      -.+.|.++||+.+|.+++.+.+. +-+...+++..|+++.
T Consensus        27 ~~l~V~~~dTV~~lK~~I~~~~g-ip~~~Q~Li~~Gk~L~   65 (94)
T 2kan_A           27 FTVEVDRTETVSSLKDKIHIVEN-TPIKRMQLYYSGIELA   65 (94)
T ss_dssp             EEEEECTTCBHHHHHHHHHHHSS-SCTTTEEEEETTEEEC
T ss_pred             EEEEECCCCHHHHHHHHHHHHHC-CCCCCEEEEECCEECC
T ss_conf             99998996949999999988879-8902189999998945


No 217
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}
Probab=24.25  E-value=32  Score=13.92  Aligned_cols=85  Identities=14%  Similarity=0.187  Sum_probs=47.7

Q ss_pred             EEEEEECCHHHHHH----HHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCC-HHHHHHCCCCEEEE
Q ss_conf             99999773466777----88609974741687335277678999997333940999827675488-77863277847961
Q gi|254780911|r  113 IVGVVSNHTTHKKL----VENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS-DHLCHKMTGRIINI  187 (288)
Q Consensus       113 I~~VISN~~d~~~l----A~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAgymril~-~~~~~~~~~~iiNi  187 (288)
                      =.+||-+.+..+.+    .++.|.......    +.    .+.++.+++..+|+|++--.|--.. -+++++...+    
T Consensus         9 kILiVDD~~~~r~~l~~~L~~~g~~v~~a~----~g----~~Al~~l~~~~~dlvi~D~~mP~~dG~~~~~~ir~~----   76 (130)
T 3eod_A            9 QILIVEDEQVFRSLLDSWFSSLGATTVLAA----DG----VDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNR----   76 (130)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCEEEEES----CH----HHHHHHHTTCCCSEEEECCC-----CHHHHHHHHHT----
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEEC----CH----HHHHHHHHCCCCCEEHHHHCCCCCCHHHHHHHHHHH----
T ss_conf             899996989999999999998899999989----99----999999852898874574217999899999999960----


Q ss_pred             CCCCCC-----CCCCCCHHHHHHHCCCC
Q ss_conf             336676-----78999958999742683
Q gi|254780911|r  188 HHSFLP-----SFKGANPYKQAYEYGVK  210 (288)
Q Consensus       188 HpslLP-----~f~G~~~y~~A~~~Gvk  210 (288)
                       +.-.|     ++.......+|++.|+.
T Consensus        77 -~~~~piI~lt~~~~~~~~~~a~~~Ga~  103 (130)
T 3eod_A           77 -GDQTPVLVISATENMADIAKALRLGVE  103 (130)
T ss_dssp             -TCCCCEEEEECCCCHHHHHHHHHHCCS
T ss_pred             -CCCCCEEEEECCCCHHHHHHHHHCCCC
T ss_conf             -989989999899999999999986998


No 218
>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3
Probab=24.23  E-value=32  Score=13.92  Aligned_cols=44  Identities=16%  Similarity=0.142  Sum_probs=26.4

Q ss_pred             ECCCCCCHHHHHHHHCCCCCEEEEEEEEECC---HHHHHHHHHCCCCEEECC
Q ss_conf             7088679899998620467415899999773---466777886099747416
Q gi|254780911|r   90 VSQPDHCLNDLLYRWNIGTLALNIVGVVSNH---TTHKKLVENYQLPFYYLP  138 (288)
Q Consensus        90 vSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~---~d~~~lA~~~gIP~~~i~  138 (288)
                      +...|+.+.++-..-     .+...+|++..   .-++.+.+++||||...+
T Consensus       219 ~~~gg~~le~i~~~~-----~A~lniv~~~~~~~~~A~~L~~~~GiPyi~~~  265 (458)
T 1mio_B          219 YPEGGTKIEDLKDTG-----NSDLTLSLGSYASDLGAKTLEKKCKVPFKTLR  265 (458)
T ss_dssp             SCSCSBCHHHHHTTS-----SCSEEEEESHHHHHHHHHHHHHHSCCCEEEEC
T ss_pred             ECCCCCCHHHHHHHH-----CCCEEEEECHHHHHHHHHHHHHHHCCCEEECC
T ss_conf             327999799999764-----18899998855657899999998699878558


No 219
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP, protein structure initiative; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4
Probab=24.21  E-value=32  Score=13.92  Aligned_cols=38  Identities=0%  Similarity=0.050  Sum_probs=25.3

Q ss_pred             HHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             788609974741687335277678999997333940999827
Q gi|254780911|r  126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       126 lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      .++..|+++..+-. ..   .....|++..+++++|+||+..
T Consensus        95 ~~~~~~v~~~~~~~-~G---~~~~~I~~~a~~~~~dlIVmG~  132 (175)
T 2gm3_A           95 KCHEIGVGCEAWIK-TG---DPKDVICQEVKRVRPDFLVVGS  132 (175)
T ss_dssp             HHHHHTCEEEEEEE-ES---CHHHHHHHHHHHHCCSEEEEEE
T ss_pred             HHHHCCCCEEEEEE-EC---CHHHHHHHHHHHCCCCEEEECC
T ss_conf             99974982688985-34---6427789999972898899628


No 220
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1
Probab=24.21  E-value=32  Score=13.92  Aligned_cols=32  Identities=16%  Similarity=0.091  Sum_probs=22.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             99998599876688899999857981897344
Q gi|254780911|r    5 ILTITCPSNEEITSIIPDYLSTQGCNILDISQ   36 (288)
Q Consensus         5 iLti~CpD~~GIVA~VT~~La~~g~NI~~~~Q   36 (288)
                      |++..+--...-.+++...+.+.+..|+=+|+
T Consensus        22 vl~~Nv~~~~~~~~~l~~~i~~~~~DIi~lQE   53 (245)
T 1wdu_A           22 VLQANLQRKKLATAELAIEAATRKAAIALIQE   53 (245)
T ss_dssp             EEEEECTTCHHHHHHHHHHHHHHTCSEEEEES
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             99220499756799999999862998899986


No 221
>3i1m_F 30S ribosomal protein S6; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_F 1p87_F* 1vs7_F* 2avy_F 2aw7_F 1vs5_F 2i2u_F 2i2p_F* 2qan_F* 2qb9_F* 2qbb_F* 2qbd_F 2qbf_F 2qbh_F* 2qbj_F* 2qou_F* 2qow_F* 2qoy_F* 2qp0_F* 2vho_F ...
Probab=23.92  E-value=32  Score=13.88  Aligned_cols=65  Identities=8%  Similarity=0.171  Sum_probs=44.0

Q ss_pred             CCEEEEE-EECCCC----CCHHHHHHHHHHHCCCCEEEEEEEE--------CCCCCEEEEEEEEECCC-CHHHHHHHHH
Q ss_conf             9649999-985998----7668889999985798189734443--------24368899999997288-5277798889
Q gi|254780911|r    1 MSSYILT-ITCPSN----EEITSIIPDYLSTQGCNILDISQFN--------DLDTSKLFMRISFVFNT-CMKLFIADFQ   65 (288)
Q Consensus         1 M~~~iLt-i~CpD~----~GIVA~VT~~La~~g~NI~~~~Q~~--------D~~~~~FFmRi~f~~~~-~~~~l~~~f~   65 (288)
                      |+.|=+. +.-|+.    ..++..+...|.+.||.|+..+...        ...+..+|.-+.|.++. .++.|...|.
T Consensus         1 Mr~YE~~~Il~p~~~e~~~~~~~~~~~~i~~~gg~i~~~~~wG~r~LAY~I~K~~~G~Y~~~~f~~~~~~i~el~~~lk   79 (135)
T 3i1m_F            1 MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFR   79 (135)
T ss_dssp             CCEECBEEEECSTTTTSHHHHHHHHHHHHHHTTCEECCCEEEEEECCSSCTTSSSCEEEEECCEECCTTHHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHCCCCCCCEEEEEEEEEEECHHHHHHHHHHHC
T ss_conf             9863399996888078999999999999986898899975023421001135789899999999849999999999965


No 222
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata}
Probab=23.68  E-value=32  Score=13.85  Aligned_cols=42  Identities=7%  Similarity=0.154  Sum_probs=25.6

Q ss_pred             HHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             7788609974741687335277678999997333940999827
Q gi|254780911|r  125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       125 ~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      ..+...++|..-+...- ......+++++..++.++|+||++.
T Consensus        77 ~~~~~~~~~~~~~~~~v-~~g~~~~~I~~~a~~~~~dliV~G~  118 (147)
T 3hgm_A           77 TRATELGVPADKVRAFV-KGGRPSRTIVRFARKRECDLVVIGA  118 (147)
T ss_dssp             HHHHHTTCCGGGEEEEE-EESCHHHHHHHHHHHTTCSEEEECS
T ss_pred             HHHHHHCCCCCEEEEEE-ECCCHHHHHHHHHCCCCCCEEEECC
T ss_conf             99998289974699999-6377899887752035888899717


No 223
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus}
Probab=23.66  E-value=32  Score=13.85  Aligned_cols=18  Identities=11%  Similarity=0.209  Sum_probs=11.2

Q ss_pred             EEEECCCCCCCCHHHHHH
Q ss_conf             999827675488778632
Q gi|254780911|r  162 LMILARYMQILSDHLCHK  179 (288)
Q Consensus       162 livLAgymril~~~~~~~  179 (288)
                      ++|+++=|=-++++.++.
T Consensus        90 vlv~~~D~P~i~~~~i~~  107 (197)
T 3d5n_A           90 VLVALGDMPFVTKEDVNK  107 (197)
T ss_dssp             EEEEETTCCCSCHHHHHH
T ss_pred             EEEECCCCCCCCHHHHHH
T ss_conf             999028868799999999


No 224
>2dfa_A Hypothetical UPF0271 protein TTHB195; lactam utilization protein, structural genomics, NPPSFA; 1.90A {Thermus thermophilus HB8} SCOP: c.6.2.5
Probab=23.42  E-value=33  Score=13.82  Aligned_cols=125  Identities=9%  Similarity=0.051  Sum_probs=62.8

Q ss_pred             CHHHHHHHHHHHHCCCCCCEECCCCCCCC----CEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCC
Q ss_conf             52777988898740023202012445655----38999708867989999862046741589999977346677788609
Q gi|254780911|r   56 CMKLFIADFQPIVQQFSLQYSIRNTKEAT----KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQ  131 (288)
Q Consensus        56 ~~~~l~~~f~~ia~~~~m~~~i~~~~~~~----riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~g  131 (288)
                      +.+.+... -.+|++.+..+.-++..+-+    |..+-.|  ...|.+++.. +-              ..+.++|+.+|
T Consensus        41 D~~~m~~t-v~lA~~~~V~IGAHPsypD~~gFGRr~~~~s--~~el~~~i~~-Qi--------------~al~~~a~~~g  102 (250)
T 2dfa_A           41 SPGRILEA-VRLAKAHGVAVGAHPGFPDLVGFGRREMALS--PEEVYADVLY-QI--------------GALSAFLKAEG  102 (250)
T ss_dssp             CHHHHHHH-HHHHHHTTCEEEEECCCSCTTTTTCSCCCCC--HHHHHHHHHH-HH--------------HHHHHHHHHTT
T ss_pred             CHHHHHHH-HHHHHHCCCEEECCCCCCCCCCCCCCCCCCC--HHHHHHHHHH-HH--------------HHHHHHHHHCC
T ss_conf             79999999-9999985987814799776457999878899--9999999999-99--------------99999999819


Q ss_pred             CCEEECC-CCC-CCH----HHHHHHHHHHHHHCCCEEEEECCCCCCCC--------HHHHHHCCCCEEEECCCCCC-CCC
Q ss_conf             9747416-873-352----77678999997333940999827675488--------77863277847961336676-789
Q gi|254780911|r  132 LPFYYLP-MTE-QNK----IESEQKLINIIEKNNVELMILARYMQILS--------DHLCHKMTGRIINIHHSFLP-SFK  196 (288)
Q Consensus       132 IP~~~i~-~~~-~~k----~~~e~~il~~l~~~~~DlivLAgymril~--------~~~~~~~~~~iiNiHpslLP-~f~  196 (288)
                      .+..|+. |.- .|.    ++.-..+.+.+++++++|++++-....+.        +-+.+.|..|--|=--+|.| +-+
T Consensus       103 ~~l~hVKpHGALYn~~~~d~~la~ai~~ai~~~~~~l~l~~~~~s~~~~~A~~~Gl~~~~E~FADR~Y~~dG~Lv~R~~~  182 (250)
T 2dfa_A          103 LPLHHVKPHGALYLKACRDRETARAIALAVKAFDPGLPLVVLPGTVYEEEARKAGLRVVLEAFPERAYLRSGQLAPRSMP  182 (250)
T ss_dssp             CCCCCBCCCHHHHHHHHHCHHHHHHHHHHHHHHCTTCCEEECTTSHHHHHHHHTTCCEEEEECTTBCBCTTSSBCCTTST
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEECCC
T ss_conf             97522050278999998659999999999998599867998378478999998699668999732668899988863265


Q ss_pred             CC
Q ss_conf             99
Q gi|254780911|r  197 GA  198 (288)
Q Consensus       197 G~  198 (288)
                      |+
T Consensus       183 gA  184 (250)
T 2dfa_A          183 GS  184 (250)
T ss_dssp             TC
T ss_pred             CC
T ss_conf             22


No 225
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum}
Probab=23.08  E-value=33  Score=13.77  Aligned_cols=51  Identities=20%  Similarity=0.267  Sum_probs=24.2

Q ss_pred             CCCCCHH--HHHHHCCCCEEEEEEEEE-ECCC-CCCCEEEEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             8999958--999742683762257753-0556-888344444665188889999999999999
Q gi|254780911|r  195 FKGANPY--KQAYEYGVKIIGATAHYA-ICEL-DAGPIIEQDVVRVTHAQTIEDYIAIGKNIE  253 (288)
Q Consensus       195 f~G~~~y--~~A~~~Gvk~~G~TvH~V-~~~l-D~GpII~Q~~~~v~~~dt~~~l~~~~~~~E  253 (288)
                      |-|-.+.  ..|...|++.++++-=+. .+++ +.||-.     -   -++.++|.+.+.++|
T Consensus       164 ~VgDs~~Di~aA~~~Gi~ti~v~~g~~~~~~l~~~~~d~-----v---i~~~~el~~~l~~l~  218 (226)
T 3mc1_A          164 MIGDREYDVIGALKNNLPSIGVTYGFGSYEELKNAGANY-----I---VNSVDELHKKILELR  218 (226)
T ss_dssp             EEESSHHHHHHHHTTTCCEEEESSSSSCHHHHHHHTCSE-----E---ESSHHHHHHHHHTC-
T ss_pred             EECCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCE-----E---ECCHHHHHHHHHHHH
T ss_conf             752677779999986996999888999978897689999-----9---899999999999997


No 226
>1vkf_A Glycerol uptake operon antiterminator-related protein; TM1436, structural genomics, JCSG, PSI, protein structure initiative; HET: CIT; 1.65A {Thermotoga maritima MSB8} SCOP: c.1.29.1
Probab=22.74  E-value=34  Score=13.73  Aligned_cols=85  Identities=15%  Similarity=0.241  Sum_probs=54.3

Q ss_pred             EECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEE-EECC
Q ss_conf             970886798999986204674158999997734667778860997474168733527767899999733394099-9827
Q gi|254780911|r   89 LVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELM-ILAR  167 (288)
Q Consensus        89 lvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~Dli-vLAg  167 (288)
                      |+.|-++.=.++-+ .+.  .  ..-.+||.++..-..|++.|+.+..= .==-+...++. .++.++..+||+| +|-|
T Consensus        65 LI~GL~~D~~avef-Lk~--~--~~dGIISTk~~~I~~Ak~~Gl~tIqR-vFliDS~al~~-~~~~i~~~~PD~IEiLPG  137 (188)
T 1vkf_A           65 FVNGLGEGEEAILF-VKK--A--GADGIITIKPKNYVVAKKNGIPAVLR-FFALDSKAVER-GIEQIETLGVDVVEVLPG  137 (188)
T ss_dssp             GEETCCSSHHHHHH-HHH--H--TCSEEEESCHHHHHHHHHTTCCEEEE-EECCSHHHHHH-HHHHHHHHTCSEEEEESG
T ss_pred             CCCCCCCCHHHHHH-HHH--C--CCCEEEECCHHHHHHHHHCCCEEEEE-EEEEEHHHHHH-HHHHHHHCCCCEEEECCC
T ss_conf             17787898799999-997--6--99999968899999999869969999-87764678999-999986569999998750


Q ss_pred             CCCCCCHHHHHHCCCC
Q ss_conf             6754887786327784
Q gi|254780911|r  168 YMQILSDHLCHKMTGR  183 (288)
Q Consensus       168 ymril~~~~~~~~~~~  183 (288)
                      .   +.|.++++..++
T Consensus       138 ~---i~p~ii~~~~~~  150 (188)
T 1vkf_A          138 A---VAPKVARKIPGR  150 (188)
T ss_dssp             G---GHHHHHTTSTTS
T ss_pred             H---HHHHHHHHCCCC
T ss_conf             3---179999854698


No 227
>2fhm_A Probable acylphosphatase; hydrolase; NMR {Bacillus subtilis} PDB: 2hlt_A 2hlu_A 3br8_A
Probab=22.57  E-value=34  Score=13.70  Aligned_cols=58  Identities=16%  Similarity=0.182  Sum_probs=46.0

Q ss_pred             HHHHHHHHHCCCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             79888987400232020124456553899970886798999986204674158999997
Q gi|254780911|r   60 FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS  118 (288)
Q Consensus        60 l~~~f~~ia~~~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VIS  118 (288)
                      ++.-....|.+++..=.+++.+.- .+-+.+.|....+..++..++.|.-.+.|.-|-.
T Consensus        17 FR~~~~~~A~~lgl~G~V~N~~dG-~Vei~~~G~~~~i~~f~~~l~~gp~~a~V~~v~~   74 (91)
T 2fhm_A           17 FRYFVQMEADKRKLAGWVKNRDDG-RVEILAEGPENALQSFVEAVKNGSPFSKVTDISV   74 (91)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECTTS-CEEEEEEECHHHHHHHHHHHHTTCSSSEEEEEEE
T ss_pred             CHHHHHHHHHHCCCEEEEEECCCC-CEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             489999999983988999999999-8999998599999999999976999888999999


No 228
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima}
Probab=22.18  E-value=35  Score=13.65  Aligned_cols=87  Identities=11%  Similarity=0.117  Sum_probs=51.7

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             79899998620467415899999773466777---886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      +.+++||.+.     +.+.+.|.+.......+   |-++|++.+.  -+.  .+-+++ +++.++.++.+-.+++..||+
T Consensus        57 ~~~~ell~~~-----~iD~V~i~tp~~~H~~~~~~al~~gk~Vl~--EKP~a~~~~ea-~~l~~~~~~~~~~v~~~v~~~  128 (337)
T 3ip3_A           57 NNWWEMLEKE-----KPDILVINTVFSLNGKILLEALERKIHAFV--EKPIATTFEDL-EKIRSVYQKVRNEVFFTAMFG  128 (337)
T ss_dssp             SSHHHHHHHH-----CCSEEEECSSHHHHHHHHHHHHHTTCEEEE--CSSSCSSHHHH-HHHHHHHHHHTTTCCEEECCG
T ss_pred             CCHHHHHCCC-----CCCEEEEECCCHHHHHHHHHHHHCCCEEEE--ECCCCCCCHHH-HHHHHHHHCCCCCCCEECCEE
T ss_conf             9999996489-----988899958861679999999987996999--47854440122-234554320024322111245


Q ss_pred             CCCCHHHHHHC-------CCCEEEECC
Q ss_conf             54887786327-------784796133
Q gi|254780911|r  170 QILSDHLCHKM-------TGRIINIHH  189 (288)
Q Consensus       170 ril~~~~~~~~-------~~~iiNiHp  189 (288)
                      +...|.+....       -|++.-++-
T Consensus       129 ~r~~p~~~~~~~~i~~g~iG~i~~i~~  155 (337)
T 3ip3_A          129 IRYRPHFLTAKKLVSEGAVGEIRLVNT  155 (337)
T ss_dssp             GGGSHHHHHHHHHHHHTTTSSEEEEEE
T ss_pred             EECCCHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             541612333444211100000120057


No 229
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus}
Probab=22.16  E-value=25  Score=14.58  Aligned_cols=82  Identities=11%  Similarity=0.020  Sum_probs=43.7

Q ss_pred             CEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHH-HHHHHCCCC---EEECCCC---CCCHHHHHHHHHHHHHH
Q ss_conf             3899970886798999986204674158999997734667-778860997---4741687---33527767899999733
Q gi|254780911|r   85 KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK-KLVENYQLP---FYYLPMT---EQNKIESEQKLINIIEK  157 (288)
Q Consensus        85 riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~-~lA~~~gIP---~~~i~~~---~~~k~~~e~~il~~l~~  157 (288)
                      .+-|.=.-....+.-|-.++... -.+++.+|+=+...|. ++...+++.   ...-+..   .....+|..++.+.+..
T Consensus       104 ~~~i~K~W~~~~le~L~ea~~~~-~ka~v~~vv~d~g~A~i~~l~~~~i~~i~~~~~~~~~~~~~~~~~ff~~i~~~l~~  182 (352)
T 3oby_A          104 ELSIIKKWKPEQLERLRRAVEDS-NRPEIVMLTIEEGYAVAGVLRQWGVEEIFEERMGYGKGMGDSRKEFFGEVAAKLES  182 (352)
T ss_dssp             CEEEEEECCHHHHHHHHHHHTTS-CCCCEEEEEEETTEEEEEEEETTEEEEEEEEEC--------CCCCHHHHHHHHHHH
T ss_pred             EEEEEECCCHHHHHHHHHHHCCC-CCCCEEEEEECCCCEEEEEECCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             79999377989999999864502-48738999983894999998154799920002688876305799999999999860


Q ss_pred             CCCEEEEECC
Q ss_conf             3940999827
Q gi|254780911|r  158 NNVELMILAR  167 (288)
Q Consensus       158 ~~~DlivLAg  167 (288)
                      .+++.|++||
T Consensus       183 ~~~k~iIiaG  192 (352)
T 3oby_A          183 FDFKYLIVAG  192 (352)
T ss_dssp             HCCSEEEEEC
T ss_pred             CCCCEEEEEC
T ss_conf             5764799978


No 230
>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5
Probab=21.87  E-value=35  Score=13.61  Aligned_cols=72  Identities=13%  Similarity=0.195  Sum_probs=39.5

Q ss_pred             CCHHHHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECCCCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             79899998620467415899999773466777---886099747416873--3527767899999733394099982767
Q gi|254780911|r   95 HCLNDLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYM  169 (288)
Q Consensus        95 snL~~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~~~~--~~k~~~e~~il~~l~~~~~DlivLAgym  169 (288)
                      .++.+|+.       +.+++.|.+.......+   |-++|++.+.=  +.  .+.++. +++.++.++.++  .++-+|+
T Consensus        57 ~~~~~l~~-------~~D~V~I~tp~~~H~~~~~~al~~gkhv~~E--KP~~~~~~e~-~~l~~~~~~~~~--~~~v~~~  124 (319)
T 1tlt_A           57 DSLSSLAA-------SCDAVFVHSSTASHFDVVSTLLNAGVHVCVD--KPLAENLRDA-ERLVELAARKKL--TLMVGFN  124 (319)
T ss_dssp             SSHHHHHT-------TCSEEEECSCTTHHHHHHHHHHHTTCEEEEE--SSSCSSHHHH-HHHHHHHHHTTC--CEEEECG
T ss_pred             CCHHHHHC-------CCCEEEEECCCHHHHHHHHHHHHCCCEEEEE--CCCHHHHHHH-HHHHHHHHHCCC--EEEEEEC
T ss_conf             88999856-------9999999488666689999998619879996--3650246677-777777650363--1688631


Q ss_pred             CCCCHHHHH
Q ss_conf             548877863
Q gi|254780911|r  170 QILSDHLCH  178 (288)
Q Consensus       170 ril~~~~~~  178 (288)
                      +...|.+..
T Consensus       125 ~r~~p~~~~  133 (319)
T 1tlt_A          125 RRFAPLYGE  133 (319)
T ss_dssp             GGGCHHHHH
T ss_pred             CCCCHHHHH
T ss_conf             346869999


No 231
>2bjd_A Acylphosphatase; hyperthermophIle, hydrolase; 1.27A {Sulfolobus solfataricus} PDB: 2bje_A 1y9o_A
Probab=21.85  E-value=35  Score=13.61  Aligned_cols=60  Identities=17%  Similarity=0.121  Sum_probs=47.4

Q ss_pred             HHHHHHHHHHCCCCCCEECCCCCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEEC
Q ss_conf             7798889874002320201244565538999708867989999862046741589999977
Q gi|254780911|r   59 LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN  119 (288)
Q Consensus        59 ~l~~~f~~ia~~~~m~~~i~~~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN  119 (288)
                      -++.-....|.+++..=.+++.+.- ++-+.+.|....+.+++..++.|.-.+.|.-+-..
T Consensus        28 GFR~~v~~~A~~l~l~G~V~N~~dG-~Vei~~qG~~~~v~~fi~~l~~gp~~a~V~~i~~~   87 (101)
T 2bjd_A           28 GFRKFVQIHAIRLGIKGYAKNLPDG-SVEVVAEGYEEALSKLLERIKQGPPAAEVEKVDYS   87 (101)
T ss_dssp             SHHHHHHHHHHHTTCEEEEEECTTS-CEEEEEEEEHHHHHHHHHHHTTCSTTCEEEEEEEE
T ss_pred             CCHHHHHHHHHHCCCEEEEEECCCC-CEEEEEEECHHHHHHHHHHHHHCCCCCEEEEEEEE
T ss_conf             7189999999985997999999999-89999997999999999999758998888799999


No 232
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A
Probab=21.62  E-value=35  Score=13.58  Aligned_cols=30  Identities=13%  Similarity=0.114  Sum_probs=17.4

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCEE
Q ss_conf             96499999859987668889999985798189
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQGCNIL   32 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~g~NI~   32 (288)
                      |++..+.+.+--..|  ..+...|++.+.+++
T Consensus         1 M~~k~v~v~GaG~~g--~~~~~~L~~~~~~v~   30 (450)
T 1ff9_A            1 MATKSVLMLGSGFVT--RPTLDVLTDSGIKVT   30 (450)
T ss_dssp             -CCCEEEEECCSTTH--HHHHHHHHTTTCEEE
T ss_pred             CCCCEEEEECCCHHH--HHHHHHHHHCCCEEE
T ss_conf             998879998887999--999999983969699


No 233
>1gu7_A 2,4-dienoyl-COA reductase; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A
Probab=21.38  E-value=36  Score=13.54  Aligned_cols=125  Identities=9%  Similarity=0.012  Sum_probs=62.5

Q ss_pred             CCCCEEEEECCCCC-CHHHHHHHHCCCCCEEEEEEEEECCHHH---HHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             65538999708867-9899998620467415899999773466---7778860997474168733527767899999733
Q gi|254780911|r   82 EATKTLILVSQPDH-CLNDLLYRWNIGTLALNIVGVVSNHTTH---KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK  157 (288)
Q Consensus        82 ~~~riailvSg~gs-nL~~Ll~~~~~g~L~~eI~~VISN~~d~---~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~  157 (288)
                      +..+++|...|.|. .+..+..+.   .+.+++..++++.+..   ..++++.|... .+...+.+..++.+++.++...
T Consensus       166 ~~~~vlv~~~g~g~vG~~~~~lak---~~G~~vi~~~~~~~~~~~~~~~~~~lGa~~-vi~~~~~~~~~~~~~~~~~~~~  241 (364)
T 1gu7_A          166 PGKDWFIQNGGTSAVGKYASQIGK---LLNFNSISVIRDRPNLDEVVASLKELGATQ-VITEDQNNSREFGPTIKEWIKQ  241 (364)
T ss_dssp             TTTCEEEESCTTSHHHHHHHHHHH---HHTCEEEEEECCCTTHHHHHHHHHHHTCSE-EEEHHHHHCGGGHHHHHHHHHH
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHH---HCCCEEEEEECCCCCHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHC
T ss_conf             886699982453330578888898---789989999867843589999999749979-9948877467888999999750


Q ss_pred             --CCCEEEEEC-CCCCCCCHHHHH--HCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEEE
Q ss_conf             --394099982-767548877863--277847961336676789999589997426837622
Q gi|254780911|r  158 --NNVELMILA-RYMQILSDHLCH--KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGA  214 (288)
Q Consensus       158 --~~~DlivLA-gymril~~~~~~--~~~~~iiNiHpslLP~f~G~~~y~~A~~~Gvk~~G~  214 (288)
                        .++|+++=+ | -... ...++  +..|+++.+--  +...+..-+....+.++..+.|.
T Consensus       242 ~g~~vdvvid~vG-~~~~-~~~~~~l~~~G~iv~~G~--~~~~~~~~~~~~~~~k~~~i~g~  299 (364)
T 1gu7_A          242 SGGEAKLALNCVG-GKSS-TGIARKLNNNGLMLTYGG--MSFQPVTIPTSLYIFKNFTSAGF  299 (364)
T ss_dssp             HTCCEEEEEESSC-HHHH-HHHHHTSCTTCEEEECCC--CSSCCEEECHHHHHHSCCEEEEC
T ss_pred             CCCCCCEEEECCC-HHHH-HHHHHHHCCCCEEEEEEC--CCCCCCCCCHHHHHHCCEEEEEE
T ss_conf             5875337860664-7889-999986469979999947--77998776889998788189999


No 234
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding motif, oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2
Probab=21.31  E-value=36  Score=13.53  Aligned_cols=90  Identities=12%  Similarity=0.135  Sum_probs=43.2

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHH--HCCCCCEEEEEEEEECCHHHHHHHH--HCCCCEEECCCCCCCHHHHH---HHHH
Q ss_conf             456553899970886798999986--2046741589999977346677788--60997474168733527767---8999
Q gi|254780911|r   80 TKEATKTLILVSQPDHCLNDLLYR--WNIGTLALNIVGVVSNHTTHKKLVE--NYQLPFYYLPMTEQNKIESE---QKLI  152 (288)
Q Consensus        80 ~~~~~riailvSg~gsnL~~Ll~~--~~~g~L~~eI~~VISN~~d~~~lA~--~~gIP~~~i~~~~~~k~~~e---~~il  152 (288)
                      ....+|+ |+++|.++-+..=+-+  .+..+-.+.|.++--|.+.+..+.+  +.+-..++++.+-.+.++.+   +.+.
T Consensus        17 r~~~Mkt-VlITGas~GIG~aia~~l~~la~~G~~V~~~~R~~~~~~~l~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~i~   95 (267)
T 1sny_A           17 RGSHMNS-ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIE   95 (267)
T ss_dssp             ---CCSE-EEESCCSSHHHHHHHHHHHTSSSCCSEEEEEESCTTSCHHHHHHHHHCTTEEEEECCTTCGGGHHHHHHHHH
T ss_pred             CCCCCCE-EEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHH
T ss_conf             9999998-999189878999999999988867999999988989999999998529988999963799999999986555


Q ss_pred             HHHHHCCCEEEE-ECCCCC
Q ss_conf             997333940999-827675
Q gi|254780911|r  153 NIIEKNNVELMI-LARYMQ  170 (288)
Q Consensus       153 ~~l~~~~~Dliv-LAgymr  170 (288)
                      +..+.-.+|.+| -||++.
T Consensus        96 ~~~~~~~idiLvnNAg~~~  114 (267)
T 1sny_A           96 GVTKDQGLNVLFNNAGIAP  114 (267)
T ss_dssp             HHHGGGCCSEEEECCCCCC
T ss_pred             HHHCCCCEEEEEEECCCCC
T ss_conf             5422686379995033223


No 235
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A
Probab=21.10  E-value=36  Score=13.51  Aligned_cols=81  Identities=7%  Similarity=0.039  Sum_probs=45.6

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             45655389997088679899998620467415899999773466777886099747416873352776789999973339
Q gi|254780911|r   80 TKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNN  159 (288)
Q Consensus        80 ~~~~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~  159 (288)
                      ..+..+++|..+|.... .++..+..   +.+.-..+++.+++...+|++.|.. ++++.++   .+..+++.++.....
T Consensus       164 ~~~g~~vlI~GaG~~g~-~a~~~a~~---~g~~~v~~~~~~~~~~~~a~~lGa~-~~i~~~~---~~~~~~i~~~t~g~g  235 (352)
T 3fpc_A          164 IKLGDTVCVIGIGPVGL-MSVAGANH---LGAGRIFAVGSRKHCCDIALEYGAT-DIINYKN---GDIVEQILKATDGKG  235 (352)
T ss_dssp             CCTTCCEEEECCSHHHH-HHHHHHHT---TTCSSEEEECCCHHHHHHHHHHTCC-EEECGGG---SCHHHHHHHHTTTCC
T ss_pred             CCCCCEEEEECCCCCCC-HHHHHHHH---CCCCEEEEECCCHHHHHHHHHCCCC-EEEECCC---CCHHHHHHHHHCCCC
T ss_conf             89999789954786462-27999998---4993799954988999999966995-7861899---678999999855768


Q ss_pred             CEEEE-ECCC
Q ss_conf             40999-8276
Q gi|254780911|r  160 VELMI-LARY  168 (288)
Q Consensus       160 ~Dliv-LAgy  168 (288)
                      +|+|+ +.|-
T Consensus       236 ~D~v~D~~G~  245 (352)
T 3fpc_A          236 VDKVVIAGGD  245 (352)
T ss_dssp             EEEEEECSSC
T ss_pred             CCEEEECCCC
T ss_conf             8779997686


No 236
>1q7s_A BIT1, protein CGI-147; apoptosis; 2.00A {Homo sapiens} SCOP: c.131.1.1
Probab=21.09  E-value=36  Score=13.50  Aligned_cols=39  Identities=15%  Similarity=0.242  Sum_probs=29.1

Q ss_pred             HHHHHHCCCCCEEEEEEEEECCHHHHHH---HHHCCCCEEECC
Q ss_conf             9998620467415899999773466777---886099747416
Q gi|254780911|r   99 DLLYRWNIGTLALNIVGVVSNHTTHKKL---VENYQLPFYYLP  138 (288)
Q Consensus        99 ~Ll~~~~~g~L~~eI~~VISN~~d~~~l---A~~~gIP~~~i~  138 (288)
                      +.+..|..+. ...|++-+.|-+++..+   |++.|+|++.+.
T Consensus        41 ~~~~~W~~~g-~~KIvL~~~~e~~L~~l~~~a~~~~l~~~~v~   82 (117)
T 1q7s_A           41 EMLKQWEYCG-QPKVVVKAPDEETLIALLAHAKMLGLTVSLIQ   82 (117)
T ss_dssp             HHHHHHHHTT-CCEEEEEESSHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             HHHHHHHHCC-CCEEEEECCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9999997789-91799965999999999999998799889998


No 237
>2j28_9 Signal recognition particle 54; ribosome, protein/RNA complex; 8.0A {Escherichia coli}
Probab=20.98  E-value=36  Score=13.49  Aligned_cols=208  Identities=10%  Similarity=0.098  Sum_probs=96.8

Q ss_pred             HHHHHHHHHCCCCEEEEEEEECCCCCEEEEEEEEECCCC-HHHHHHHH-HHHHCCCCCC-EECCCCCCCCCEEEEE----
Q ss_conf             889999985798189734443243688999999972885-27779888-9874002320-2012445655389997----
Q gi|254780911|r   18 SIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-MKLFIADF-QPIVQQFSLQ-YSIRNTKEATKTLILV----   90 (288)
Q Consensus        18 A~VT~~La~~g~NI~~~~Q~~D~~~~~FFmRi~f~~~~~-~~~l~~~f-~~ia~~~~m~-~~i~~~~~~~riailv----   90 (288)
                      ..|...|-+.+.|..-..++.+.-.....-. +.....+ .+.+...+ .++..-++.. ..+.....++.+..||    
T Consensus        31 ~eI~~aLL~ADV~~~vv~~ii~~ik~~~~~~-~~~~~~~~~~~i~k~v~~eL~~~l~~~~~~l~~~~~~p~VIm~VGvnG  109 (430)
T 2j28_9           31 REVRMALLEADVALPVVREFINRVKEKAVGH-EVNKSLTPGQEFVKIVRNELVAAMGEENQTLNLAAQPPAVVLMAGLQG  109 (430)
T ss_dssp             HHHHHHHHTSSCCCHHHHHHHHHHHHHHTTC-CCCSSSCHHHHHHHHHHHHHHHHTTCSCCCCCSCSSSSCEEEEECSSS
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHC-CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCC
T ss_conf             9999999973899999999999999998317-467668829999999999999864766543442789985999975689


Q ss_pred             CCCCCCHHHHHHHHCCC-CCEEEEEEEEEC--CH----HHHHHHHHCCCCEEECCCCCC-CHHHHHHHHHHHHHHCCCEE
Q ss_conf             08867989999862046-741589999977--34----667778860997474168733-52776789999973339409
Q gi|254780911|r   91 SQPDHCLNDLLYRWNIG-TLALNIVGVVSN--HT----THKKLVENYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVEL  162 (288)
Q Consensus        91 Sg~gsnL~~Ll~~~~~g-~L~~eI~~VISN--~~----d~~~lA~~~gIP~~~i~~~~~-~k~~~e~~il~~l~~~~~Dl  162 (288)
                      ||.-+...-|-..++.. ...  +.+|-++  |+    -++.+|+..|+|++......+ ....++.--....+.+++=+
T Consensus       110 sGKTTTiaKLA~~~k~k~~kk--Vllva~DTfR~AA~eQLk~~a~~~~vpv~~~~~~~dp~~va~~ai~~ak~~~~Dvvi  187 (430)
T 2j28_9          110 AGKTTSVGKLGKFLREKHKKK--VLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAKLKFYDVLL  187 (430)
T ss_dssp             SSSTTTHHHHHHHHHTSSSCC--CCBCCCCCSSSCSHHHHHHHHHHTTCCCCCCSSCCCTTHHHHHHHHHHHHTTCSCEE
T ss_pred             CCCCCHHHHHHHHHHHHCCCE--EEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             985542999999999947985--899955755515899999998604777415665568789999999999986999899


Q ss_pred             EEECCCCCCCCHHHHHHCC--CCEEEECCCC--CCCCCCCCHHHHH--HHCCCCEEEEEEEEEECCCCCCCEE
Q ss_conf             9982767548877863277--8479613366--7678999958999--7426837622577530556888344
Q gi|254780911|r  163 MILARYMQILSDHLCHKMT--GRIINIHHSF--LPSFKGANPYKQA--YEYGVKIIGATAHYAICELDAGPII  229 (288)
Q Consensus       163 ivLAgymril~~~~~~~~~--~~iiNiHpsl--LP~f~G~~~y~~A--~~~Gvk~~G~TvH~V~~~lD~GpII  229 (288)
                      |=.||-++.=.. +.+...  .+.++-|..|  +.+--|.+...||  +..-+.++|+-.--.|+.--.|.++
T Consensus       188 iDTAGR~~~d~~-lm~El~~i~~~~~p~e~lLV~da~~gq~~~~qa~~f~~~~~~~gvIlTKlDg~akgG~al  259 (430)
T 2j28_9          188 VDTAGRLHVDEA-MMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAAL  259 (430)
T ss_dssp             EEECCCCSSHHH-HHHHHHHHHHHHCCSEEEEEEETTTGGGGHHHHHHHHTTCSSCEEEEECSSSCSCCTHHH
T ss_pred             EECCCCHHHHHH-HHHHHHHHHHHCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHH
T ss_conf             946763021599-999999999856985799984255675679999999863588605885025677730785


No 238
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP, structural genomics; HET: ATP; 2.50A {Thermococcus kodakarensis KOD1} SCOP: c.30.1.8 d.142.1.9
Probab=20.83  E-value=37  Score=13.47  Aligned_cols=15  Identities=20%  Similarity=0.268  Sum_probs=7.0

Q ss_pred             CHHHHHHHHHCCCCE
Q ss_conf             346677788609974
Q gi|254780911|r  120 HTTHKKLVENYQLPF  134 (288)
Q Consensus       120 ~~d~~~lA~~~gIP~  134 (288)
                      +...+.+.++.|||.
T Consensus        99 k~~~~~~l~~~GIp~  113 (320)
T 2pbz_A           99 FELQDKALEGAGIPR  113 (320)
T ss_dssp             HHHHHHHHHHHTCCB
T ss_pred             HHHHHHHHHHCCCCC
T ss_conf             999999999769997


No 239
>3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics, structural proteomics in europe, spine; 2.70A {Klebsiella pneumoniae}
Probab=20.77  E-value=37  Score=13.46  Aligned_cols=40  Identities=3%  Similarity=0.091  Sum_probs=19.7

Q ss_pred             HHCCCCEEECCC-CCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             860997474168-7335277678999997333940999827
Q gi|254780911|r  128 ENYQLPFYYLPM-TEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       128 ~~~gIP~~~i~~-~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      ++.||.+..+.. ..+...+.=.++.+..++.++|+||--|
T Consensus        60 ~~~gi~~~vf~~v~~~p~~~~v~~~~~~~~~~~~D~IiavG  100 (387)
T 3bfj_A           60 REAGIEVAIFDGVEPNPKDTNVRDGLAVFRREQCDIIVTVG  100 (387)
T ss_dssp             HHTTCEEEEECCCCSSCBHHHHHHHHHHHHHTTCCEEEEEE
T ss_pred             HHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             97699599983736899999999999988733998899808


No 240
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens}
Probab=20.68  E-value=11  Score=17.20  Aligned_cols=39  Identities=5%  Similarity=0.058  Sum_probs=24.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCEEE
Q ss_conf             4466518888999999999999999999999998769178
Q gi|254780911|r  231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF  270 (288)
Q Consensus       231 Q~~~~v~~~dt~~~l~~~~~~~E~~~l~~av~~~~e~rv~  270 (288)
                      +..+.|.+++|+.+|.+++.+.+. +-+.-.+|+..||++
T Consensus        36 ~~~i~V~~~~TV~~LK~~I~~~~~-ip~~~qrLi~~Gk~L   74 (101)
T 2klc_A           36 KEEFAVPENSSVQQFKEEISKRFK-SHTDQLVLIFAGKIL   74 (101)
T ss_dssp             EEEEEECSCCCHHHHHHHHHHHHT-CCGGGEEEEETTEEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHC-CCHHHEEEEECCEEC
T ss_conf             699998999929999999998889-197998846678098


No 241
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4
Probab=20.51  E-value=37  Score=13.42  Aligned_cols=40  Identities=23%  Similarity=0.296  Sum_probs=22.6

Q ss_pred             HHHHHCCCCEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             7788609974741687335277678999997333940999827
Q gi|254780911|r  125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILAR  167 (288)
Q Consensus       125 ~lA~~~gIP~~~i~~~~~~k~~~e~~il~~l~~~~~DlivLAg  167 (288)
                      .+++..+++....-....   .....+++..+++++|+||+..
T Consensus        71 ~~~~~~~~~~~~~~~~~~---~~~~~i~~~~~~~~~dliVvG~  110 (141)
T 1jmv_A           71 DLAESVDYPISEKLSGSG---DLGQVLSDAIEQYDVDLLVTGH  110 (141)
T ss_dssp             HHHHHSSSCCCCEEEEEE---CHHHHHHHHHHHTTCCEEEEEE
T ss_pred             HHHHHCCCCEEEEEEEEC---CHHHHHHHHHHHCCCCEEEEEC
T ss_conf             999871776289999606---7478899998727888899932


No 242
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, allostery, S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10
Probab=20.38  E-value=37  Score=13.40  Aligned_cols=17  Identities=29%  Similarity=0.434  Sum_probs=8.2

Q ss_pred             CEEEEECCCCCCHHHHH
Q ss_conf             38999708867989999
Q gi|254780911|r   85 KTLILVSQPDHCLNDLL  101 (288)
Q Consensus        85 riailvSg~gsnL~~Ll  101 (288)
                      +.+|-||-.|..=..|+
T Consensus        58 ~~vVVVSA~gg~Td~Ll   74 (510)
T 2cdq_A           58 SPVIVLSAMGKTTNNLL   74 (510)
T ss_dssp             CEEEEECCSTTHHHHHH
T ss_pred             CCEEEEECCCCCHHHHH
T ss_conf             94999959999747999


No 243
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1
Probab=20.32  E-value=38  Score=13.40  Aligned_cols=100  Identities=15%  Similarity=0.183  Sum_probs=57.8

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCCCCC--------CHHHHHHHHHHH
Q ss_conf             553899970886798999986204674158999997734667778860997474168733--------527767899999
Q gi|254780911|r   83 ATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQ--------NKIESEQKLINI  154 (288)
Q Consensus        83 ~~riailvSg~gsnL~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~~~~--------~k~~~e~~il~~  154 (288)
                      |||++|+=-|.| |+..+..+.+.  +.+++. |+++.+++.      +..-..+|=...        ........+.+.
T Consensus         2 ~mKi~IID~g~g-N~~Sv~~~l~~--lg~~~~-ii~~~~~l~------~~D~iIlPG~G~~~~~~~~l~~~~~~~~i~~~   71 (200)
T 1ka9_H            2 RMKALLIDYGSG-NLRSAAKALEA--AGFSVA-VAQDPKAHE------EADLLVLPGQGHFGQVMRAFQESGFVERVRRH   71 (200)
T ss_dssp             -CEEEEECSSCS-CHHHHHHHHHH--TTCEEE-EESSTTSCS------SCSEEEECCCSCHHHHHHTTSSSCTHHHHHHH
T ss_pred             CCEEEEEECCCC-HHHHHHHHHHH--CCCCEE-EECCHHHHH------HCCEEEECCCCCHHHHHHHHHHCCCHHHHHHH
T ss_conf             977999948985-89999999998--799899-988999985------37989995987589999766545929999999


Q ss_pred             HHHCCCEEEEECCCCCCCCHHH--------HHHCCCCEEEECCCCCC
Q ss_conf             7333940999827675488778--------63277847961336676
Q gi|254780911|r  155 IEKNNVELMILARYMQILSDHL--------CHKMTGRIINIHHSFLP  193 (288)
Q Consensus       155 l~~~~~DlivLAgymril~~~~--------~~~~~~~iiNiHpslLP  193 (288)
                      +....|=|=+++| ||+|....        +.-+.+++...-.+..|
T Consensus        72 ~~~~~PILGIClG-~QlL~~~s~e~~~~~gl~~~~g~v~~~~~~~~~  117 (200)
T 1ka9_H           72 LERGLPFLGICVG-MQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVP  117 (200)
T ss_dssp             HHTTCCEEECTHH-HHTTSSEETTSTTCCCCCSSSSEEEECCSSSSS
T ss_pred             HHCCCCEEEEHHH-HHHHHHCCCCCCCCCCCEEEEEEEECCCCCCCC
T ss_conf             8759938998299-999876472056657725822599525665243


No 244
>1yzq_A Small GTP binding protein RAB6 isoform; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.78A {Homo sapiens} SCOP: c.37.1.8 PDB: 3cwz_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*
Probab=20.17  E-value=38  Score=13.37  Aligned_cols=27  Identities=15%  Similarity=0.257  Sum_probs=23.6

Q ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHC
Q ss_conf             964999998599876688899999857
Q gi|254780911|r    1 MSSYILTITCPSNEEITSIIPDYLSTQ   27 (288)
Q Consensus         1 M~~~iLti~CpD~~GIVA~VT~~La~~   27 (288)
                      |++|-+.+.|....|=.+-+..+..+.
T Consensus         4 ~~~~KI~vvG~~~vGKSsLi~~~~~~~   30 (170)
T 1yzq_A            4 LRKFKLVFLGEQSVGKTSLITRFMYDS   30 (170)
T ss_dssp             ---CEEEEEESTTSSHHHHHHHHHHSC
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             876899999949979999999998397


No 245
>2jya_A AGR_C_3324P, uncharacterized protein ATU1810; protein with unknown function ATU1810, ontario centre for structural proteomics; NMR {Agrobacterium tumefaciens str}
Probab=20.00  E-value=38  Score=13.35  Aligned_cols=42  Identities=0%  Similarity=-0.003  Sum_probs=31.6

Q ss_pred             HHHHHHHCCCCCEEEEEEEEECCHHHHHHHHHCCCCEEECCC
Q ss_conf             999986204674158999997734667778860997474168
Q gi|254780911|r   98 NDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPM  139 (288)
Q Consensus        98 ~~Ll~~~~~g~L~~eI~~VISN~~d~~~lA~~~gIP~~~i~~  139 (288)
                      ..|+-=..+++-..+|.+-..++++|-..|+++||+|.++.-
T Consensus        39 dpLMGWtsS~Dt~~qv~L~F~skE~Ai~yA~k~g~~y~V~ep   80 (106)
T 2jya_A           39 DPIMGYTSSSDMKQQVKLTFETQEQAEAYAQRKGIEYRVILP   80 (106)
T ss_dssp             CTTTCSCSCCCSEEEEEEEESSHHHHHHHHHHHTCEEEECCC
T ss_pred             CCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHCCCEEEEECC
T ss_conf             787442266774686388758999999999986983999756


Done!