BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate
deformylase [Candidatus Liberibacter asiaticus str. psy62]
         (288 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040588|gb|ACT57384.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 288

 Score =  597 bits (1539), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF
Sbjct: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH
Sbjct: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM
Sbjct: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ
Sbjct: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ 288
           TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
Sbjct: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ 288


>gi|315122658|ref|YP_004063147.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496060|gb|ADR52659.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 289

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 242/288 (84%), Gaps = 3/288 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           MS +ILT+T PS++EI S++  YLS + C+ILD++QFND +T K FMR SF    +TCMK
Sbjct: 1   MSIHILTVTSPSHKEIISVLSGYLSGK-CDILDLAQFNDSNTRKFFMRASFTLKKHTCMK 59

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ DFQPI+QQFSL+ SIRN KE  KTLILVS+ DHCL+DLLY+WN  TLA++I G+VS
Sbjct: 60  NFLIDFQPIIQQFSLKISIRNAKERMKTLILVSRFDHCLHDLLYQWNARTLAMDIAGIVS 119

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  H+KL  +YQ+PFYY+P+T+QNKI+ E++LINIIEKNNV+L+ILARYMQILS+ +C 
Sbjct: 120 NHPIHQKLATDYQIPFYYIPITKQNKIKCEEELINIIEKNNVKLLILARYMQILSEKICQ 179

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKG NPYKQAYEYGVKIIGATAHY    LD GPIIEQDVV +TH
Sbjct: 180 KMSGRIINIHHSFLPSFKGGNPYKQAYEYGVKIIGATAHYVTPALDEGPIIEQDVVHITH 239

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ +++YI+IG+NIE KVL+ AVNAHIQ RVFIN+RKT+VFP   N+Y
Sbjct: 240 AQNVKNYISIGRNIETKVLSNAVNAHIQHRVFINERKTVVFPTQSNDY 287


>gi|222084490|ref|YP_002543019.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221721938|gb|ACM25094.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  364 bits (935), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M+ Y+LT++C S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+       +
Sbjct: 1   MTHYVLTVSCHSTRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAGKFEMEVEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E ++++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMDVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|222082165|ref|YP_002541530.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221726844|gb|ACM29933.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 221/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M+ Y+L +TC S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+       +
Sbjct: 1   MTHYVLRVTCTSRRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAGKFEMEAEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E +++ ++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMEVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|222081891|ref|YP_002541256.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221726570|gb|ACM29659.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  362 bits (930), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 222/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M  ++LT++C S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+       +
Sbjct: 1   MEKFVLTVSCQSTRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAVKFEMEAEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E ++++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMDVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|325293815|ref|YP_004279679.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325061668|gb|ADY65359.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  362 bits (928), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++Y+LT+ C S   I + I  YL+ +GCNI+D SQF+DL+T K FMR+SF+      M+
Sbjct: 1   MTTYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFISEEGATMQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP+ ++F ++  I +  +  KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AITEGFQPVAEKFGMEARIYSDGQRMKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+++IE +  EL++LARYMQ+LSD++C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIKVTKENKPQAEAQLMDLIETSGTELVVLARYMQVLSDNMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYDRGVKLIGATAHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|153008789|ref|YP_001370004.1| formyltetrahydrofolate deformylase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560677|gb|ABS14175.1| formyltetrahydrofolate deformylase [Ochrobactrum anthropi ATCC
           49188]
          Length = 294

 Score =  361 bits (926), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 220/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MHNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVALD 60

Query: 61  I--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F P+   F +++   +  + TKTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  VLREGFAPVAAPFEMEFEFHDNAQRTKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+EQ+L++I++    EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAEQRLLDIVDDTGTELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQSAADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|294677927|ref|YP_003578542.1| formyltetrahydrofolate deformylase [Rhodobacter capsulatus SB 1003]
 gi|294476747|gb|ADE86135.1| formyltetrahydrofolate deformylase [Rhodobacter capsulatus SB 1003]
          Length = 294

 Score =  360 bits (924), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M++Y+LT+ C S   I + I +YL+  GCN+ D +Q++DL T + FMR++FV  T   L 
Sbjct: 1   MTTYVLTVNCHSTRGIVAAIANYLADSGCNLTDSNQYDDLLTGQFFMRVTFVSQTGATLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F+P+ Q+F ++++I + ++  K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  SLKAGFEPVAQEFDMEWAIHDAEKKVKVLLMVSNFGHCLNDLLYRWRIGALPVEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+++ +T++NK E+E  L++++E++  EL++LARYMQILSD LC 
Sbjct: 121 NHMTYQKVVVNHDIPFHHIKVTKENKPEAEAHLLDVVEESGAELVVLARYMQILSDKLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQ+ VR+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQETVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA VL +A++AH+Q RVFIN  KT+VFPA P  Y
Sbjct: 241 AQSPEDYVSLGRDVEALVLARAIHAHVQHRVFINGNKTVVFPASPGGY 288


>gi|239832558|ref|ZP_04680887.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
 gi|239824825|gb|EEQ96393.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
          Length = 294

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 217/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MHNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVALD 60

Query: 61  I--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  +   F + +   +    TKTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  VLREGFASVAAPFDMNFEFHDNAHRTKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+EQ+L++I+E    EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAEQRLLDIVEDTGTELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQSAADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|209551777|ref|YP_002283694.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537533|gb|ACI57468.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 294

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 217/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   FS++Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  EIGADFAAVAAPFSMEYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E  ++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEAHIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|209546027|ref|YP_002277917.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538884|gb|ACI58817.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 294

 Score =  358 bits (918), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF P+   FS+ Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  EIGADFSPVAAPFSMDYEFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E +++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEARIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|86355884|ref|YP_467776.1| formyltetrahydrofolate deformylase [Rhizobium etli CFN 42]
 gi|86279986|gb|ABC89049.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CFN 42]
          Length = 294

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT + FMR+SF+    +   
Sbjct: 1   MKSYVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGRFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   + L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMRVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVDLVEQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|86360691|ref|YP_472579.1| formyltetrahydrofolate deformylase [Rhizobium etli CFN 42]
 gi|86284793|gb|ABC93852.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CFN 42]
          Length = 294

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M S+ILT++C S   I + I  YL+ +GCNI+D SQF+DLDT + FMR+SF+    +   
Sbjct: 1   MKSFILTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGRFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVDLVEQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|150398028|ref|YP_001328495.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150029543|gb|ABR61660.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 294

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 157/288 (54%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+LT+TC S   I + +  YL+  GCNI+D SQF+DL T   FMR++FV  T  K  
Sbjct: 1   MKSYVLTVTCKSTRGIIAAVSGYLAEAGCNIVDSSQFDDLQTGLFFMRLAFVSETGAKAA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P+ ++F +   IR+T+E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVAKRFGMTAEIRDTEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK  +E +L+ ++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFEYQKVVVNHDIPFHCIKVTKENKPRAEAQLMEVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|190889899|ref|YP_001976441.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190695178|gb|ACE89263.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 294

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MRSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|222106953|ref|YP_002547744.1| formyltetrahydrofolate deformylase [Agrobacterium vitis S4]
 gi|221738132|gb|ACM39028.1| formyltetrahydrofolate deformylase [Agrobacterium vitis S4]
          Length = 294

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M+SY+LT++CPS   I + +  YL+  GCNI+D SQF+DLDT + FMR+SF+       +
Sbjct: 1   MTSYVLTVSCPSKRGIVAALSGYLAEMGCNIVDSSQFDDLDTDRFFMRVSFISEQGASRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A   PIV  F ++  + ++ E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  KIEAGLAPIVDNFQMEIGLYDSTERVKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK ++E +L+ ++++   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKDNKPQAEAQLMELVQQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQA+E GVK+IGATAHY   +LD GPIIEQDV RVTH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAFERGVKLIGATAHYVTADLDEGPIIEQDVARVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ  EDY++IG+++E++VL +A++AHI  R FIN  K++VFPA P +Y
Sbjct: 241 AQNAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNKSVVFPASPGSY 288


>gi|15889735|ref|NP_355416.1| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|15157649|gb|AAK88201.1| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  355 bits (911), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M+SY+LT+ C S   I + I  YL+ +GCNI+D SQF+DL+T K FMR+SF+      ++
Sbjct: 1   MTSYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFISEEGASLQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP+ ++F +   I    +  K +++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AITEGFQPVSEKFGMASDIYPDGQRMKAMLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+++IE +  EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDLIETSGTELVVLARYMQVLSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTGDLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|227823517|ref|YP_002827490.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227342519|gb|ACP26737.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  355 bits (910), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 156/288 (54%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+LT+TC S   I + +  YL+ +GC I D SQF+DL+T   FMR++F+     KL 
Sbjct: 1   MKSYVLTVTCKSTRGIVAAVTGYLAEKGCYISDSSQFDDLETGLFFMRLTFISQEGAKLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P++++F +   +R+T+E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFAPVIKRFDMAMDVRDTEERTKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|158423000|ref|YP_001524292.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
 gi|158329889|dbj|BAF87374.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
          Length = 314

 Score =  355 bits (910), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 156/287 (54%), Positives = 215/287 (74%), Gaps = 2/287 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           +SY+LT++C +   I + I  +L+T GCNI D SQF+D DT + FMRI F     +  + 
Sbjct: 22  ASYVLTVSCTTRRGIVAAISGFLATAGCNITDSSQFDDADTGRFFMRIRFRSEEGIGQEE 81

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F PI  Q  + Y + N     K L++VS+  HCLNDLLYRW IG L ++IVGVVSN
Sbjct: 82  LDAAFAPIAGQMGIDYQLHNASRRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSN 141

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  ++K+V N+ +PF+ + +T++NK E+E +L++I+E+   EL++LARYMQ+LSD LC K
Sbjct: 142 HFDYQKVVVNHDIPFHCIKVTKENKAEAEAQLLSIVEQTGTELVVLARYMQVLSDALCRK 201

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+THA
Sbjct: 202 MSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTSDLDEGPIIEQDIARITHA 261

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           Q+ +DY++IG+++E++VL +A++AHI  R+FIN  +T+VFPA P +Y
Sbjct: 262 QSPDDYVSIGRDVESQVLARAIHAHIHHRIFINGNRTVVFPASPGSY 308


>gi|150378015|ref|YP_001314610.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150032562|gb|ABR64677.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 293

 Score =  354 bits (908), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 153/285 (53%), Positives = 218/285 (76%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           Y+LT++C S   I + I  YL+ QGCNI+D SQF+DLDT + FMR+SF+        +  
Sbjct: 3   YVLTVSCQSTRGIVAAISGYLAEQGCNIVDSSQFDDLDTGQFFMRVSFISEEGAVQTIIE 62

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+ ++F + +++ +  +  K L++VS+  HCLNDLLYRW IG L ++IVGVVSNH 
Sbjct: 63  QGFVPVAERFGMNWNLFDAAKREKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNHF 122

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++K+V N+ +PF+++P+T+ NK E E ++++++E+   EL++LARYMQILSD +C KM+
Sbjct: 123 DYQKVVVNHDIPFHHIPVTKANKPEVEARIMDLVEQTGTELIVLARYMQILSDQMCQKMS 182

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGANPYKQA+E GVK+IGATAHY   +LD GPIIEQD VRVTHAQ+
Sbjct: 183 GKIINIHHSFLPSFKGANPYKQAFERGVKLIGATAHYVTADLDEGPIIEQDTVRVTHAQS 242

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            EDY+++G+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 243 PEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 287


>gi|241666498|ref|YP_002984582.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861955|gb|ACS59620.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 294

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M S++LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKSFVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   F + Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DIDAGFATVAAPFEMDYDFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ N++++E  +++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANRVQAEGHIMDVVEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|241207177|ref|YP_002978273.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861067|gb|ACS58734.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 294

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 220/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT + F R+SF+    + L 
Sbjct: 1   MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGRFFTRVSFISEEGVPLA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F++   I +     K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELKEGFEPICKRFAMDAEIHDGSARMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK+++E ++++I+E+   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +T+VFPA P  Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVFPASPGGY 288


>gi|332716561|ref|YP_004444027.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325063246|gb|ADY66936.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M++++LT+TC S   I + +  +L+ +GCNI+D SQF+DL T + FMR+ F+     K  
Sbjct: 1   MTNFVLTVTCKSTRGIVAALSGFLAEKGCNIVDSSQFDDLGTGRFFMRVGFISEEGAKRD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A   PI Q+F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DLMAGLMPISQKFGMEVALHDQSERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E ++++I E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKENKPQAEARIMDIAESTGTELIVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 TMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVEAQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|116250000|ref|YP_765838.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254648|emb|CAK05722.1| putative formyltetrahydrofolate deformylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 294

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K F R+SF+    + L 
Sbjct: 1   MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGKFFTRVSFISEEGVPLA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F++   I +     K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELKEGFEPICKRFAMDAEIHDGNARMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK+++E ++++I+E+   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +T+VFPA P  Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVFPASPGGY 288


>gi|116255754|ref|YP_771587.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115260402|emb|CAK03506.1| putative formyltetrahydrofolate deformylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 294

 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +++LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNFVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGA 60

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             D  F  +   F + Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DIDTGFAAVAAPFEMDYDFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E +++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEARIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|190895648|ref|YP_001985940.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190699593|gb|ACE93677.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 294

 Score =  351 bits (901), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 215/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|159186072|ref|NP_356423.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|159141206|gb|AAK89208.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  351 bits (900), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++++LT+TC S   I + +   L+ +GCNI+D SQF+DL T + FMR+ F+       +
Sbjct: 1   MTNFVLTVTCKSTRGIVAALSGLLAEKGCNIVDSSQFDDLGTGRFFMRVGFISEEGATRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A   PI + F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALMAGLAPISKTFGMEVALHDQAERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ I E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKENKPQAEARIMEIAESTGTELVVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD+VR+TH
Sbjct: 181 AMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDIVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGSRTVVFPPSPGSY 288


>gi|218460526|ref|ZP_03500617.1| formyltetrahydrofolate deformylase [Rhizobium etli Kim 5]
          Length = 294

 Score =  351 bits (900), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F++ Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFAMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|15966689|ref|NP_387042.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
 gi|307300275|ref|ZP_07580055.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|15075961|emb|CAC47515.1| Putative formyltetrahydrofolate deformylase [Sinorhizobium meliloti
           1021]
 gi|306904441|gb|EFN35025.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 294

 Score =  351 bits (900), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+LT++C S   I + I  YL+ +GC I D SQF+D  T   FMR++F+     KL 
Sbjct: 1   MKSYVLTVSCKSTRGIVAAITGYLAEKGCYISDSSQFDDFQTGLFFMRLTFISQDGAKLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P++++F +   IR+++E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVIKRFEMMMEIRDSEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|195970220|ref|NP_384204.3| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
 gi|307309552|ref|ZP_07589207.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|307320384|ref|ZP_07599801.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|15073026|emb|CAC41485.1| Probable formyltetrahydrofolate deformylase [Sinorhizobium meliloti
           1021]
 gi|306893950|gb|EFN24719.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|306900012|gb|EFN30633.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 296

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 217/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +++LT++C S   + + +  YL+ QGCNI D SQF+DLDT K FMR SF+    + L 
Sbjct: 3   MQNFVLTVSCKSTRGVVAALSGYLAEQGCNIADSSQFDDLDTGKFFMRTSFISEERVGLA 62

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +   +PI  +F ++ ++    E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 63  ALEEGLKPIASKFEMETALHEQSERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 123 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 183 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 243 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 290


>gi|307321152|ref|ZP_07600556.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|306893227|gb|EFN24009.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
          Length = 294

 Score =  350 bits (898), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+LT++C S   I + I  YL+ +GC I D SQF+D  T   FMR++F+     KL 
Sbjct: 1   MKSYVLTVSCKSTRGIVAAITGYLAEKGCYISDSSQFDDFQTGLFFMRLTFISQDGAKLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P++++F +   IR+++E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVIKRFEMMMEIRDSEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++N+ ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENRPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|227819940|ref|YP_002823911.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227338939|gb|ACP23158.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +Y+LT+TC S   I + +  YL+ QGCNI+D SQF+DL T   FMRISF+    +   
Sbjct: 1   MHTYVLTVTCKSTRGIVAALSGYLAEQGCNIIDSSQFDDLQTGLFFMRISFISEQGVGRA 60

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +   +PI   F+++ ++ +  E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALEEGLKPIAATFAMETALHDQSERTKALLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|36958692|gb|AAQ87160.1| Formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 295

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +Y+LT+TC S   I + +  YL+ QGCNI+D SQF+DL T   FMRISF+    +   
Sbjct: 2   MHTYVLTVTCKSTRGIVAALSGYLAEQGCNIIDSSQFDDLQTGLFFMRISFISEQGVGRA 61

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +   +PI   F+++ ++ +  E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 62  ALEEGLKPIAATFAMETALHDQSERTKALLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 122 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 182 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 242 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 289


>gi|218510147|ref|ZP_03508025.1| formyltetrahydrofolate deformylase [Rhizobium etli Brasil 5]
          Length = 294

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 152/288 (52%), Positives = 214/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M + +LT+TC S   I + I  YL+ + CNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVTCKSTRGIVAAISSYLAEKRCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|84686506|ref|ZP_01014399.1| formyltetrahydrofolate deformylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665419|gb|EAQ11896.1| formyltetrahydrofolate deformylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 294

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M++++LT+ C S   I + I  YL  +GCNI D +QF+D +T + F RI+    T  +L 
Sbjct: 1   MTAFVLTVRCASRRGIVAAISGYLFEKGCNITDSAQFDDAETGRFFARITCAPETGTELE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++F +++ + +T E  K +I+VS   HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DLKEGFAPIAEEFGMEWGMHDTSERMKVIIMVSNFGHCLNDLLYRWRIGALPVDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ LPF+++ +T++NK E+E +L++++ ++  +L++LARYMQILSD LC 
Sbjct: 121 NHMTYQKLVVNHDLPFHHIKVTKENKPEAEARLMDVVTESGADLVVLARYMQILSDRLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATAHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +AV+AHI +R F+N  KT+VFPA P++Y
Sbjct: 241 AQSPGDYVSLGRDVESQVLARAVHAHINRRSFLNDDKTVVFPASPDSY 288


>gi|307314594|ref|ZP_07594195.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|306899011|gb|EFN29655.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 294

 Score =  349 bits (895), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  Y+LTIT  S   I + I  YL+ +GCNI+D SQF+ L+T   FMR++F+     K  
Sbjct: 1   MHKYVLTITSKSTRGIVADISGYLAEKGCNIVDSSQFDGLETGLFFMRLAFISEQGAKAE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P+ ++F +   IR+T E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREAFEPVAKRFGMTAEIRDTAERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|260577260|ref|ZP_05845234.1| formyltetrahydrofolate deformylase [Rhodobacter sp. SW2]
 gi|259020504|gb|EEW23826.1| formyltetrahydrofolate deformylase [Rhodobacter sp. SW2]
          Length = 294

 Score =  348 bits (892), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 208/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M SY+L + C S   I + I  +L+  GCNI D +QF+D  T   FMRI+F     +   
Sbjct: 1   MKSYVLVVKCVSTRGIVAAISGFLAQNGCNITDSAQFDDAQTGMFFMRITFRSEAGVSAA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   FS+ ++I +     K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  DLTAGFAAVADGFSMDWAIHDAAHRVKVLLMVSNFGHCLNDLLYRWRIGGLPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ LPF+ + +T+ NK ++E +L+ ++E++  EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKLVVNHDLPFHLIKVTKDNKADAEARLLALVEESGAELVVLARYMQVLSDAFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAH+   +LD GPIIEQD VRVTH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHFVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGSY 288


>gi|227821997|ref|YP_002825968.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227340997|gb|ACP25215.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  348 bits (892), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++Y+LT+ C S   I + I  +L+  GCNI D SQF+DL T + FMR+ F+       +
Sbjct: 1   MTTYVLTVACKSTRGIVAAISGFLAEMGCNITDSSQFDDLGTGRFFMRVGFISEKGATRQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +  +PI ++F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++I+GVVS
Sbjct: 61  DLASGLKPIAEKFEMETTLHDQAERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIIGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ + E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKENKPQAEARIMELAESTGTELIVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 TMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  +TIVFP  P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGARTIVFPPSPGSY 288


>gi|17988732|ref|NP_541365.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           16M]
 gi|23500636|ref|NP_700076.1| formyltetrahydrofolate deformylase [Brucella suis 1330]
 gi|148558473|ref|YP_001257833.1| formyltetrahydrofolate deformylase [Brucella ovis ATCC 25840]
 gi|163845026|ref|YP_001622681.1| formyltetrahydrofolate deformylase [Brucella suis ATCC 23445]
 gi|225629367|ref|ZP_03787400.1| formyltetrahydrofolate deformylase [Brucella ceti str. Cudo]
 gi|225686668|ref|YP_002734640.1| formyltetrahydrofolate deformylase [Brucella melitensis ATCC 23457]
 gi|254703229|ref|ZP_05165057.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|254705627|ref|ZP_05167455.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|254710856|ref|ZP_05172667.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|254720226|ref|ZP_05182037.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|256015670|ref|YP_003105679.1| formyltetrahydrofolate deformylase [Brucella microti CCM 4915]
 gi|256029239|ref|ZP_05442853.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|256043776|ref|ZP_05446698.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256058924|ref|ZP_05449138.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|256111179|ref|ZP_05452215.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256157434|ref|ZP_05455352.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|256253588|ref|ZP_05459124.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|256262198|ref|ZP_05464730.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260167669|ref|ZP_05754480.1| formyltetrahydrofolate deformylase [Brucella sp. F5/99]
 gi|260564961|ref|ZP_05835446.1| formyl transferase [Brucella melitensis bv. 1 str. 16M]
 gi|261220724|ref|ZP_05935005.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|261313037|ref|ZP_05952234.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|261318430|ref|ZP_05957627.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|261322864|ref|ZP_05962061.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|261753859|ref|ZP_05997568.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|261757102|ref|ZP_06000811.1| formyl transferase [Brucella sp. F5/99]
 gi|265985238|ref|ZP_06097973.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|265986228|ref|ZP_06098785.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|265990202|ref|ZP_06102759.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992691|ref|ZP_06105248.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995924|ref|ZP_06108481.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|306838632|ref|ZP_07471468.1| formyltetrahydrofolate deformylase [Brucella sp. NF 2653]
 gi|306841531|ref|ZP_07474229.1| formyltetrahydrofolate deformylase [Brucella sp. BO2]
 gi|17984545|gb|AAL53629.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           16M]
 gi|23464279|gb|AAN34081.1| formyltetrahydrofolate deformylase [Brucella suis 1330]
 gi|148369758|gb|ABQ62630.1| formyltetrahydrofolate deformylase [Brucella ovis ATCC 25840]
 gi|163675749|gb|ABY39859.1| formyltetrahydrofolate deformylase [Brucella suis ATCC 23445]
 gi|225615863|gb|EEH12912.1| formyltetrahydrofolate deformylase [Brucella ceti str. Cudo]
 gi|225642773|gb|ACO02686.1| formyltetrahydrofolate deformylase [Brucella melitensis ATCC 23457]
 gi|255998330|gb|ACU50017.1| formyltetrahydrofolate deformylase [Brucella microti CCM 4915]
 gi|260152604|gb|EEW87697.1| formyl transferase [Brucella melitensis bv. 1 str. 16M]
 gi|260919308|gb|EEX85961.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|261297653|gb|EEY01150.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|261298844|gb|EEY02341.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|261302063|gb|EEY05560.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|261737086|gb|EEY25082.1| formyl transferase [Brucella sp. F5/99]
 gi|261743612|gb|EEY31538.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|262550221|gb|EEZ06382.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|262763561|gb|EEZ09593.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000871|gb|EEZ13561.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091894|gb|EEZ16216.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264658425|gb|EEZ28686.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|264663830|gb|EEZ34091.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|306288368|gb|EFM59727.1| formyltetrahydrofolate deformylase [Brucella sp. BO2]
 gi|306406275|gb|EFM62518.1| formyltetrahydrofolate deformylase [Brucella sp. NF 2653]
 gi|326411059|gb|ADZ68123.1| formyltetrahydrofolate deformylase [Brucella melitensis M28]
 gi|326554351|gb|ADZ88990.1| formyltetrahydrofolate deformylase [Brucella melitensis M5-90]
          Length = 294

 Score =  347 bits (891), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|62317264|ref|YP_223117.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 1 str.
           9-941]
 gi|83269245|ref|YP_418536.1| formyltetrahydrofolate deformylase [Brucella melitensis biovar
           Abortus 2308]
 gi|189022525|ref|YP_001932266.1| formyltetrahydrofolate deformylase [Brucella abortus S19]
 gi|237816825|ref|ZP_04595817.1| formyltetrahydrofolate deformylase [Brucella abortus str. 2308 A]
 gi|254690771|ref|ZP_05154025.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|254698550|ref|ZP_05160378.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731998|ref|ZP_05190576.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|256255954|ref|ZP_05461490.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|260544502|ref|ZP_05820323.1| formyl transferase [Brucella abortus NCTC 8038]
 gi|260756343|ref|ZP_05868691.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|260759771|ref|ZP_05872119.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|260763010|ref|ZP_05875342.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882167|ref|ZP_05893781.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|297249312|ref|ZP_06933013.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 5 str.
           B3196]
 gi|62197457|gb|AAX75756.1| PurU, formyltetrahydrofolate deformylase [Brucella abortus bv. 1
           str. 9-941]
 gi|82939519|emb|CAJ12492.1| Formyl transferase, N-terminal:Amino acid-binding
           ACT:Formyltetrahydrofolate deformylase [Brucella
           melitensis biovar Abortus 2308]
 gi|189021099|gb|ACD73820.1| Formyl transferase, N-terminal [Brucella abortus S19]
 gi|237787638|gb|EEP61854.1| formyltetrahydrofolate deformylase [Brucella abortus str. 2308 A]
 gi|260097773|gb|EEW81647.1| formyl transferase [Brucella abortus NCTC 8038]
 gi|260670089|gb|EEX57029.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|260673431|gb|EEX60252.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676451|gb|EEX63272.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|260871695|gb|EEX78764.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|297173181|gb|EFH32545.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 5 str.
           B3196]
          Length = 294

 Score =  347 bits (891), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|306846119|ref|ZP_07478681.1| formyltetrahydrofolate deformylase [Brucella sp. BO1]
 gi|306273370|gb|EFM55231.1| formyltetrahydrofolate deformylase [Brucella sp. BO1]
          Length = 294

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTHGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|119385340|ref|YP_916396.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119387626|ref|YP_918660.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119375107|gb|ABL70700.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119378201|gb|ABL72964.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
          Length = 294

 Score =  347 bits (889), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 213/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  Y LT+ CPS   I + +  +L+  GCNI D SQF+D++T + FMR+SFV    + L 
Sbjct: 1   MKKYTLTVACPSTRGIVATVAGFLAEHGCNITDSSQFDDIETGRFFMRVSFVSEEGVGLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A      + F + Y+I +  E  K +I+VS+  HCLNDLLYRW IG L + IV V+S
Sbjct: 61  ELRAGLAEPAKPFDMDYAIHDEAEKMKVVIMVSRFGHCLNDLLYRWRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T +NK ++E +L+ ++E +  EL++LARYMQ+LSD LC 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIKVTRENKPQAEAQLMQVVEDSGAELVVLARYMQVLSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD++RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVESQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|161620961|ref|YP_001594847.1| formyltetrahydrofolate deformylase [Brucella canis ATCC 23365]
 gi|260567837|ref|ZP_05838306.1| formyl transferase [Brucella suis bv. 4 str. 40]
 gi|161337772|gb|ABX64076.1| formyltetrahydrofolate deformylase [Brucella canis ATCC 23365]
 gi|260154502|gb|EEW89583.1| formyl transferase [Brucella suis bv. 4 str. 40]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 155/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL +LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELEVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|150398500|ref|YP_001328967.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150030015|gb|ABR62132.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 294

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 214/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +++LT+TC S   I + I  YL+ QGCNI+D SQF+DL+T   FMRISF+    + L 
Sbjct: 1   MQNFVLTVTCKSTRGIVAAISGYLAGQGCNIVDSSQFDDLETGLFFMRISFISEERLGLA 60

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +   +PI  +F +  ++    E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALEEGLKPIASKFEMVTALHEQSERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK  +E +L+ ++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFEYQKVVVNHDIPFHCIKVTKENKPRAEAQLMEVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|190891658|ref|YP_001978200.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190696937|gb|ACE91022.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 298

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 211/285 (74%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMRISF  +    L    
Sbjct: 8   YALRVACPSIRGVTAAIAGYLSQNGCNISDSAQFDDADTGRYFMRISFQPHDGQTLDQLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI  +F       +  E  K +++VS+  HCLNDLLYRW IG L ++IVGV+SNHT
Sbjct: 68  QGFEPIAGKFEASAEFFDESEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNHT 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++++V N+ +PF+ + +T +NK E+E K + I+E++  EL++LARYMQ+LSD +C KM+
Sbjct: 128 DYQRVVVNHDIPFHCIKVTRENKPEAEAKQMQIVEESGAELIVLARYMQVLSDDMCRKMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD+VRVTHAQ+
Sbjct: 188 GRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIVRVTHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            EDY+++G+++E++VL +A++AHI  RVFIN  KT+VFPA P +Y
Sbjct: 248 GEDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTVVFPASPGSY 292


>gi|254700110|ref|ZP_05161938.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
 gi|261750601|ref|ZP_05994310.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
 gi|261740354|gb|EEY28280.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
          Length = 294

 Score =  345 bits (885), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLD  + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDMGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|260427697|ref|ZP_05781676.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260422189|gb|EEX15440.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  345 bits (885), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           MS + LT+TCPS   I + I  +L+ QGCNI D SQF+D +T   FMR+SF   T   L 
Sbjct: 1   MSKFALTVTCPSTRGIVAAIATFLAEQGCNITDSSQFDDFETGNFFMRVSFQSETGASLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    + F + Y+  +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  GLQEQFAATAKGFGMDYAFHDEAAKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +++ ++E+   +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHNIRVTKENKPQAEGRIMEVVEETGADLIVLARYMQILSDEMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|163761527|ref|ZP_02168599.1| formyltetrahydrofolate deformylase [Hoeflea phototrophica DFL-43]
 gi|162281241|gb|EDQ31540.1| formyltetrahydrofolate deformylase [Hoeflea phototrophica DFL-43]
          Length = 294

 Score =  345 bits (885), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 146/288 (50%), Positives = 222/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++++LT++CPS   I + +  +L+  GCNI+D SQF+DL+T K FMRIS V   +  ++
Sbjct: 1   MTTFVLTVSCPSTRGIVAALSGFLAEMGCNIVDSSQFDDLETGKFFMRISCVSEKDATLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI ++FS++  I +  +  K +++VS+  HCLND+LYRW IG L + IVGVVS
Sbjct: 61  KLAERLKPIAEKFSMETGIFDQSDRMKVMLMVSRFGHCLNDILYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ +++    +L++LARYMQ+LSD +C 
Sbjct: 121 NHLDYQKVVVNHDIPFHHIPVTKENKPQAEARIMELVDSTGTDLIVLARYMQVLSDKMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQDVV VTH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDVVGVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++EA+VL++A++AHI +RVF+N  +T+VFP  P +Y
Sbjct: 241 AQSPGDYVSLGRDVEARVLSRAIHAHIHRRVFLNGNRTVVFPPSPGSY 288


>gi|254695924|ref|ZP_05157752.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216351|ref|ZP_05930632.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917958|gb|EEX84819.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 294

 Score =  344 bits (882), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 154/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+    + L 
Sbjct: 1   MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW I  L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIDALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|114767063|ref|ZP_01445960.1| formyltetrahydrofolate deformylase protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114540782|gb|EAU43847.1| formyltetrahydrofolate deformylase protein [Roseovarius sp.
           HTCC2601]
          Length = 294

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           MS + LT+TCPS   I + I  +L+ QGCNI D SQF+D +T   FMR+S +   +  ++
Sbjct: 1   MSKFALTVTCPSTRGIVAAIAAFLAEQGCNITDSSQFDDFETGNFFMRVSVMSEKDATLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    + F + Y   +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ELRERFAETAKNFKMDYEFHDEAEKMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +++ ++E+   EL++LARYMQILSD LC 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIRVTKENKPQAEARIMEVVEETGAELVVLARYMQILSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 VMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|209549227|ref|YP_002281144.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534983|gb|ACI54918.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 298

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 154/285 (54%), Positives = 208/285 (72%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMRISF       L    
Sbjct: 8   YALRVACPSIRGVTAAIATYLSQSGCNISDSAQFDDADTGRYFMRISFQPQDGHTLGQLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI  +F       +  E  K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH 
Sbjct: 68  DGFEPIADRFEANAEFFDEAEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNHM 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++++V N+ +PF+ + +T +NK E+E K + I+E +  EL++LARYMQ+LSD +C KM+
Sbjct: 128 DYQRIVVNHDIPFHCIKVTRENKPEAEAKQMQIVEGSGAELVVLARYMQVLSDEMCRKMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD+VRVTHAQ+
Sbjct: 188 GRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIVRVTHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            EDY+++G+++E++VL +A++AHI  RVFIN  KT+VFPA P +Y
Sbjct: 248 GEDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTVVFPASPGSY 292


>gi|146279003|ref|YP_001169162.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557244|gb|ABP71857.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 294

 Score =  342 bits (878), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           MS ++LT+TCP+   I + I ++L+  GCNI D +QF+D +T + FMR+ F   T   L 
Sbjct: 1   MSKFVLTVTCPTRRGIVAAISNFLADNGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F  I   F + + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  ALNDSFARIAPDFEMGWQIFDSSRKLKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ +PF+ + +T++NK ++E +L+ ++E+   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKLVVNHDIPFHLIRVTKENKPDAEARLLALVEETGAELVVLARYMQVLSDSFCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL +A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLARAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|77464523|ref|YP_354027.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|221640433|ref|YP_002526695.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides KD131]
 gi|332559415|ref|ZP_08413737.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides WS8N]
 gi|77388941|gb|ABA80126.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|221161214|gb|ACM02194.1| Formyltetrahydrofolate deformylase [Rhodobacter sphaeroides KD131]
 gi|332277127|gb|EGJ22442.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides WS8N]
          Length = 294

 Score =  341 bits (874), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 149/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  ++LT+TCP+   I + I  +L+  GCNI D +QF+D +T + FMR+ F   T   L 
Sbjct: 1   MPKFVLTVTCPTRRGIVAAISTFLADHGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  + +     + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  GLTADFAAVGETLEADWQIFDSASKIKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+ + +T+ NK E+E +L+ ++++   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKVVVNHDIPFHLIKVTKDNKPEAEARLMALVDETGAELVVLARYMQVLSDAFCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|126463363|ref|YP_001044477.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105027|gb|ABN77705.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 294

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 149/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  ++LT+TCP+   I + I  +L+  GCNI D +QF+D +T + FMR+ F   T   L 
Sbjct: 1   MPKFVLTVTCPTRRGIVAAISTFLADHGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  + +     + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  GLTADFAAVGETLEANWQIFDSASKIKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+ + +T+ NK E+E +L+ ++++   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKVVVNHDIPFHLIKVTKDNKPEAEARLMALVDETGAELVVLARYMQVLSDAFCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|83944246|ref|ZP_00956701.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. EE-36]
 gi|83953287|ref|ZP_00962009.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. NAS-14.1]
 gi|83842255|gb|EAP81423.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. NAS-14.1]
 gi|83844790|gb|EAP82672.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. EE-36]
          Length = 294

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 213/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +Y LT+TCPS   + + I +YL+ QGCNI D +QF+D +T   FMR+SF     + L 
Sbjct: 1   MKTYALTVTCPSARGVVAAIANYLADQGCNISDSAQFDDKETGGFFMRVSFESEAEVDLA 60

Query: 61  -IAD-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            ++D F    + F + Y   +     K +I+VS+  HCLNDLLYRW IG L ++IV VVS
Sbjct: 61  TLSDGFADAARPFDMAYEFHDEAVKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N  +PF+ + +T +NK ++E +++ ++E    EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNNDIPFHCIKVTPENKADAEARIMAVVEDAGAELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGAT+HY   +LD GPIIEQD+VRVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATSHYVTADLDEGPIIEQDIVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHRRVFVNGNKTVVFPASPGSY 288


>gi|84516018|ref|ZP_01003379.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
 gi|84510460|gb|EAQ06916.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
          Length = 294

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+ + LT+TC S   I + I  +L+  GCNI D SQF+D +T K FMR+SF   T   L 
Sbjct: 1   MTKFALTVTCDSARGIVAAIAGFLADHGCNITDSSQFDDTETGKFFMRVSFTSETGAALD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               DF  I  +F + ++  +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  TIADDFGDIGTRFGMAFAFHDEAVRMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ +P+T+QNK E+E +++++++    +L++LARYMQ+LSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIPVTKQNKPEAEARIMDVVDATGADLVVLARYMQVLSDRMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+ RVTH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIARVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI +RV +N  KT+VFPA P +Y
Sbjct: 241 AQSPADYVSLGRDVESQVLARAIHAHIHRRVMLNGNKTVVFPASPGSY 288


>gi|310815109|ref|YP_003963073.1| formyltetrahydrofolate deformylase protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753844|gb|ADO41773.1| formyltetrahydrofolate deformylase protein [Ketogulonicigenium
           vulgare Y25]
          Length = 294

 Score =  339 bits (869), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           MS+YILT+TC +   I + +  +L+  GCNI D +QF+D+ T K FMRIS        L 
Sbjct: 1   MSNYILTVTCATTRGIVAAVSGFLAENGCNITDSAQFDDVLTGKFFMRISVTSQEGATLA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F  +  +F ++++  +  E  K +I+VS+  HCLNDLLYR  IG L ++IVGV+S
Sbjct: 61  DLQSRFATVGARFGMEFAFFDASERVKAVIMVSRFGHCLNDLLYRQRIGALPIDIVGVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++KLV N+ +PF+++ +T QNK E+E   + I+ +   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKLVVNHDIPFHHIRVTPQNKPEAEAAQMQILRETGAELVVLARYMQILSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVFIN  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVESQVLARAIHAHIHRRVFINGNKTVVFPASPGSY 288


>gi|186939590|dbj|BAG31006.1| putative formyltetrahydrofolate deformylase [Ensifer sp. AJ110404]
          Length = 298

 Score =  338 bits (868), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 150/285 (52%), Positives = 210/285 (73%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMR+SF       ++   
Sbjct: 8   YALRVACPSIRGVTAAIATYLSQNGCNISDSAQFDDADTDRYFMRVSFQPKEGRTLEQLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI +++       +  E  K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH 
Sbjct: 68  EGFKPIAEKYEANTEFFDETEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNHL 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++++V N+ +PF+ + +T++NK E+E   + I+E +  EL++LARYMQ+LSD +C KM+
Sbjct: 128 DYQRVVVNHDIPFHCIKVTKENKPEAEATQMQIVEDSGAELIVLARYMQVLSDEMCRKMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+VRVTHAQ+
Sbjct: 188 GRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIVRVTHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            EDY+++G+++E++VL +A++AHI  RVFI+  KT+VFPA P +Y
Sbjct: 248 GEDYVSLGRDVESQVLARAIHAHIHGRVFIDGNKTVVFPASPGSY 292


>gi|84515453|ref|ZP_01002815.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
 gi|84510736|gb|EAQ07191.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
          Length = 294

 Score =  338 bits (866), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+S+ L + C S   I + +  YL+  GCNI+D +QF+D DT   FMR+SF     + L 
Sbjct: 1   MNSFALRVQCTSRRGIVAAVSTYLAEAGCNIIDSAQFDDADTGNFFMRVSFRSEEGLPLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +DF PI   F +     +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  KLRSDFAPIADAFGMNAHFFDEAVKPKVVIMVSRFGHCLNDLLYRWRIGALPVDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V ++ LPF Y+ +T+ NK E+E +++ ++E+   EL++LARYMQILSD LC 
Sbjct: 121 NHMDYQKVVVSHDLPFRYINVTKANKPEAEAQIMQVVEETGTELIVLARYMQILSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA E GVK+IGAT+HY   +LD GPIIEQD +RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQALERGVKLIGATSHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA+VL++A++AH+  RVFIN  KT+VFPA P ++
Sbjct: 241 AQSADDYVSLGRDVEAQVLSRAIHAHVHGRVFINGDKTVVFPASPGSF 288


>gi|163746436|ref|ZP_02153794.1| putative formyltetrahydrofolate deformylase [Oceanibulbus indolifex
           HEL-45]
 gi|161380321|gb|EDQ04732.1| putative formyltetrahydrofolate deformylase [Oceanibulbus indolifex
           HEL-45]
          Length = 294

 Score =  338 bits (866), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 208/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+ + LT+TCPS   I + I  Y++  GCNI D +QF+D D  + FMR+S    T   L 
Sbjct: 1   MTKFCLTVTCPSRRGIVAAIAKYIAENGCNITDSAQFDDADNGQFFMRVSAEAETGNTLE 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  I + F + Y   +T    K +++VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  DLRAGFAEIAEPFGMDYKFHDTDSTMKVVVMVSRFGHCLNDLLYRVRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK E+E +++ ++E    EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHHIKVTKENKSEAEARIMEVVEDAGAELIVLARYMQILSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+VR+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E+ VL++A++AH   RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSASDYVSLGRDVESGVLSRAIHAHAHHRVFLNGNKTVVFPASPGSY 288


>gi|332717058|ref|YP_004444524.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325063743|gb|ADY67433.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 147/289 (50%), Positives = 208/289 (71%), Gaps = 2/289 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M+SY++ ++CP+   I + +  YL+  GCNI D SQF DL+T + FMR+SFV    M+  
Sbjct: 1   MTSYVMKVSCPARSGIVAAVSGYLARSGCNINDSSQFTDLETGRFFMRLSFVSEEGMEPA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A F  +   F ++Y I +    TK +I+VS+  HCLNDLLYR +IG L + IV V+S
Sbjct: 61  ALVAGFASVAADFDMEYDIHDLSRKTKVVIMVSRFGHCLNDLLYRSHIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+++ +T + K E+E  ++ ++     EL++LARYMQ+LS+ LC 
Sbjct: 121 NHLEYQKQVVNEDIPFHHIRVTPETKPEAEAAILQVVRDAGAELVVLARYMQVLSERLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GV++IGATAHY   +LD GPIIEQD +RVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVRLIGATAHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYF 287
           AQ+  DY+++G+++E++VL +A++AHI  RVF+N  KT+VFPA P  Y 
Sbjct: 241 AQSGMDYVSLGRDVESQVLARAIHAHIHHRVFLNGNKTVVFPASPGEYM 289


>gi|254486193|ref|ZP_05099398.1| formyltetrahydrofolate deformylase [Roseobacter sp. GAI101]
 gi|214043062|gb|EEB83700.1| formyltetrahydrofolate deformylase [Roseobacter sp. GAI101]
          Length = 327

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 210/292 (71%), Gaps = 10/292 (3%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +Y LT+TCPS   + + I +YL+   CNI D +QF+D +T   FMR+SF  +  + L 
Sbjct: 34  MKNYALTVTCPSTRGVVAAIANYLADNACNITDSAQFDDKETGNFFMRVSFESDGTVDLA 93

Query: 60  -----FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                F+A   P    F + Y   +  E  K +I+VS+  HCLNDLLYRW IG L ++IV
Sbjct: 94  ALAEGFVATASP----FDMTYDFHDQTEKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIV 149

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH  ++K+V N  +PF+ + +T +NK E+E +++ ++E    +L++LARYMQILSD
Sbjct: 150 AVVSNHMDYQKVVVNNDIPFHCIKVTAENKAEAEARIMAVVEDAGADLIVLARYMQILSD 209

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +C KM+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGAT+HY   +LD GPIIEQD+V
Sbjct: 210 EMCQKMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATSHYVTADLDEGPIIEQDIV 269

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            VTHAQ+  DY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 270 GVTHAQSANDYVSLGRDVESQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 321


>gi|260430256|ref|ZP_05784230.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260418728|gb|EEX11984.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  333 bits (855), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 149/288 (51%), Positives = 210/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M+ Y LT+TC +   I + I  +L+  GCNI D SQF+D++TS+ FMRISF     + L 
Sbjct: 1   MTKYCLTVTCATTRGIVAAIATFLAEHGCNITDSSQFDDVETSRFFMRISFESQDGVDLA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  I + FS+Q++  +  E  K +I+VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  ALEADFAAIAKTFSMQFAFHDEAEKMKVVIMVSRFGHCLNDLLYRVRIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+ + +T++NK ++E  ++ ++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKAVVNSDIPFHCIRVTKENKPQAEAAIMKVVEEAGAELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+  GVK+IGAT+HY   +LD GPIIEQD VR+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFARGVKLIGATSHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++E++VL +A++AH   RVF+N  KT+VF A P +Y
Sbjct: 241 AQSPDDYVSLGRDVESQVLARAIHAHANHRVFLNGNKTVVFQASPGSY 288


>gi|114763913|ref|ZP_01443154.1| formyltetrahydrofolate deformylase protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114543505|gb|EAU46519.1| formyltetrahydrofolate deformylase protein [Roseovarius sp.
           HTCC2601]
          Length = 294

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 207/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           MS  ILT+ CP    I + I  +L+ QGCNI D SQF+D+   + FMR+SF        +
Sbjct: 1   MSQIILTVACPVRSGIVAAISTFLAEQGCNIHDSSQFSDIGNDRFFMRLSFESEQGRSRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    Q F ++++  +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ALAEGFAATAQSFGMEFAFHDPSEKMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T+ NK E+E + + I+ +   EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIKVTKANKPEAEAEQMRIVRETGAELIVLARYMQILSDEMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL++A++AH+ +RVF+N  KT+VFPA P  Y
Sbjct: 241 AQSPSDYVSLGRDVESQVLSRAIHAHMHRRVFLNGDKTVVFPASPGEY 288


>gi|325274280|ref|ZP_08140392.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
 gi|324100597|gb|EGB98331.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
          Length = 298

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 215/285 (75%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+L +TCPS   +T+ I  +LS++GCNI D +QF+D  T+  FMRI+F       L    
Sbjct: 8   YVLRVTCPSIRGVTADITSFLSSRGCNIRDSAQFDDESTNHYFMRITFRSEEGQSLEDLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +FQP+V ++ +++   + +   K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH 
Sbjct: 68  KEFQPLVDKYKMEFEFFDERAKRKVILMVSRFGHCLNDLLYRWGIGALPIDIVGVISNHL 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +K+VE + +P++++ +T++NK E+E   + I+ +   EL++LARYMQILSD +C +M+
Sbjct: 128 DFQKVVEGHGIPYHHIKVTKENKAEAEAAQMRIVREAGAELIVLARYMQILSDEMCQQMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKG +PYKQA+E GVK+IGAT+H+   +LD GPIIEQD+VR+THAQ+
Sbjct: 188 GRIINIHHSFLPSFKGGSPYKQAFERGVKLIGATSHFVTADLDEGPIIEQDIVRITHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            EDY+++G+++E++VL +A++A++  RVF+N+ KTIVFP  P++Y
Sbjct: 248 PEDYVSLGRDVESQVLARAIHAYVHGRVFMNENKTIVFPPSPDSY 292


>gi|260429850|ref|ZP_05783826.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260419333|gb|EEX12587.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 148/288 (51%), Positives = 207/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M   ILT +CP    I + I  +L+ QGCNI D SQF+D+   + FMR+SF   + +   
Sbjct: 1   MPQTILTASCPVRPGIVAAISIFLAEQGCNIHDSSQFSDIVNDRFFMRLSFESESGVTRA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F      F + Y+  +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ALNEGFAETAASFGMDYAFHDPSEKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ LPF+ + +T+QNK E+E + + I+ ++  +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDLPFHCIKVTKQNKPEAEAEQMRIVRESGADLIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI +RVF+N+ KT+VFPA P  Y
Sbjct: 241 AQSPSDYVSLGRDVESQVLARAIHAHIHRRVFMNRDKTVVFPASPGEY 288


>gi|159186111|ref|NP_356339.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|159141245|gb|AAK89124.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  327 bits (839), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 143/288 (49%), Positives = 206/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++YI+ ++CP+   I + +  YL+  GCNI D SQF D +T++ FMR+SF+    +  +
Sbjct: 1   MNTYIMKVSCPARSGIVAAVSGYLARSGCNINDSSQFTDQETARFFMRLSFISEQGSGRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F  +   F + Y I +  +  K +I+VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  ALLDGFGSVAADFDMDYDIHDLSQKKKIVIMVSRFGHCLNDLLYRSRIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+++ +T + K E+E  ++ ++     EL++LARYMQ+LSD LC 
Sbjct: 121 NHLDYQKQVVNEDIPFHHIRVTPETKPEAEGAILQVVRDTGAELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GV++IGATAHY   +LD GPIIEQD +RVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVRLIGATAHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI QRVF+N  KT+VFPA P  +
Sbjct: 241 AQSGMDYVSLGRDVESQVLARAIHAHIHQRVFLNGNKTVVFPASPGEH 288


>gi|150397295|ref|YP_001327762.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150028810|gb|ABR60927.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 298

 Score =  325 bits (832), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 206/285 (72%), Gaps = 2/285 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           Y L + CPS   +T+ I  YLS  GCNI D +QF+D  T + FMR+SF       ++L  
Sbjct: 8   YALRVACPSIRGVTAAIATYLSNNGCNISDSAQFDDKSTGRYFMRVSFQPEEGHTLELLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  I  ++     + +     K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH 
Sbjct: 68  EGFADIAAEYEADAELFDETAKRKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNHF 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++K+V N+ +PF+++ +T +NK+ +E + + I+++   EL++LARYMQ+LSD +C KM+
Sbjct: 128 DYQKIVVNHDIPFHHIKVTRENKLAAEAEQMRIVDETGAELIVLARYMQVLSDGMCRKMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQ+ VRVTHAQ+
Sbjct: 188 GRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQETVRVTHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
            +DY+++G+++E++VL +A++AHI  RVF+N  KTIVFP  P ++
Sbjct: 248 ADDYVSLGRDVESQVLARAIHAHIHGRVFLNGNKTIVFPPSPGSF 292


>gi|186939595|dbj|BAG31003.1| putative formyltetrahydrofolate deformylase [Aminobacter sp.
           AJ110403]
          Length = 291

 Score =  322 bits (825), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 203/284 (71%), Gaps = 2/284 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y L +  PS   +T+ + +YL++ GCNI D +QF+D  T + FMR+SF       L    
Sbjct: 8   YALRVAGPSIRGVTAAVANYLASNGCNISDSAQFDDKSTGRYFMRVSFHSEEGRTLEDLR 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  I ++F       +     K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH 
Sbjct: 68  NGFAEIAKKFEADVEFFDETTKRKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNHM 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            ++KLV N+ +PF+ + +T++NK ++E + + I+E    EL++LARYMQ+LSD +C KM+
Sbjct: 128 DYQKLVVNHDIPFHCIKVTKENKPQAEAEQMRIVEDTGAELIVLARYMQVLSDEMCRKMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTHAQ+
Sbjct: 188 GRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTHAQS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNN 285
            +DY+++G+++E++VL +A++AHI  RVFIN  KTIVFP  P +
Sbjct: 248 ADDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTIVFPPSPGS 291


>gi|89068495|ref|ZP_01155892.1| formyltetrahydrofolate deformylase [Oceanicola granulosus HTCC2516]
 gi|89045914|gb|EAR51974.1| formyltetrahydrofolate deformylase [Oceanicola granulosus HTCC2516]
          Length = 292

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 196/286 (68%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ Y LT++CP+   I + I   L+ +  NI+D +QFND +  + FMR+SF  +T     
Sbjct: 1   MAHYNLTLSCPTAPGIVAAISGELARREGNIVDSAQFNDAEAGRFFMRLSFTTDTPRAAL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A    I     + +++R   E    +ILVS+  HCLNDLLYR  IG L + I  V+SNH
Sbjct: 61  EAGLADIAAPLGIDWTLRARTEKLGIVILVSRFGHCLNDLLYRARIGALPVEIRAVISNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             + + VEN  +PF+++P+T + K ++E   + ++E+    L++LARYMQ+LS+ +C +M
Sbjct: 121 RDYARAVENEGIPFHHIPVTPETKADAEAATLRVVEETEAGLVVLARYMQVLSEEMCRRM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGANPY+QA+  GV++IGATAHY   +LD GPIIEQD VRVTHAQ
Sbjct: 181 SGRIINIHHSFLPSFKGANPYRQAHRKGVRLIGATAHYVTADLDEGPIIEQDTVRVTHAQ 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           + +DY+A+G+++EA+VL +AV AH   RV +N  +T+VFPA P  +
Sbjct: 241 SPQDYVALGRDVEAQVLARAVQAHAHGRVLLNGDRTVVFPAGPGEH 286


>gi|126731705|ref|ZP_01747510.1| formyltetrahydrofolate deformylase [Sagittula stellata E-37]
 gi|126707871|gb|EBA06932.1| formyltetrahydrofolate deformylase [Sagittula stellata E-37]
          Length = 294

 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 203/288 (70%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ + LT++C S   I + I  +L+  GCNI D SQF+D++T + FMR SF   T   L 
Sbjct: 1   MTKFCLTVSCASKRGIVAGIATFLADHGCNITDSSQFDDVETGRFFMRTSFTSETGADLA 60

Query: 61  IAD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F  + +   L ++  +     K +++VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  TLEQAFVSVAEGMDLDFTFHDEAAKMKVVVMVSRFGHCLNDLLYRCRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+ + +T++NK ++E  ++ ++E    +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKTVVNQDIPFHCIRVTKENKPQAEAAIMQVVEDAGADLIVLARYMQILSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+  GVK+IGAT+HY   +LD GPIIEQD +RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFARGVKLIGATSHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA+VL +A++AH   RVF+N  KT+VFP+ P ++
Sbjct: 241 AQSPDDYVSLGRDVEAQVLARAIHAHAHHRVFLNGNKTVVFPSSPGSH 288


>gi|239981526|ref|ZP_04704050.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
 gi|291453377|ref|ZP_06592767.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
 gi|291356326|gb|EFE83228.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
          Length = 299

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 192/279 (68%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           SY+LT+ CP  + I   +  YL   GCNI D  QF D DT   FMR+SF   + + +   
Sbjct: 20  SYVLTLACPDRQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVSFSAGSPVSVEKL 79

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F +++ I  ++E  + +++VS+  HCLNDLL+R  IG L ++I  VVSNH
Sbjct: 80  RASFAAIGDSFRMEWQIHRSEERMRIVLMVSKFGHCLNDLLFRARIGALPVDIAAVVSNH 139

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               +LVE+Y +PF+++P+T+  K E+EQ++++++E+  VEL++LARYMQ+LS++ C ++
Sbjct: 140 PAFAELVESYGIPFHHIPVTKDTKAEAEQRVLDLVEREGVELVVLARYMQVLSENFCKQL 199

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 200 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQEVERVGHEV 259

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +A+G+++E + L +AV  H + R+ +N  +T+VF
Sbjct: 260 TPEQLVAVGRDVECQALARAVKWHAEHRILLNGHRTVVF 298


>gi|311897860|dbj|BAJ30268.1| putative formyltetrahydrofolate deformylase [Kitasatospora setae
           KM-6054]
          Length = 287

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 134/281 (47%), Positives = 190/281 (67%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           S Y+LT++CP  + I   +  YL   GCNI+D  Q+ D  T   FMR+ F      T  K
Sbjct: 7   SQYVLTLSCPDKQGIVHAVSSYLFMTGCNIIDSQQYGDAGTGLFFMRVHFSAEEPVTAEK 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           L  A F  I   F +++ I  + E  + L++VS+  HCLNDLL+R  IG L + I GVVS
Sbjct: 67  LR-ASFAAIGASFRMEWQIHASAERMRVLLMVSKFGHCLNDLLFRTRIGALPVEIAGVVS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NHT  ++L E+Y +PF++LP+T   K ++EQ+L++++    V+L++LARYMQ+LSD LC 
Sbjct: 126 NHTDFRELTESYGIPFHHLPVTRDTKADAEQRLLDLVAAERVDLVVLARYMQVLSDDLCK 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RVTH
Sbjct: 186 ALSGRVINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVARVTH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T +  +A+G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 246 DVTPDQLVALGRDVECQALARAVKWHSERRVLLNGSRTVVF 286


>gi|320009236|gb|ADW04086.1| formyltetrahydrofolate deformylase [Streptomyces flavogriseus ATCC
           33331]
          Length = 299

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 188/279 (67%), Gaps = 2/279 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  + L    
Sbjct: 21  YVLTLSCPDRQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTLDKLR 80

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F +++ I    +  + +++VS+  HCLNDLL+R   G L + IV VVSNHT
Sbjct: 81  ASFAAIGDSFRMEWQIHRASDRMRIVLMVSKFGHCLNDLLFRSRTGALPVEIVAVVSNHT 140

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF ++P+ ++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC +++
Sbjct: 141 DFAELVASYGVPFRHIPVNKENKPEAEAQLLELVRGENVELVVLARYMQVLSDDLCKQLS 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 201 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGVT 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +  +A+G+++E + L +AV  H ++R+ +N R+T+VFP
Sbjct: 261 PDQLVAVGRDVECQALARAVTWHAERRILLNGRRTVVFP 299


>gi|282860684|ref|ZP_06269750.1| formyltetrahydrofolate deformylase [Streptomyces sp. ACTE]
 gi|282564420|gb|EFB69956.1| formyltetrahydrofolate deformylase [Streptomyces sp. ACTE]
          Length = 300

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 185/279 (66%), Gaps = 2/279 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    +    
Sbjct: 22  YVLTLSCPDRQGIVHAVSSYLLVTGCNIEDSQQFGDHDTGLFFMRVHFSADGPADVVKLR 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I    E  + +++VS+  HCLNDLL+R + G L + IV VVSNHT
Sbjct: 82  AGFAAIGDSFRMDWQIHRASERMRVVLMVSKFGHCLNDLLFRASTGALPVEIVAVVSNHT 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF ++P+T   K E+E +L+ ++   NVEL++LARYMQ+LSD LC +++
Sbjct: 142 DFAELVASYGIPFRHIPVTRDTKQEAEAQLLELVRGENVELVVLARYMQVLSDDLCKQLS 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 202 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGVT 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +  +A+G+++E + L +AV  H ++R+ +N R+T++FP
Sbjct: 262 PDQLVAVGRDVECRALARAVKWHAERRILLNGRRTVIFP 300


>gi|239943392|ref|ZP_04695329.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
 gi|239989845|ref|ZP_04710509.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           11379]
 gi|291446861|ref|ZP_06586251.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
 gi|291349808|gb|EFE76712.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
          Length = 298

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 188/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  + +    
Sbjct: 20  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKLR 79

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 80  ASFAAIGEAFRMEWQIHRSDEKMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNHT 139

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC +++
Sbjct: 140 DFAELVASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQLS 199

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 200 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 259

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 260 PDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVIF 297


>gi|302552227|ref|ZP_07304569.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302469845|gb|EFL32938.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 293

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  + L    
Sbjct: 15  YVLTLSCPDRKGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVSLDKLR 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F +++ I    +  + L++VS+  HCLNDLL+R   G L + I GVVSNHT
Sbjct: 75  ASFAAIGDSFQMEWQINRADQKMRILLMVSKFGHCLNDLLFRARTGALPVEIAGVVSNHT 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T+  K E+E +L++++ +  VEL++LARYMQ+LSD LC +++
Sbjct: 135 DFAELVGSYNIPFHHIPVTKDTKPEAEARLLDLVREEGVELVVLARYMQVLSDDLCKQLS 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 195 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +AIG+++E + L + V  H ++R+ +N R+T++F
Sbjct: 255 PEGLVAIGRDVECQALARGVKWHAERRILLNGRRTVIF 292


>gi|182436856|ref|YP_001824575.1| formyltetrahydrofolate deformylase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465372|dbj|BAG19892.1| putative formyltetrahydrofolate deformylase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 298

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  + +    
Sbjct: 20  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKLR 79

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 80  ASFAAIGEAFRMEWQIHRSAERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNHT 139

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC +++
Sbjct: 140 DFAELTASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQLS 199

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 200 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 259

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 260 PDQLVAIGRDVECRALARAVKWHAERRILLNGRRTVIF 297


>gi|326777451|ref|ZP_08236716.1| formyltetrahydrofolate deformylase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657784|gb|EGE42630.1| formyltetrahydrofolate deformylase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 298

 Score =  291 bits (745), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  + +    
Sbjct: 20  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKLR 79

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 80  ASFAAIGEAFRMEWQIHRSAERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNHT 139

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC +++
Sbjct: 140 DFAELTASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQLS 199

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 200 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 259

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 260 PDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVIF 297


>gi|318056978|ref|ZP_07975701.1| formyltetrahydrofolate deformylase [Streptomyces sp. SA3_actG]
 gi|318080281|ref|ZP_07987613.1| formyltetrahydrofolate deformylase [Streptomyces sp. SA3_actF]
 gi|333026314|ref|ZP_08454378.1| putative formyltetrahydrofolate deformylase [Streptomyces sp.
           Tu6071]
 gi|332746166|gb|EGJ76607.1| putative formyltetrahydrofolate deformylase [Streptomyces sp.
           Tu6071]
          Length = 305

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 185/286 (64%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------- 54
           SSY+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F          
Sbjct: 19  SSYVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSVESTGQDGE 78

Query: 55  -TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
            T +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I
Sbjct: 79  PTGLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSKFGHCLNDLLFRSRSGALPVEI 138

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNHT  ++L  +Y +PF+++P+ +  K ++EQ+ ++++ + +VEL++LARYMQ+LS
Sbjct: 139 AAVVSNHTDFRELTASYGVPFHHIPVPKDGKAQAEQRFLDLVAEEDVELVVLARYMQVLS 198

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC K++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 199 DDLCKKLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEV 258

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 259 ERVTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 304


>gi|294814255|ref|ZP_06772898.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|326442646|ref|ZP_08217380.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|294326854|gb|EFG08497.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
          Length = 283

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     + L    
Sbjct: 5   YVLTLSCPDKQGIVHAVSSYLFITGCNIEDSKQFGDQDTGLFFMRVQFSAEEPVTLEKLR 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  +   F + + I    E  + +++VS+  HCLNDLL+R  IG L + I  VVSNH 
Sbjct: 65  ASFAAVGDAFQMDWRINRADEPMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNHR 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++L  +Y +PF+++P+T++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC +++
Sbjct: 125 EFEELAGSYHIPFHHIPVTKENKPEAEARLLELVRAENVELVVLARYMQVLSDDLCKELS 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  +
Sbjct: 185 GRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGLS 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 245 PEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 282


>gi|254388399|ref|ZP_05003634.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|197702121|gb|EDY47933.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
          Length = 289

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     + L    
Sbjct: 11  YVLTLSCPDKQGIVHAVSSYLFITGCNIEDSKQFGDQDTGLFFMRVQFSAEEPVTLEKLR 70

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  +   F + + I    E  + +++VS+  HCLNDLL+R  IG L + I  VVSNH 
Sbjct: 71  ASFAAVGDAFQMDWRINRADEPMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNHR 130

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++L  +Y +PF+++P+T++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC +++
Sbjct: 131 EFEELAGSYHIPFHHIPVTKENKPEAEARLLELVRAENVELVVLARYMQVLSDDLCKELS 190

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  +
Sbjct: 191 GRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGLS 250

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 251 PEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 288


>gi|297200447|ref|ZP_06917844.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
 gi|197709569|gb|EDY53603.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
          Length = 292

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 188/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     + +    
Sbjct: 14  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAEAPVTVDKLR 73

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I   ++  + +++VS+  HCLNDLL+R  IG L + I  VVSNHT
Sbjct: 74  ASFAAIGDSFHMDWQIHRAEDKMRVVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNHT 133

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T +NK E+E +L+ ++ + +VEL++LARYMQ+LSD LC +++
Sbjct: 134 DFAELVGSYDIPFHHIPVTRENKAEAEARLLELVREQDVELVVLARYMQVLSDDLCKQLS 193

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 194 GKIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 253

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 254 PDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 291


>gi|295838217|ref|ZP_06825150.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB74]
 gi|295826919|gb|EDY43570.2| formyltetrahydrofolate deformylase [Streptomyces sp. SPB74]
          Length = 298

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 183/286 (63%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----- 56
           S Y+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F   +      
Sbjct: 12  SGYVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSLASAGPDEE 71

Query: 57  ---MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I
Sbjct: 72  AAGLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSRFGHCLNDLLFRSRSGALPVEI 131

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNHT  ++L  +Y +PF+++P+    K E+E++ ++++ + NVEL++LARYMQ+LS
Sbjct: 132 AAVVSNHTDFRELTGSYGVPFHHIPVPRDGKAEAERRFLDLVAEENVELVVLARYMQVLS 191

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 192 DDLCKRLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEV 251

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 252 ERVTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 297


>gi|29830389|ref|NP_825023.1| formyltetrahydrofolate deformylase [Streptomyces avermitilis
           MA-4680]
 gi|29607500|dbj|BAC71558.1| putative formyltetrahydrofolate deformylase [Streptomyces
           avermitilis MA-4680]
          Length = 293

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F       ++   
Sbjct: 15  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAEAPVTVEKLR 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I   ++  + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 75  ASFTAIGDAFHMDWQIHRAEDRMRVVLMVSKFGHCLNDLLFRARTGALPVEIAAVVSNHT 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T  NK E+E +L+ ++   N+EL++LARYMQ+LSD LC +++
Sbjct: 135 DFAELVASYDIPFHHIPVTRDNKAEAEAQLLELVRSENIELVVLARYMQVLSDDLCKQLS 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 195 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 255 PDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 292


>gi|302560077|ref|ZP_07312419.1| formyltetrahydrofolate deformylase [Streptomyces griseoflavus
           Tu4000]
 gi|302477695|gb|EFL40788.1| formyltetrahydrofolate deformylase [Streptomyces griseoflavus
           Tu4000]
          Length = 293

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    ++   
Sbjct: 15  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVTVEKLR 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I       + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 75  ASFAAIGDSFQMDWQINRADAKMRIVLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNHT 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T+  K E+E KL+ I+ +  VEL++LARYMQ+LSD LC +++
Sbjct: 135 DFAELVASYNVPFHHIPVTKDTKAEAEAKLLEIVREERVELVVLARYMQVLSDDLCKQLS 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 195 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +A+G+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 255 PEGLVAVGRDVECQALARAVKWHAERRILLNGRRTVVF 292


>gi|32141235|ref|NP_733636.1| formyltetrahydrofolate deformylase [Streptomyces coelicolor A3(2)]
 gi|256786134|ref|ZP_05524565.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
 gi|289770029|ref|ZP_06529407.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
 gi|24427864|emb|CAD55482.1| putative formyltetrahydrofolate deformylase (fragment)
           [Streptomyces coelicolor A3(2)]
 gi|289700228|gb|EFD67657.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
          Length = 297

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 135/279 (48%), Positives = 186/279 (66%), Gaps = 4/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F      T  KL 
Sbjct: 19  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAGEPVTVDKLR 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I      T+ +++VS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 79  -ASFTAIGDAFHMDWQINRADAKTRIVLMVSRFGHCLNDLLFRARIGALPVEIAAVVSNH 137

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T+  K E+E +++ I+ + NVEL++LARYMQ+LSD LC  +
Sbjct: 138 TDFAELVGSYDIPFHHIPVTKDTKPEAEARVLEIVREENVELVVLARYMQVLSDDLCKAL 197

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 198 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 257

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 258 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 296


>gi|239930613|ref|ZP_04687566.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
 gi|291438978|ref|ZP_06578368.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
 gi|291341873|gb|EFE68829.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
          Length = 293

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    ++   
Sbjct: 15  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVTVEKLR 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I    +  + L++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 75  ASFAAIGDSFQMDWRIDRGDQKMRILLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNHT 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T++ K E+E +L+ I+ +  VEL++LARYMQ+LSD LC +++
Sbjct: 135 DFAELVSSYDIPFHHIPVTKETKPEAEARLLEIVREEQVELVVLARYMQVLSDDLCKQLS 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 195 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDAT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 255 PDQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 292


>gi|302519940|ref|ZP_07272282.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB78]
 gi|302428835|gb|EFL00651.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB78]
          Length = 305

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 131/286 (45%), Positives = 185/286 (64%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------- 54
           SSY+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F          
Sbjct: 19  SSYVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSVESTRQDGE 78

Query: 55  -TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
            T +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I
Sbjct: 79  PTGLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSKFGHCLNDLLFRSRSGALPVEI 138

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNHT  ++L  +Y +PF+++P+ +  K ++E++ ++++ + +VEL++LARYMQ+LS
Sbjct: 139 AAVVSNHTDFRELTASYGVPFHHIPVPKDGKGQAEERFLDLVAEEDVELVVLARYMQVLS 198

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC K++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 199 DDLCKKLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEV 258

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 259 ERVTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 304


>gi|328884274|emb|CCA57513.1| Formyltetrahydrofolate deformylase [Streptomyces venezuelae ATCC
           10712]
          Length = 283

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     + +    
Sbjct: 5   YVLTLSCPDKQGIVHAVSSYLFITGCNIEDSQQFGDRDTGLFFMRVHFSAEAPVNVDKLR 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  +   F++ + I    +  + +++VS+  HCLNDLL+R  IG L + IV VVSNHT
Sbjct: 65  ASFAAVGDSFTMDWQINRADQRMRIVLMVSKFGHCLNDLLFRSRIGALPVEIVAVVSNHT 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LV +Y +PF ++P+T+  K  +E +L++++ + NVEL++LARYMQ+LSD LC +++
Sbjct: 125 DFQELVGSYGIPFRHIPVTKDTKAAAEAELLDLVREENVELVVLARYMQVLSDDLCKQLS 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 185 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHEVT 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +AIG+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 245 PDQLVAIGRDVECQALARAVKWHAEHRILLNGRRTVVF 282


>gi|319779080|ref|YP_004129993.1| Formyltetrahydrofolate deformylase [Taylorella equigenitalis MCE9]
 gi|317109104|gb|ADU91850.1| Formyltetrahydrofolate deformylase [Taylorella equigenitalis MCE9]
          Length = 281

 Score =  288 bits (736), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 191/280 (68%), Gaps = 1/280 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKL 59
           M  YILTI+CP    I   +  +L   G NI+D  QF D ++   F+RI F   N+  + 
Sbjct: 1   MKHYILTISCPDRTGIVHTVTGFLLNLGGNIIDSQQFGDHESQTFFLRIHFSLANSDAET 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+ I ++F++ + I +    +K LILVS+  HCLNDLL+R   G L ++IVGVVSN
Sbjct: 61  LGKSFENIAKEFNMNWKIWDKDRKSKVLILVSKQGHCLNDLLFRTKSGNLPIDIVGVVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +KL ++Y +PFY+LP++++N+ E E ++I ++++  V+L++LARYMQILS+ +C  
Sbjct: 121 HRVFEKLSKSYGIPFYHLPVSKENRPEQEAQIIKLVDELQVDLVVLARYMQILSNDMCKA 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLPSFKGA PY QAY  GVKIIGATAHY   +LD GPIIEQ++  V H 
Sbjct: 181 LNGKAINIHHSFLPSFKGAKPYHQAYARGVKIIGATAHYVTSDLDEGPIIEQEIEHVDHR 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           QT ED + +G +IE+ VL++AV  HI+ R+ +N  KT+VF
Sbjct: 241 QTAEDLVQVGSDIESLVLSRAVRGHIEHRILLNGNKTVVF 280


>gi|290959549|ref|YP_003490731.1| formyltetrahydrofolate deformylase [Streptomyces scabiei 87.22]
 gi|260649075|emb|CBG72189.1| putative formyltetrahydrofolate deformylase [Streptomyces scabiei
           87.22]
          Length = 293

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT+ CP    I   +  YL   G NI D  QF D DT   FMR+ F     + +    
Sbjct: 15  YVLTLACPDKPGIVHAVSSYLFMTGGNIEDSQQFGDHDTGLFFMRVHFSAEAPVNVEKLR 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + I    E  + +++VS+  HCLNDLL+R +IG L + I  VVSNHT
Sbjct: 75  ASFAAIGDSFRMDWQINRADEKMRVVLMVSRFGHCLNDLLFRASIGALPVEIAAVVSNHT 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T+  K ++E +++ I+ + NVEL++LARYMQ+LSD LC +++
Sbjct: 135 DFAELVRSYDIPFHHVPVTKDTKAQAEARILEIVREENVELVVLARYMQVLSDDLCKQLS 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 195 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGVT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +A+G+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 255 PEGLVAVGRDVECQALARAVKWHAERRILMNGRRTVVF 292


>gi|297193747|ref|ZP_06911145.1| formyltetrahydrofolate deformylase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|297151924|gb|EFH31430.1| formyltetrahydrofolate deformylase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 289

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 130/278 (46%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F   T + +    
Sbjct: 11  YVLTLSCPDKQGIVHAVSSYLFITGCNIEDSRQFGDRDTGLFFMRVHFSAETPVTVDKLR 70

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  +   F + + I    E  + +++VS+  HCLNDLL+R   G L + I  VVSNHT
Sbjct: 71  ASFAAVGDAFQMDWQIHLADERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNHT 130

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T+ NK  +E +L++++    VEL++LARYMQ+LSD LC +++
Sbjct: 131 DFAELVASYDIPFHHIPVTKDNKAAAEAQLLDLVHAEQVELVVLARYMQVLSDDLCKQLS 190

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 191 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHEVT 250

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 251 PEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 288


>gi|302536000|ref|ZP_07288342.1| formyltetrahydrofolate deformylase [Streptomyces sp. C]
 gi|302444895|gb|EFL16711.1| formyltetrahydrofolate deformylase [Streptomyces sp. C]
          Length = 295

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 186/280 (66%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
           + Y+LT++CP  + I   +  YL   GCNI+D  QF D +T   FMR+ F     + +  
Sbjct: 15  AQYVLTVSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDRETGLFFMRVHFEAEPAVTVEK 74

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I   F + + I  + E  + +++VS+  HCLNDLL+R  IG L + I  VVSN
Sbjct: 75  LRASFAAIGDSFRMDWQIHRSDERMRIVLMVSKFGHCLNDLLFRSRIGALPVEIAAVVSN 134

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT   +LV +Y +PF ++P+T+  K ++E +L+ ++ + NVEL++LARYMQ+LSD LC +
Sbjct: 135 HTDFAELVGSYDIPFVHIPVTKDTKADAEARLLELVREQNVELVVLARYMQVLSDTLCKE 194

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 195 LSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHE 254

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +  +AIG+++E + L +AV  H + RV +N  +T+VF
Sbjct: 255 VTPDQLVAIGRDVECQALARAVKWHSEHRVLLNGSRTVVF 294


>gi|317124555|ref|YP_004098667.1| formyltetrahydrofolate deformylase [Intrasporangium calvum DSM
           43043]
 gi|315588643|gb|ADU47940.1| formyltetrahydrofolate deformylase [Intrasporangium calvum DSM
           43043]
          Length = 280

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 138/282 (48%), Positives = 192/282 (68%), Gaps = 5/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ +I+T+TC     I + +   L     NI++  QF+D DT+  FMR   VF+      
Sbjct: 1   MARHIMTLTCDDRPGIVAAVSTALLDVNANIVENQQFSDEDTNLFFMRT--VFDAAQDEV 58

Query: 61  IADFQPIVQQFSLQY---SIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 I +  ++++   ++R   E  +TLILVS+ DHCL DLLYRW  G L ++IVGVV
Sbjct: 59  QTVLDAIDRSAAVEHQHLAVRPADERCRTLILVSRFDHCLLDLLYRWKSGDLPIDIVGVV 118

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE Y +PF +LP+T++ K  +E +L+ ++   +V L++LARYMQILSD LC
Sbjct: 119 SNHEDTRGLVEYYGVPFTHLPVTKETKAAAEAELLRLVAAQDVGLVVLARYMQILSDDLC 178

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA+E GVK+IGA+AHY   +LD GPIIEQDVVRVT
Sbjct: 179 QQLAGRAINIHHSFLPGFKGAKPYHQAHERGVKLIGASAHYVTGDLDEGPIIEQDVVRVT 238

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA+T E  +AIG+++E +VL++AV  H + RVF++ R+TIVF
Sbjct: 239 HAETPERLVAIGRDVERRVLSRAVRDHAESRVFLSGRRTIVF 280


>gi|297158245|gb|ADI07957.1| formyltetrahydrofolate deformylase [Streptomyces bingchenggensis
           BCW-1]
          Length = 290

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           YILT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F   + +++    
Sbjct: 12  YILTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDRDTGLFFMRVHFRAVSPVRVEDLR 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  + + F + + I    E  + ++LVS+  HCLNDLL+R  IG L + I  VVSNHT
Sbjct: 72  ASFAAVGESFQMDWQIHPAAEKMRVVLLVSKFGHCLNDLLFRSRIGALPVEIAAVVSNHT 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF ++P+T++NK ++E +L+ ++E   VEL++LARYMQ+LSD LC ++ 
Sbjct: 132 DFAELVGSYGVPFRHIPVTKENKAQAEAELLELVEAEKVELVVLARYMQVLSDDLCKRLA 191

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H   
Sbjct: 192 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHELN 251

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +A G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 252 PDQLVAAGRDVECQALARAVKWHSERRVLLNGHRTVVF 289


>gi|307327708|ref|ZP_07606892.1| formyltetrahydrofolate deformylase [Streptomyces violaceusniger Tu
           4113]
 gi|306886606|gb|EFN17608.1| formyltetrahydrofolate deformylase [Streptomyces violaceusniger Tu
           4113]
          Length = 289

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 187/278 (67%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           YILT++CP  + I   +  YL   GCNI D  QF D DT   FMR++F   + +K+    
Sbjct: 11  YILTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDRDTGLFFMRVAFRAVSPVKVEDLR 70

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  + + F + + I       + L++VS+  HCLNDLL+R  IG L + I  VVSNHT
Sbjct: 71  ASFAAVGESFQMDWEIHPADRKMRILLMVSKFGHCLNDLLFRSRIGALPVEIAAVVSNHT 130

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LV +Y +PF++LP+T+  K E+E  L++++   +VEL++LARYMQ+LSD LC  ++
Sbjct: 131 DFEELVGSYGIPFHHLPVTKDTKQEAEAWLLDLVRTEHVELVVLARYMQVLSDDLCKALS 190

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 191 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHELT 250

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +A+G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 251 PDQLVAVGRDVECQALARAVKWHSERRVLLNGHRTVVF 288


>gi|329941335|ref|ZP_08290614.1| formyltetrahydrofolate deformylase [Streptomyces griseoaurantiacus
           M045]
 gi|329299866|gb|EGG43765.1| formyltetrahydrofolate deformylase [Streptomyces griseoaurantiacus
           M045]
          Length = 295

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 184/279 (65%), Gaps = 4/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           Y+LT++CP  + I   +  YL   GCNI+D  QF D DT   FMR+ F      T  KL 
Sbjct: 17  YVLTLSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDQDTGLFFMRVHFSAEPSVTSEKLR 76

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I    E  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 77  -ASFAAIGDSFHMDWQIHRADEKMRIVLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNH 135

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T + K ++E +L+ I+ +  VEL++LARYMQ+LSD LC K+
Sbjct: 136 TDFAELVASYGIPFHHVPVTRETKADAEARLLGIVREAEVELVVLARYMQVLSDDLCKKL 195

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 196 NGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 255

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +A+G+++E + L +AV  H ++R+ +N  +T++F
Sbjct: 256 TPDQLVAVGRDVECQALARAVKWHAERRILLNGHRTVIF 294


>gi|117927364|ref|YP_871915.1| formyltetrahydrofolate deformylase [Acidothermus cellulolyticus
           11B]
 gi|117647827|gb|ABK51929.1| formyltetrahydrofolate deformylase [Acidothermus cellulolyticus
           11B]
          Length = 283

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 192/283 (67%), Gaps = 5/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+  ILT++CP    I   +  +L+ +G NILD  QF D  T + FMR+  +  T  ++ 
Sbjct: 1   MNRCILTLSCPDRLGIVHAVSGFLADRGANILDSQQFGDRSTRRFFMRVH-IECTDPRIG 59

Query: 61  IA----DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           IA    DF  + + FS+ + I + +E T+T+I+VS+  HCLNDLLYRW+IG L  +IV V
Sbjct: 60  IAELRRDFSAVAEAFSMTWQIHDEEERTRTIIMVSRLGHCLNDLLYRWHIGALPADIVAV 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + L  +Y +P++Y+P+T + K ++E KL+ ++++ +V+L++LARYMQILS  +
Sbjct: 120 VSNHRDFEDLAASYGIPYHYIPVTPETKAQAEDKLLALVDEASVDLIVLARYMQILSPTV 179

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C ++ G+IINIHHSFLPSF+GA PY QAYE GVK+IGATAHY    LD GPIIEQ+V RV
Sbjct: 180 CERLPGKIINIHHSFLPSFRGARPYHQAYERGVKLIGATAHYVTATLDEGPIIEQEVARV 239

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H   +     +G+++E   L +AV  H++ RV ++  KT+VF
Sbjct: 240 DHTYDVAHLAEVGRDLECLALARAVRWHLEHRVLLDGNKTVVF 282


>gi|254385822|ref|ZP_05001142.1| formyltetrahydrofolate deformylase [Streptomyces sp. Mg1]
 gi|194344687|gb|EDX25653.1| formyltetrahydrofolate deformylase [Streptomyces sp. Mg1]
          Length = 291

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 186/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F   T + L    
Sbjct: 13  YVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSRQFGDHDTGLFFMRVHFSAETPVTLEKLR 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F + + +  +    + +++VS+  HCLNDLL+R +IG L + I  VVSNHT
Sbjct: 73  ASFAAIGDSFRMDWELHRSDARMRIVLMVSKFGHCLNDLLFRASIGALPVEIAAVVSNHT 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LV +Y +PF ++P+T+  K  +E++L+ ++ + +VEL++LARYMQ+LSD LC +++
Sbjct: 133 DFEELVGSYDIPFVHIPVTKDTKAAAEERLLELVREQDVELVVLARYMQVLSDTLCKELS 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 193 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHEVT 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +A+G+++E + L +AV  H + RV +N  +T+VF
Sbjct: 253 PDQLVAVGRDVECQALARAVKWHSEHRVLLNGSRTVVF 290


>gi|260222615|emb|CBA32352.1| Formyltetrahydrofolate deformylase [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 327

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 191/281 (67%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +YILT +CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F   +C +L  A
Sbjct: 49  TYILTFSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDHDTGLFFMRVQF---SCSQLSHA 105

Query: 63  DFQPIVQQFS----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           + +  +  F+    LQ++++   +  +T+I+VS+  HCLNDLL+RW  G L L+I  +VS
Sbjct: 106 ELKSQLGTFAEPLKLQWNLQTVAQPMRTVIMVSKEGHCLNDLLFRWKSGLLPLDIRAIVS 165

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E K + IIE    EL++LARYMQILSD++C 
Sbjct: 166 NHREFYQLAASYNVPFHHIPVTAATKEQAEAKQLEIIEAEGAELVVLARYMQILSDNMCR 225

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H
Sbjct: 226 QLNGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARVDH 285

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++T+ED   +G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 286 SRTVEDLTTLGRDTESQVLARAVKWHSEHRVLLNGHKTVIF 326


>gi|254473959|ref|ZP_05087352.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
 gi|211956848|gb|EEA92055.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
          Length = 285

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 196/280 (70%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           ++Y+LT++C   + I + + + +++Q CNI + +Q+ D +T++ FMRISF     M  + 
Sbjct: 5   ANYVLTLSCGDRKGIVAAVANSIASQNCNICESAQYGDPETNRFFMRISFNAPEGMTKEQ 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F P+   +   + + +  +  + L+LVSQ  HCLNDLLYR + G L +++V V SN
Sbjct: 65  FEEGFGPVATGYGFDWKVHDLSKKPRVLVLVSQMGHCLNDLLYRNSTGQLPMDLVAVASN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT ++  VE+ Q+PF+YLP+T++ K E E +++ ++E+ N++L+ILARYMQILS+ LC +
Sbjct: 125 HTKYQSRVEHEQIPFHYLPVTKETKAEQEAQIVELVERENIDLVILARYMQILSNELCER 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G++INIHHSFLPSF GA PY +A+  GVK++GATAHY   +LD GPIIEQDV RV H 
Sbjct: 185 LAGKVINIHHSFLPSFIGAKPYHRAHARGVKMVGATAHYVTADLDEGPIIEQDVSRVEHF 244

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ + IA G++ E++VL +AV  H++ R+ +N  +T++F
Sbjct: 245 HSVNELIAQGRDTESQVLARAVRYHLEHRILLNGDRTVIF 284


>gi|90022021|ref|YP_527848.1| formyltetrahydrofolate deformylase [Saccharophagus degradans 2-40]
 gi|89951621|gb|ABD81636.1| formyltetrahydrofolate deformylase [Saccharophagus degradans 2-40]
          Length = 293

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 135/282 (47%), Positives = 184/282 (65%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI---SFVFNTCM 57
           +S  IL  +C     I + +    S QG NI + SQF D+ T + FMR    S      +
Sbjct: 10  VSELILKFSCDDQPGIVASVASLFSLQGFNIRESSQFEDVSTRRFFMRTLLESVEGPKSL 69

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              ++ FQ +  ++ + + + +  E TK LI VSQ  HCL++LL  W  G L ++IVGVV
Sbjct: 70  ADVMSAFQSVADRYKMTWELTDAAEKTKVLIAVSQWGHCLDNLLNGWKRGYLPVDIVGVV 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K L E Y +PF+YLP+T   K + EQ+++++++ +  +L++LARYMQILSD LC
Sbjct: 130 SNHEVMKPLCEWYGVPFHYLPVTADTKPQQEQQILDVMDSSEADLLVLARYMQILSDDLC 189

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   ELD GPIIEQ V RV+
Sbjct: 190 KKLEGRAINIHHSFLPGFKGARPYHQAYERGVKLIGATAHYVTAELDEGPIIEQAVERVS 249

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T E+ + IG++ EA VL +AV  H ++RV +N +KT+VF
Sbjct: 250 HANTPEELVEIGRDSEAVVLQRAVRWHAERRVLLNGKKTVVF 291


>gi|264680505|ref|YP_003280415.1| formyltetrahydrofolate deformylase [Comamonas testosteroni CNB-2]
 gi|299532934|ref|ZP_07046321.1| formyltetrahydrofolate deformylase [Comamonas testosteroni S44]
 gi|262211021|gb|ACY35119.1| formyltetrahydrofolate deformylase [Comamonas testosteroni CNB-2]
 gi|298719158|gb|EFI60128.1| formyltetrahydrofolate deformylase [Comamonas testosteroni S44]
          Length = 282

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 129/281 (45%), Positives = 188/281 (66%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           +YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  +      +K
Sbjct: 4   AYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPVTGLFFMRVQFACDGKDAASLK 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A+   +  Q+ +Q+S+ +  E  KT+I+VS+  HCLNDLL+RW  G L + I  ++S
Sbjct: 64  ASVAE---LADQYQMQWSLHSKAERIKTVIMVSKEGHCLNDLLFRWKSGLLPIEIKAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E++   IIE+   EL++LARYMQ+LS+ LC 
Sbjct: 121 NHREFYQLAASYNIPFHHIPVTAATKAQAEERQYEIIEEEGAELVVLARYMQVLSNDLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H ++RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSERRVILNGHKTVVF 281


>gi|319785684|ref|YP_004145159.1| formyltetrahydrofolate deformylase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464196|gb|ADV25928.1| formyltetrahydrofolate deformylase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 283

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 128/279 (45%), Positives = 179/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLF 60
            YIL ++CP    I   +   L  QGCNILD  QF D +T + F+R+ F       ++  
Sbjct: 4   DYILALSCPDRTGIVYRVSGLLFGQGCNILDAQQFGDEETGRFFLRVHFELPEPQALEGV 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  +  +F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH
Sbjct: 64  RERFANLAGEFDMDWQLHDARRRARLLVLVSRQGHCLNDLLFRAHSGQLRVDIAAVASNH 123

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                L  +Y +PF++LP+   N+ E EQ +I+++E+  V+L++LARYMQILS  LC  +
Sbjct: 124 QDFAALSASYGVPFHHLPVDASNRGEQEQAIIDLVEREQVDLVVLARYMQILSPRLCEAL 183

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA 
Sbjct: 184 AGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTPDLDEGPIIEQDVARVDHAM 243

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D + +G +IE++VL +AV  H++ R+ +N  KT+VF
Sbjct: 244 TPRDLVRVGSDIESQVLARAVRRHVEHRILLNGHKTVVF 282


>gi|297197992|ref|ZP_06915389.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
 gi|197715005|gb|EDY59039.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
          Length = 290

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 189/279 (67%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LT++CP    +   +  +L     NI +  QF+D    + FMR+ F  +   T ++  
Sbjct: 11  FVLTLSCPDRSGLVHAVTGFLVRHSGNIQESQQFDDRLQDRFFMRVHFDVSDPGTTLEDL 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F P+ + + + + +RN    T+TLI+VS+  HCLNDLL+R   G L + +  +VSNH
Sbjct: 71  RSGFAPVAEAYRITWQLRNAATPTRTLIMVSKFGHCLNDLLFRQRTGALGIEVPAIVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                L E+Y +PF+++P+T + K ++E +L+ ++++ +++L++LARYMQILS+ LC ++
Sbjct: 131 RDFAPLAESYGIPFHHVPVTPETKADAEARLLELVDRLDIDLVVLARYMQILSNDLCKQL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDV+RV HAQ
Sbjct: 191 EGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTPDLDEGPIIEQDVIRVNHAQ 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + E  + +G+++EA+VL +AV  H Q RV IN  +T+VF
Sbjct: 251 SAESLVTLGRDVEAQVLARAVEWHSQSRVMINGHRTVVF 289


>gi|167033112|ref|YP_001668343.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
 gi|166859600|gb|ABY98007.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
          Length = 288

 Score =  281 bits (720), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 130/280 (46%), Positives = 184/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK----L 59
           +IL ++CP+   I + +  YL+  GC I +++QF+D D  + FMR  F FNT +      
Sbjct: 8   FILRVSCPAVSGIVAAVTTYLAEHGCYISEMAQFDDEDNGRFFMRAVFRFNTGVSGDTPQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + Q+F +Q+S+ ++    + L++VS+ DHCL+DLLYR   G L + I  VVSN
Sbjct: 68  LEAGFTDVAQRFDMQWSLHSSARPMRVLLMVSKFDHCLSDLLYRHAKGELDMQITAVVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T+  K E E  L+ I+E    EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAERQGIRFVYLPVTKDTKAEQEAALLRIVEDTGTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV HA
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTRDLDEGPIIEQEVQRVDHA 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +  +AIG++ E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YAPDALVAIGRDTETIALSRAVKYHLEHRVFLNHDRTVIF 287


>gi|121603212|ref|YP_980541.1| formyltetrahydrofolate deformylase [Polaromonas naphthalenivorans
           CJ2]
 gi|120592181|gb|ABM35620.1| formyltetrahydrofolate deformylase [Polaromonas naphthalenivorans
           CJ2]
          Length = 282

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 125/278 (44%), Positives = 184/278 (66%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-KLFI 61
           +YILT++CP    I   +  +L   G NI + +Q+ND DT   FMR+ F  +    +   
Sbjct: 4   AYILTLSCPDRRGIVHAVSGFLFEHGGNIEEAAQYNDPDTGLFFMRVRFACDELAPEALS 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           +  +   + F + + + +T +  +T+ILVS+  HCLNDLL+RW  G L L++  ++SNH 
Sbjct: 64  SQLKTFAEPFEMNWKLHDTTQPMRTVILVSKEGHCLNDLLFRWKSGLLPLDVRAIISNHR 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF++LP++   K + E + + IIE    EL++LARYMQILS+ +C K+ 
Sbjct: 124 DFYQLAASYNIPFHHLPVSAATKGQVEARQLEIIEAEGAELVVLARYMQILSNDMCKKLA 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H++T
Sbjct: 184 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHSKT 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A+G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 244 VEDLTAMGRDTESQVLARAVKWHSEHRVVLNGHKTVIF 281


>gi|221064880|ref|ZP_03540985.1| formyltetrahydrofolate deformylase [Comamonas testosteroni KF-1]
 gi|220709903|gb|EED65271.1| formyltetrahydrofolate deformylase [Comamonas testosteroni KF-1]
          Length = 282

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 129/281 (45%), Positives = 186/281 (66%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           +YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  +      +K
Sbjct: 4   AYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPVTGLFFMRVQFACDGKDAASLK 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A    +  Q+ +Q+S+ +  E  KT+I+VS+  HCLNDLL+RW  G L + I  ++S
Sbjct: 64  ASVAQ---LADQYQMQWSLHSKAERIKTVIMVSKEGHCLNDLLFRWKSGLLPIEIKAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E++   IIE+   EL++LARYMQ+LS+ LC 
Sbjct: 121 NHREFYQLAASYNIPFHHIPVTAATKAQAEERQYEIIEEEGAELVVLARYMQVLSNDLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H ++RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSERRVILNGHKTVVF 281


>gi|302539696|ref|ZP_07292038.1| formyltetrahydrofolate deformylase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302457314|gb|EFL20407.1| formyltetrahydrofolate deformylase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 290

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 125/279 (44%), Positives = 191/279 (68%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKL--F 60
           ++LT++CP    +   +  YL +   NIL+  QF+D    + FMR+ F V +  + L   
Sbjct: 11  FVLTLSCPDRAGLVHAVATYLVSHSGNILESQQFDDRRQDRFFMRVHFDVLDPDVSLAEL 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ +   + + + +    T+TLI+VS+  HCLNDLL+R + G L ++I  +VSNH
Sbjct: 71  RTGFGPVAESHRITWQLHDASTPTRTLIMVSKFGHCLNDLLFRRSTGALKVDIPAIVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T + L  NY +PF+++P+T + K E+E +L+ ++++ +V+L++LARYMQILSD LC ++
Sbjct: 131 RTFEPLARNYGIPFHHIPVTPETKHEAEARLLRLVDELDVDLVVLARYMQILSDDLCKQL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDVVRV H++
Sbjct: 191 DGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTSDLDEGPIIEQDVVRVDHSR 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++ + +G+++EA+VL +AV  H + RV +N  +T+VF
Sbjct: 251 APDELVTMGRDVEAQVLARAVEWHSESRVLVNGNRTVVF 289


>gi|295691455|ref|YP_003595148.1| formyltetrahydrofolate deformylase [Caulobacter segnis ATCC 21756]
 gi|295433358|gb|ADG12530.1| formyltetrahydrofolate deformylase [Caulobacter segnis ATCC 21756]
          Length = 280

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 186/277 (67%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD- 63
           ILT++CP    I + +  +L  +GCNILD  QF+D +T + FMR+ F  +   +  + D 
Sbjct: 2   ILTLSCPDQRGIVAKVSAFLYERGCNILDAQQFDDQETGQFFMRVVFDADGADRAALRDA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F  +    ++++++R+  E  + L+L S+ DHCL DL+YRW IG L ++I GVVSNH   
Sbjct: 62  FGTLASTLAMKWTLRDRAERYRVLLLASKFDHCLADLVYRWRIGELPMDITGVVSNHPAE 121

Query: 124 K-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
               ++   LPF++LP+T++ K E E +L  +I++   E+++LARYMQ+LSD L  K+ G
Sbjct: 122 TYAHIDLSDLPFHHLPVTKETKFEQEAELWKLIQETQTEIVVLARYMQVLSDGLSAKLQG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGA+AHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGAKPYHQAHARGVKLIGASAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G++IE +VL +A+   ++ RV +N RKT+VF
Sbjct: 242 EDLVRKGRDIERRVLARALRYRLEDRVLLNGRKTVVF 278


>gi|298290475|ref|YP_003692414.1| formyltetrahydrofolate deformylase [Starkeya novella DSM 506]
 gi|296926986|gb|ADH87795.1| formyltetrahydrofolate deformylase [Starkeya novella DSM 506]
          Length = 289

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 190/281 (67%), Gaps = 6/281 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLF 60
           Y+LT++CP    I + +  +L  +G NIL+  QF+D ++ + FMR+ F     +  +   
Sbjct: 8   YVLTLSCPDRPGIVAAVASFLFERGGNILEAQQFDDTESGRFFMRVVFDRAADSGAIAEL 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A+F+ + ++F+L + +R   +  + ++LVS+ DHCL DLLYRW IG + + I G+++N+
Sbjct: 68  KAEFEAVAEKFALNWRLRGRNQKRRVMLLVSKFDHCLADLLYRWRIGEIPMEIAGIIANY 127

Query: 121 --TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
              T+  L +   +PF+YLP+T+Q K+E E +L  + +K+  E+ +LARYMQ+LSD L  
Sbjct: 128 PRETYAHL-DFADIPFHYLPVTKQTKMEQEAQLWELFQKSGAEVAVLARYMQVLSDGLSA 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R++H
Sbjct: 187 KLSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTSDLDEGPIIEQDVERISH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T +D +  G++IE +VL +A+  H+  RV +N  +T+VF
Sbjct: 247 QDTADDLVRKGRDIERRVLARALAWHLDDRVLLNGHRTVVF 287


>gi|229821474|ref|YP_002883000.1| formyltetrahydrofolate deformylase [Beutenbergia cavernae DSM
           12333]
 gi|229567387|gb|ACQ81238.1| formyltetrahydrofolate deformylase [Beutenbergia cavernae DSM
           12333]
          Length = 280

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 183/279 (65%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ ++LT++CP    I S +   L+  G NI +  QF D DT   FMR+    +   ++ 
Sbjct: 1   MTHWVLTLSCPDRPGIVSAVAGVLAGLGGNITESQQFGDADTGLYFMRVQVECDASREVL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                 + +QF + + +       +T+++VS   HCLNDLL+R     L + IV VVSNH
Sbjct: 61  DRAVGGVAEQFGMSWELDVVGRPVRTVVMVSTAAHCLNDLLFRQRSERLPIEIVAVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +L   Y + F+++P+T + ++++E +L+ ++   + EL++LARYMQILSD LC  +
Sbjct: 121 TMLAELAAFYGIDFHHVPVTRETRVDAEAQLLELVHALDAELVVLARYMQILSDDLCRDL 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAHYA  +LD GPIIEQDV RV H  
Sbjct: 181 EGRIINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYATADLDEGPIIEQDVERVRHDD 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T+ED +A+G+++E +VL +AV  H + RV +++ +T+VF
Sbjct: 241 TVEDLVAMGQDVERRVLARAVRWHAEHRVLLDRTRTVVF 279


>gi|312114038|ref|YP_004011634.1| formyltetrahydrofolate deformylase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219167|gb|ADP70535.1| formyltetrahydrofolate deformylase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 286

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +++LT++C     I + I   L+  GCNI D +QF D+ +++ FMR+SF     M    A
Sbjct: 7   AFVLTLSCADQSGIVASIAGILAEHGCNITDSAQFGDVKSNRFFMRVSFSAPDTMDEAGA 66

Query: 63  D--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +   +P+V +F +   +    E  + LILVS+  HCLNDLLYR  +G L + I  +VSNH
Sbjct: 67  ERMLKPVVDRFKMTTRLHPVAERMRVLILVSKFGHCLNDLLYRHRVGALPVEIPAIVSNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               +L  ++ +PF++LPM    K + E KL  IIE   ++L++LARYMQ+LS+ LC  +
Sbjct: 127 RDFYRLAASHDIPFHHLPMAADTKEKQEHKLAEIIEDEKIDLVVLARYMQVLSEDLCRTL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V RV H+ 
Sbjct: 187 EGRAINIHHSFLPSFKGAKPYHQAHMRGVKLIGATAHYVTPALDEGPIIEQEVARVDHSM 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +IED + +G+++E+ VL++AV  H++ R+ +N  +T+VF
Sbjct: 247 SIEDLVNMGRDVESLVLSRAVKWHVEHRILVNGNRTVVF 285


>gi|146308487|ref|YP_001188952.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576688|gb|ABP86220.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 288

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 189/280 (67%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +I+ I+CP+   I + +  YL+ +GC I ++SQF+D  + + FMR  F FN   +  I +
Sbjct: 8   FIIKISCPAASGIVAAVTTYLADRGCYISEMSQFDDETSGRFFMRAVFRFNDRYEGDIDE 67

Query: 64  ----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + Q+F +++++ +T +  + L++VS+ DHCL DLLYR + G L + I  +VSN
Sbjct: 68  VEQGFVAVAQRFEMEWALHSTAQPMRVLLMVSKYDHCLVDLLYRHHKGELDMQITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T+ +K + E  L+ I+++   EL++LARYMQILSD LC +
Sbjct: 128 HLELRPMAEREGIRFIYLPVTKDSKAQQEAALMKIVDETQTELVVLARYMQILSDDLCKQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV HA
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHA 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +AIG++ E   L+KAV  H++ RVF+N  +T++F
Sbjct: 248 YLPDDLVAIGRDTETVALSKAVKYHLEHRVFLNGERTVIF 287


>gi|86748270|ref|YP_484766.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
 gi|86571298|gb|ABD05855.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 287

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 187/283 (66%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           ++ +L+++C     I + +   L   GCN+++  QFND +T   FMR+ F     +  + 
Sbjct: 4   TNVVLSLSCRDQPGIVAAVSKLLFDAGCNVVEAHQFNDAETHLFFMRMRFAMLKPDASIA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F+P+  +F + +++R+  E  + +ILVS+ DHCL DLLYRW  G LA+++ G+++
Sbjct: 64  ALEAAFEPVANEFGITWTMRSLSEKQRVMILVSKFDHCLADLLYRWRTGELAMDVAGIIA 123

Query: 119 NH--TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           NH   T+  L +   +PF+YLP+T+  K+E E ++  +I   N +L++LARYMQ+LSD L
Sbjct: 124 NHPRETYAHL-DLDGIPFHYLPVTKPTKMEQEAQVWELIRAANTDLVVLARYMQVLSDGL 182

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C K+ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R+
Sbjct: 183 CAKLAGRCINIHHSFLPGFKGARPYHQAFERGVKLIGATAHYVTPDLDEGPIIEQDVERI 242

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +ED +  G+ IE +VL +A+  HI  RV +N  KT+VF
Sbjct: 243 SHHNCVEDLVRKGREIERRVLARAITWHIDGRVIVNGTKTVVF 285


>gi|16127860|ref|NP_422424.1| formyltetrahydrofolate deformylase [Caulobacter crescentus CB15]
 gi|221236681|ref|YP_002519118.1| formyltetrahydrofolate deformylase [Caulobacter crescentus NA1000]
 gi|13425382|gb|AAK25592.1| formyltetrahydrofolate deformylase [Caulobacter crescentus CB15]
 gi|220965854|gb|ACL97210.1| formyltetrahydrofolate deformylase [Caulobacter crescentus NA1000]
          Length = 280

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 185/277 (66%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI-AD 63
           ILT++CP    I + +  +L  +GCNILD  QF+D +T + FMR+ F  +   +  +  D
Sbjct: 2   ILTLSCPDQRGIVAKVSAFLFERGCNILDAQQFDDQETGQFFMRVVFDADGADREALRGD 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F  +   F +++++RN  +  + L+L S+ DHCL DL+YRW IG L ++I GVVSNH   
Sbjct: 62  FGALADGFKMKWTLRNRADRYRVLLLASKFDHCLADLVYRWRIGELPMDITGVVSNHPAQ 121

Query: 124 K-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
               V+   L F++LP+T++ K E E +L  +I++   ++++LARYMQ+LSD L  K+ G
Sbjct: 122 TYAHVDLSGLDFHHLPVTKETKFEQEAELWKLIQETKTDIVVLARYMQVLSDGLSAKLQG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGA+AHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGAKPYHQAHARGVKLIGASAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G++IE +VL +A+   ++ RV +N RKT+VF
Sbjct: 242 EDLVRKGRDIERRVLARALRYRLEDRVLLNGRKTVVF 278


>gi|332531082|ref|ZP_08406999.1| formyltetrahydrofolate deformylase [Hylemonella gracilis ATCC
           19624]
 gi|332039467|gb|EGI75876.1| formyltetrahydrofolate deformylase [Hylemonella gracilis ATCC
           19624]
          Length = 282

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 132/282 (46%), Positives = 190/282 (67%), Gaps = 7/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           ++YILT +CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F   +C ++  
Sbjct: 3   AAYILTFSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDPDTGLFFMRVRF---SCGQVSY 59

Query: 62  ADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            D Q       + F +Q+ +   +   +TLI VS+  HCLNDLL+RW IG L ++I  +V
Sbjct: 60  PDLQAQLKAFAEPFQMQWRLNPAETKVRTLIFVSKEGHCLNDLLFRWKIGLLPIDIRAIV 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    +L  +Y +PF+++P+T   K E+E K   I++  N EL++LARYMQ+LSD LC
Sbjct: 120 SNHRDFYQLAASYNIPFHHIPVTAATKAEAEAKQFEIVQAENAELVVLARYMQVLSDDLC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++G+ INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV 
Sbjct: 180 RKLSGKAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARVD 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H++T+ED+ AIG++ E++VL +AV  H + RV +N  KT++F
Sbjct: 240 HSKTVEDFTAIGRDTESQVLARAVKWHSEHRVILNGHKTVIF 281


>gi|121607699|ref|YP_995506.1| formyltetrahydrofolate deformylase [Verminephrobacter eiseniae
           EF01-2]
 gi|121552339|gb|ABM56488.1| formyltetrahydrofolate deformylase [Verminephrobacter eiseniae
           EF01-2]
          Length = 282

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 184/281 (65%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +Y+LT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F    C     A
Sbjct: 4   AYVLTLSCPDRLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRF---ACALHDQA 60

Query: 63  DFQPIVQQFS----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+  + +F+    +++S+    E  KT++LVS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  GFKDRLGRFAALHQMRWSLHLAAEPVKTVLLVSKEGHCLNDLLFRWQSGLLPVDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L  +Y +PF++LP++   K ++E +L+ IIE    EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFCPLAASYAVPFHHLPVSAATKAQAEARLLEIIEAEGAELVVLARYMQVLSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 QLAGRVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQDVARAEH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+E  IA G++ E++VL +AV  H + RV ++  KT+VF
Sbjct: 241 TDTVETLIARGRDTESQVLARAVKWHSEHRVLLDGHKTVVF 281


>gi|326315436|ref|YP_004233108.1| formyltetrahydrofolate deformylase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372272|gb|ADX44541.1| formyltetrahydrofolate deformylase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 282

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 184/281 (65%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMK 58
           +YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +T     ++
Sbjct: 4   AYILTLSCPDKLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRFACDTHDQAALR 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A+F    +   + +S+    E  KT I+VS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 64  ARLAEF---AEPHRMHWSLHAASEPMKTAIMVSREGHCLNDLLFRWKSGLLPVHICAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T+ NK ++E +   II++   EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFYQLAASYNVPFHHIPVTKDNKPQAEARQYEIIQQEGAELVVLARYMQVLSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLEGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHTEHRVVLNGHKTVIF 281


>gi|239817750|ref|YP_002946660.1| formyltetrahydrofolate deformylase [Variovorax paradoxus S110]
 gi|239804327|gb|ACS21394.1| formyltetrahydrofolate deformylase [Variovorax paradoxus S110]
          Length = 285

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 129/281 (45%), Positives = 180/281 (64%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           +YILT++CP    I   +  +L  +G NI + +Q+ND DT   FMR+ F  +      ++
Sbjct: 7   AYILTLSCPDRTGIVHAVSGFLLERGGNIEEAAQYNDHDTGLFFMRVRFACSDHPEAALR 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A F      F +   +    E  KT+ILVS+  HCLNDLL+RW  G LA+++  ++S
Sbjct: 67  EQLATFGA---GFGMSLQLHAAAEPMKTVILVSKEGHCLNDLLFRWKSGLLAIDVRAIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K + E K + IIE    EL++LARYMQILS+ LC 
Sbjct: 124 NHRDFYQLAASYNVPFHHIPVTAATKAQGEAKQLEIIESEGAELVVLARYMQILSNGLCK 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 184 SLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 243

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  +T+VF
Sbjct: 244 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHRTVVF 284


>gi|300691173|ref|YP_003752168.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum PSI07]
 gi|299078233|emb|CBJ50880.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum PSI07]
          Length = 288

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 183/284 (64%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  TLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K++ E ++ +I+E+  ++L++LARYMQILSD 
Sbjct: 124 NHRDFYQLAASYDVPFLHLPLLKGTDAQKVQQEARIWDIVEEQRIDLVVLARYMQILSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 184 LCRRLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|158423116|ref|YP_001524408.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
 gi|158330005|dbj|BAF87490.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
          Length = 289

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 187/286 (65%), Gaps = 14/286 (4%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKL-- 59
           +++L  +CP    I + +  +L  QGCNIL+  QF+D ++++ FMR++F V      L  
Sbjct: 7   TFVLKFSCPDRAGIVAAVSTFLYEQGCNILEAQQFDDTESNRFFMRVAFNVIEGTADLPR 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+   F L +S+R+  E  + L+LVS+ DHCL DLLYRW IG + + I G++SN
Sbjct: 67  IRTAFGPVADGFKLDWSMRDPAEKRRVLLLVSKFDHCLADLLYRWRIGEIPMEITGIISN 126

Query: 120 HTTHKKLVENYQ------LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           H      +E Y       +PF++LP+++  K+E E ++  I +++  E+ +LARYMQ+LS
Sbjct: 127 HP-----IETYAHLDFDGIPFHHLPVSKATKMEQEAQVWRIFQESGSEMAVLARYMQVLS 181

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D L  K++GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV
Sbjct: 182 DGLSAKLSGRCINIHHSFLPGFKGAKPYHQAHQRGVKLIGATAHYVTSDLDEGPIIEQDV 241

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R+TH  + +D +  G++IE +VL +A+  H+Q RV  N  KTIVF
Sbjct: 242 ERITHQDSPDDLVRKGRDIERRVLARALAWHLQDRVIPNGHKTIVF 287


>gi|160896529|ref|YP_001562111.1| formyltetrahydrofolate deformylase [Delftia acidovorans SPH-1]
 gi|160362113|gb|ABX33726.1| formyltetrahydrofolate deformylase [Delftia acidovorans SPH-1]
          Length = 307

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 181/278 (65%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  N C    + 
Sbjct: 29  AYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPATGLFFMRVQFACNGCDPAALR 88

Query: 63  DFQPIVQ-QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                +  Q+ +++ +    EA KT+++VS+  HCLNDLL+RW  G L ++I  ++SNH 
Sbjct: 89  AALADLGGQYQMKWRLHTKAEAMKTVLMVSKEGHCLNDLLFRWKSGLLPVDIRAIISNHR 148

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF+++P+T   K ++E K   IIE    EL++LARYMQ+LS+ LC K+ 
Sbjct: 149 EFYQLAASYNIPFHHIPVTAATKAQAEAKQFEIIEAEGAELVVLARYMQVLSNDLCTKLA 208

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T
Sbjct: 209 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHTDT 268

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 269 VEDLTARGRDTESQVLARAVKWHSEHRVILNGHKTVVF 306


>gi|329896277|ref|ZP_08271433.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC3088]
 gi|328921882|gb|EGG29250.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC3088]
          Length = 286

 Score =  278 bits (710), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 132/281 (46%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI--SFVFNT-CMK 58
           +S+ LT TCP++  I + +  YLS QGC + ++ QF+D DT + F+R    F  NT  + 
Sbjct: 5   TSFTLTATCPASSGIVAAVTSYLSDQGCYLSELHQFDDEDTGRFFLRTVGRFEVNTISLD 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ +  S++++  +T    KTLI+VS+ DHCL DLLYR     L ++I  VVS
Sbjct: 65  TLRTGFAPVAKTLSMEWAFHDTLAPMKTLIMVSKFDHCLEDLLYRVRKKELTIDITAVVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L E   + F +LP+T  NK + EQ L++I+ +   EL++LARYMQILSD LC 
Sbjct: 125 NHKDCRALAEREGIRFVHLPVTPDNKAQQEQALLDIVSETQTELVVLARYMQILSDDLCQ 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ V  V H
Sbjct: 185 SLKGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTADLDEGPIIEQSVQPVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T E  +A+G++ E   L +AV  H + RVF++  KT++F
Sbjct: 245 TYTPEQLVAVGRDTETMALARAVKLHSEHRVFLDGNKTVIF 285


>gi|103487321|ref|YP_616882.1| formyltetrahydrofolate deformylase [Sphingopyxis alaskensis RB2256]
 gi|98977398|gb|ABF53549.1| formyltetrahydrofolate deformylase [Sphingopyxis alaskensis RB2256]
          Length = 290

 Score =  278 bits (710), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 126/282 (44%), Positives = 184/282 (65%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-----FNTCM 57
           +Y+LT +C     I + +   L+ +   ILD  Q+ DLD+ + FMR+ F      F   +
Sbjct: 8   AYVLTFSCADAVGIVAAVTGLLADRDGFILDSQQYADLDSGRFFMRVEFRGEGSRFPGNL 67

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F PI ++F +   I +     + +I VSQ  HCLNDLL+RW+ G LA++IVGVV
Sbjct: 68  AGVQDAFAPIARRFQMDARISDRAAKPRFVIAVSQGSHCLNDLLHRWSTGNLAIDIVGVV 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++L E + +PF+YLP+++ N+ E E  +++++ +   E ++LARYMQ+LS+ L 
Sbjct: 128 SNHEHLRRLTEWHGVPFHYLPVSDANRAEQESAILDVMARGGAEYLVLARYMQVLSEDLS 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV 
Sbjct: 188 ARLAGRCINIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTSDLDEGPIIEQAVERVD 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   ++D I IG+++EA+VL +AV    +QRV I+ RKT+VF
Sbjct: 248 HRDGVDDLIRIGRDVEAQVLARAVRWVAEQRVLIDGRKTVVF 289


>gi|120609348|ref|YP_969026.1| formyltetrahydrofolate deformylase [Acidovorax citrulli AAC00-1]
 gi|120587812|gb|ABM31252.1| formyltetrahydrofolate deformylase [Acidovorax citrulli AAC00-1]
          Length = 282

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 181/278 (65%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           +YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +T  +  + 
Sbjct: 4   AYILTLSCPDKLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRFACDTHDQAALR 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A      +   + +S+    E  KT I+VS+  HCLNDLL+RW  G L ++I  ++SNH 
Sbjct: 64  ARLTEFAEPHRMHWSLHAASEPMKTAIMVSREGHCLNDLLFRWKSGLLPVHICAIISNHR 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF+++P+T+ NK ++E +   II++   EL++LARYMQ+LSD LC K+ 
Sbjct: 124 DFYQLAASYNVPFHHIPVTKDNKPQAEARQYEIIQQEGAELVVLARYMQVLSDDLCRKLE 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T
Sbjct: 184 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHTDT 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 244 VEDLTARGRDTESQVLARAVKWHTEHRVLLNGHKTVIF 281


>gi|222109639|ref|YP_002551903.1| formyltetrahydrofolate deformylase [Acidovorax ebreus TPSY]
 gi|221729083|gb|ACM31903.1| formyltetrahydrofolate deformylase [Acidovorax ebreus TPSY]
          Length = 282

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 184/278 (66%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           SYILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F   +  +  + 
Sbjct: 4   SYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGLFFMRVQFACESTDEATLK 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A+     ++ S+++S+  T  A KT+++VS+  HCLNDLL+R+  G L ++I  ++SNH 
Sbjct: 64  AELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLFRYKSGLLPIDIRAIISNHR 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF+++P+T   K ++E K   II+    EL++LARYMQ+LS+ LC K++
Sbjct: 124 DFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAELVVLARYMQVLSNDLCAKLS 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T
Sbjct: 184 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADHTDT 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 244 VEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|89899420|ref|YP_521891.1| formyltetrahydrofolate deformylase [Rhodoferax ferrireducens T118]
 gi|89344157|gb|ABD68360.1| formyltetrahydrofolate deformylase [Rhodoferax ferrireducens T118]
          Length = 282

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 182/280 (65%), Gaps = 7/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT++CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F    C +L   D
Sbjct: 5   YILTLSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDQDTGLFFMRVQF---ACAQLTHED 61

Query: 64  F----QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                +   Q F +Q+ +    +  +T+I+VS+  HCLNDLL+RW  G L ++I  ++SN
Sbjct: 62  LTLQLKAFAQPFEMQWRLHARAQPIRTVIMVSKEGHCLNDLLFRWKSGLLPIDIRAIISN 121

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H    +L  +Y +PF++LP+T   K + E +   II+    EL++LARYMQ+LSD LC K
Sbjct: 122 HREFYQLAASYNVPFHHLPITAATKPQVEARQYEIIQTEAAELVVLARYMQVLSDDLCRK 181

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++G  INIHHSFLPSFKGA PY QA++ GVK+IGATAHY    LD GPIIEQDV RV H+
Sbjct: 182 LSGSAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTANLDEGPIIEQDVARVDHS 241

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +T+ED   +G++ E++VL +AV  H + RV IN  KT++F
Sbjct: 242 KTVEDLTTLGRDTESQVLARAVKWHSEHRVLINGHKTVIF 281


>gi|121592860|ref|YP_984756.1| formyltetrahydrofolate deformylase [Acidovorax sp. JS42]
 gi|120604940|gb|ABM40680.1| formyltetrahydrofolate deformylase [Acidovorax sp. JS42]
          Length = 282

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 184/278 (66%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           SYILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F   +  +  + 
Sbjct: 4   SYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGLFFMRVQFACESTDEATLK 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A+     ++ S+++S+  T  A KT+++VS+  HCLNDLL+R+  G L ++I  ++SNH 
Sbjct: 64  AELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLFRYKSGLLPIDIRAIISNHR 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF+++P+T   K ++E K   II+    EL++LARYMQ+LS+ LC K++
Sbjct: 124 DFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAELVVLARYMQVLSNDLCTKLS 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T
Sbjct: 184 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADHTDT 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 244 VEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|91786348|ref|YP_547300.1| formyltetrahydrofolate deformylase [Polaromonas sp. JS666]
 gi|91695573|gb|ABE42402.1| formyltetrahydrofolate deformylase [Polaromonas sp. JS666]
          Length = 282

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 127/278 (45%), Positives = 183/278 (65%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +YILT++CP    I   +  +L   G NI + +Q+ND DT   FMR+ F  +      ++
Sbjct: 4   AYILTLSCPDRRGIVHAVSGFLLQNGGNIEEAAQYNDHDTGLFFMRVQFACDQLTHEELS 63

Query: 63  D-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +   + F + + +  T +  +T+I+VS+  HCLNDLL+R   G L L++  +VSNH 
Sbjct: 64  QQLKGFAEPFQMNWKLHATTQPMRTVIMVSKEGHCLNDLLFRCKSGLLPLDVRAIVSNHR 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF++ P+T  +K + E K + IIE    EL++LARYMQILS+ LC K+ 
Sbjct: 124 EFYQLAASYNIPFHHFPVTAASKAQVEDKQLEIIESEGAELVVLARYMQILSNDLCRKLA 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H++T
Sbjct: 184 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVARVDHSKT 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A+G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 244 VEDLTAMGRDTESQVLARAVKWHSEHRVLLNGHKTVIF 281


>gi|300703773|ref|YP_003745375.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum
           CFBP2957]
 gi|299071436|emb|CBJ42755.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum
           CFBP2957]
          Length = 288

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 181/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  TLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQILSD 
Sbjct: 124 NHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQEARIGEIIEEQQIDLVVLARYMQILSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 184 LCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|326388304|ref|ZP_08209907.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207470|gb|EGD58284.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 186/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLFI 61
           ++L ++C   + I + I   ++ Q CNI+  +QF D+ T + FMR+SF     +  + F 
Sbjct: 6   FVLLVSCQDRKGIVAAIAGSIAAQDCNIIHNAQFGDVYTGRFFMRVSFAGPEGLTTEKFS 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+   ++L + + + +   + L++VS+  HCLNDLLYR     L + +  VVSNH 
Sbjct: 66  EAFLPVGAAYNLDWKVHDLRVKQRALVMVSKGGHCLNDLLYRTATRYLPMEVTSVVSNHK 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T ++ VE+  +PF+Y+P+T +NK E E +L+ +I++  V+L+ILARYMQ+LSD  C K+ 
Sbjct: 126 TWQRRVEHEGIPFHYMPITPENKEEQEARLLEMIDEQQVDLIILARYMQVLSDATCRKLE 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHS LP+FKGA PY +A+E GVK++GAT HY   +LD GPII QDV  V HA T
Sbjct: 186 GRVINIHHSSLPAFKGAKPYHRAWERGVKMVGATGHYVTADLDEGPIIAQDVSMVDHADT 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IED IA G+  E++VLT+AV AH + RV +N  +T+VF
Sbjct: 246 IEDLIAQGQETESRVLTRAVKAHCEHRVMLNGARTVVF 283


>gi|207742872|ref|YP_002259264.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           IPO1609]
 gi|206594266|emb|CAQ61193.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           IPO1609]
          Length = 288

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 181/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  TLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQILSD 
Sbjct: 124 NHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQILSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 184 LCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|119714394|ref|YP_921359.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
 gi|119535055|gb|ABL79672.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
          Length = 282

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 188/281 (66%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           MS  +L ++CP    I   +  +L  +G NI +  QF D  + + FMRI+      +   
Sbjct: 1   MSELVLILSCPDRPGIVHAVTGFLVERGANITESQQFGDPLSGRFFMRIAVDVPGAVDAA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F P+ ++F +++ + +     +TLILVS+  HCLNDLL+R + G+L + +  +VS
Sbjct: 61  ALRAEFAPVAEEFEMRFDVHDAAAPYRTLILVSKDLHCLNDLLFRTSTGSLGIEVPAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     +  +Y +PF+++P+T   K ++E++L+ ++ + +++L++LARYMQILSD LC 
Sbjct: 121 NHPDAAAMAASYGVPFHHVPVTPDTKAQAEERLLELVRELDIDLVVLARYMQILSDGLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++G+ INIHHSFLPSFKGA PY QA++ GVK++GATAHY   +LD GPIIEQDV+RV H
Sbjct: 181 ELSGKAINIHHSFLPSFKGARPYHQAFDRGVKLVGATAHYVTSDLDEGPIIEQDVMRVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E  ++ G+++EA+VL++AV  H Q RV +N  +T+VF
Sbjct: 241 THHQEQLVSAGRDVEAQVLSRAVRWHAQSRVLLNGHRTVVF 281


>gi|229589807|ref|YP_002871926.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229361673|emb|CAY48554.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 288

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 186/280 (66%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +I+ +TCP+   I + +  YL+ + C I +++QF+D  + + FMR  F FN      ++ 
Sbjct: 8   FIIKVTCPAVSGIVAAVTTYLADKACYIGEMAQFDDDFSGRFFMRAVFRFNDGHAGNLQE 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + Q F +Q+ + +T+E  + +++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  IRDGFADVAQAFDMQWELHDTREPMRVMLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+++ NK   E +L+ I++    EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKDNKAAQEAELMKIVDDTRTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +AIG++ E   L+KAV  H++ RVF+N+ +T+VF
Sbjct: 248 YKPDDLVAIGRDTETVALSKAVKYHLEHRVFLNQDRTVVF 287


>gi|83749369|ref|ZP_00946364.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum UW551]
 gi|83723946|gb|EAP71129.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum UW551]
          Length = 315

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/284 (46%), Positives = 181/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 31  SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 90

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 91  TLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 150

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQILSD 
Sbjct: 151 NHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQILSDD 210

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 211 LCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 270

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 271 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 314


>gi|197104547|ref|YP_002129924.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
 gi|196477967|gb|ACG77495.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
          Length = 280

 Score =  276 bits (706), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 183/277 (66%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIAD 63
           ILT++CP    I + +   L  +G NILD  QF+D +T + FMR+ F   +   + + A 
Sbjct: 2   ILTLSCPDQPGIVARVSALLFERGANILDAQQFDDEETGRFFMRVVFDPGDAGAEAWRAA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P+ +Q+++ +++R  KE  + +IL SQ DHCL+DL++RW  G L +++  VVSNH   
Sbjct: 62  FAPLAEQYAMTWTLRGRKERRRVMILASQQDHCLSDLIWRWRQGELQMDLTAVVSNHPAS 121

Query: 124 KKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
                + Q + F++LP+T + K + E +L ++IE+   EL++LARYMQ+LSD L  K+ G
Sbjct: 122 TFPHTDLQGIAFHHLPITPETKPQQEARLWSLIEETRTELVVLARYMQVLSDDLAGKLEG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGARPYHQAHARGVKVIGATAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              I  G++IE +VL +AV   ++ RV +N RKT+VF
Sbjct: 242 AALIRKGRDIERRVLARAVRWRLEDRVLLNGRKTVVF 278


>gi|84514727|ref|ZP_01002091.1| probable formyltetrahydrofolate deformylase [Loktanella
           vestfoldensis SKA53]
 gi|84511778|gb|EAQ08231.1| probable formyltetrahydrofolate deformylase [Loktanella
           vestfoldensis SKA53]
          Length = 286

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 191/277 (68%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +IL ++C +   I + +   L++QG N+++ +QF D  + + F+R++F+     +  I D
Sbjct: 9   FILKLSCDAAPGIVAAVTSALASQGANLVETAQFWDRQSDRFFLRVAFLAEDGDETRILD 68

Query: 64  -FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
              PI  QF +  ++R+T    + LI+VS+ DH +  LLY+  +G L   +V +VSNH  
Sbjct: 69  ALAPIKVQFDMDLNLRHTARKPRLLIMVSRFDHAMLHLLYQVRVGWLDAEVVAIVSNHPD 128

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            +++ E+  LPFY+LP+T + K E+E +L+ ++E+ + +L++LARYMQ+LSD     ++G
Sbjct: 129 ARRIAEHEGLPFYHLPVTRETKAEAEAELLTLVEETDADLVVLARYMQVLSDEFSRALSG 188

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RV H+ T 
Sbjct: 189 RVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQEAERVAHSMTP 248

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +D +A+G++IEA+VL +AV  H++ RV ++ ++T+VF
Sbjct: 249 DDLVAVGRDIEARVLARAVKMHLEGRVMLSGQRTLVF 285


>gi|296270507|ref|YP_003653139.1| formyltetrahydrofolate deformylase [Thermobispora bispora DSM
           43833]
 gi|296093294|gb|ADG89246.1| formyltetrahydrofolate deformylase [Thermobispora bispora DSM
           43833]
          Length = 282

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 183/278 (65%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + Y+LT++CP    + + +   L+ + CNI +  QF D D  + FMR+ F  +  +    
Sbjct: 3   AEYVLTLSCPDRPGVVAAVSGLLAERDCNITESQQFGDPDAQRFFMRVQFATDLGIDELR 62

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           + F  +  +F +++ + +    T+ L+LVS+  HCLNDLLYR   G L + IV VVSNH 
Sbjct: 63  SAFAALAPEFGMEFELFDRSVKTRVLVLVSKLGHCLNDLLYRVRSGLLPIEIVAVVSNHP 122

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L ++Y + +++LP+T + K + E +++ ++E    +L++LARYMQILS+ +C+K+ 
Sbjct: 123 DLRPLTQSYGIDYHHLPVTPETKPKQEAEILALVEHYRADLVVLARYMQILSEDMCNKLA 182

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 183 GRMINIHHSFLPSFKGARPYHQAYARGVKLIGATAHYVTADLDEGPIIEQEVARVNHTHT 242

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED  AIG+++E + L +AV  H + RV ++  KTI+F
Sbjct: 243 PEDLAAIGRDLECQALARAVRWHAEHRVLLDGNKTIIF 280


>gi|17546592|ref|NP_519994.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum GMI1000]
 gi|17428891|emb|CAD15575.1| probable formyltetrahydrofolate deformylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 288

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 181/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  ALRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQILSD 
Sbjct: 124 NHRDFYQLAASYDVPFLHLPLLKGTDAQKAQQEARIREIIEEQRIDLVVLARYMQILSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 184 LCRQLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|325962558|ref|YP_004240464.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468645|gb|ADX72330.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 330

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 121/277 (43%), Positives = 178/277 (64%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +Y++T++CP    I   +   L   GCNI D  Q+    T   FMR+            A
Sbjct: 53  AYVVTLSCPDRPGIVHAVAGALLVAGCNITDSQQYGSPVTGNFFMRVEVTTAAPASELRA 112

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
             +P+   F +Q+S+    +  +TL++ S   HCLNDLL++   GTL + I  +VSNH  
Sbjct: 113 ALEPVAGAFGMQWSLNAVGQKVRTLVMASTSAHCLNDLLFQQRSGTLPIEIPAIVSNHQD 172

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L E Y +PF+Y+P+T++ K ++E KL  ++ ++++EL +LARYMQILSD LC ++TG
Sbjct: 173 LAGLAEFYGIPFHYIPVTKETKAQAEDKLRALMAEHDIELTVLARYMQILSDELCSELTG 232

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           + INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V+RV HA+T 
Sbjct: 233 KAINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTAALDEGPIIEQEVIRVDHARTP 292

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           E ++ +G+++E + L +AV  H + RV ++  +T+VF
Sbjct: 293 EQFVQMGRDVEGRTLVQAVQWHAEHRVLLDGNRTVVF 329


>gi|241767211|ref|ZP_04764959.1| formyltetrahydrofolate deformylase [Acidovorax delafieldii 2AN]
 gi|241362149|gb|EER58237.1| formyltetrahydrofolate deformylase [Acidovorax delafieldii 2AN]
          Length = 282

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 185/281 (65%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +YILT++CP    +   +  +L  +G NI + +Q+ND  T   FMR+ F    C +   A
Sbjct: 4   AYILTLSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDPATGLFFMRVQFA---CSQHDQA 60

Query: 63  DFQPIVQQFS----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             Q  + QF+    +++S+  T +  +T++LVS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  TLQTHLAQFAEPHQMRWSLHATAQPVRTVLLVSKEGHCLNDLLFRWKSGLLPVDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E +   II+  + EL+ILARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNVPFHHIPVTAATKAQAEARQYEIIQAEDAELVILARYMQVLSNDLCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLVNGHKTVVF 281


>gi|288960097|ref|YP_003450437.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
 gi|288912405|dbj|BAI73893.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
          Length = 288

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 129/282 (45%), Positives = 183/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           S YILT++CP    I   +  +L+ + CNI+D +QF D  +   FMR+SF         +
Sbjct: 6   SDYILTVSCPDTVGIVFAVSGFLAERSCNIIDSAQFGDRISGLFFMRVSFNGDPGGATRQ 65

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              A+F   + ++F++ + I + +   + LI+VS+  HCLNDLLYR+  G L + I  +V
Sbjct: 66  QLEAEFAAQVAERFAMTWKIHDARRRPRVLIMVSKFGHCLNDLLYRYRTGYLPIEIPAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    +L   + +PF++LP+   NK   E +L+ I+E+  V+L++LARYMQ+LS  LC
Sbjct: 126 SNHRDFYQLAAWHNIPFHHLPVGSDNKAHQEARLLEIVEEEKVDLVVLARYMQVLSGALC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +M GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+  RV 
Sbjct: 186 ERMAGRVINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTSNLDEGPIIEQEAERVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T +D +AIG++IE  VL +AV  H++ RV +N  KT+VF
Sbjct: 246 HTMTPDDLVAIGRDIENIVLARAVRYHVEHRVLLNGNKTVVF 287


>gi|27381066|ref|NP_772595.1| formyltetrahydrofolate deformylase [Bradyrhizobium japonicum USDA
           110]
 gi|27354232|dbj|BAC51220.1| formyltetrahydrofolate deformylase [Bradyrhizobium japonicum USDA
           110]
          Length = 287

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 184/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA- 62
           Y+LT++CP    I S +  +L+  G NILD  QF+D++T K FMR+ F          A 
Sbjct: 6   YVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFDDVETKKFFMRVVFTAADLAVELTAL 65

Query: 63  --DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I ++F +++ +R+     K ++LVS+ DHCL D+LYRW  G L +    +VSNH
Sbjct: 66  QTGFAAIAERFGMEWQMRDRAAHRKVMLLVSKSDHCLVDILYRWRTGELPMVPTAIVSNH 125

Query: 121 TTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                   ++  +PF++LP+T+++K E E ++++++ K   +L++LARYMQILSD L  K
Sbjct: 126 PREVYAGLDFGGIPFHHLPVTKESKREQEAQILDLVAKTGTDLVVLARYMQILSDDLSAK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPII+QDV R++H 
Sbjct: 186 LSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTRDLDEGPIIDQDVERISHR 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED +  G++IE +VL +A+  H+  RV  N RKT+VF
Sbjct: 246 DTPEDLVRKGRDIERRVLARAIRYHLDDRVIPNGRKTVVF 285


>gi|330992207|ref|ZP_08316155.1| Formyltetrahydrofolate deformylase [Gluconacetobacter sp. SXCC-1]
 gi|329760406|gb|EGG76902.1| Formyltetrahydrofolate deformylase [Gluconacetobacter sp. SXCC-1]
          Length = 292

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 186/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           +++ILT++CP+   I + I  +L  +G NI +  QF+D  + + FMRI F        + 
Sbjct: 9   ATFILTLSCPNRPGIVAAISQHLYERGANITEAQQFDDTGSRQFFMRIVFELARKEGLLH 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   FS+ +++ +T+   + L+LVS+ DHCL DLLYRW IG L +  VG+VS
Sbjct: 69  TLRTQFTDIASSFSMSWTLTDTRHRPRVLLLVSRFDHCLVDLLYRWRIGELRIEPVGIVS 128

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       V+ Y +PF+YLP+T+  K E E+++ ++   ++ EL +LARYMQ+LS+ + 
Sbjct: 129 NHPREIFADVDFYGIPFHYLPVTKDTKAEQEERIWSLFTHSDAELAVLARYMQVLSNAMA 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 189 ARLSGRCINIHHSFLPGFKGARPYHQAFSRGVKLIGATAHYVTSDLDEGPIIEQDVERIS 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + +D I  G++IE +VL +AV  HI++R  +N  KTIVF
Sbjct: 249 HADSPDDLIRKGRDIERRVLARAVRFHIERRAIMNANKTIVF 290


>gi|207723967|ref|YP_002254365.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           MolK2]
 gi|206589174|emb|CAQ36136.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           MolK2]
          Length = 288

 Score =  274 bits (701), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 180/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV       ++
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  TLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQILSD 
Sbjct: 124 NHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQILSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ++ R
Sbjct: 184 LCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  K +VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKNVVF 287


>gi|312960307|ref|ZP_07774818.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
 gi|311285529|gb|EFQ64099.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
          Length = 288

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 183/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +I+ +TCP+   I + +  YL+   C I +++QF+D  + + FMR  F FN      ++ 
Sbjct: 8   FIIKVTCPAVSGIVAAVTTYLADNACYIGEMAQFDDDFSGRFFMRAVFRFNDGHEGDLQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + Q F +Q+ + +T+E  + +++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  IKDGFAEVAQAFDMQWELHDTREPMRVMLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP++  NK   E +L+ I++    EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSRDNKAAQEAELMKIVDDTRTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ V RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTRDLDEGPIIEQQVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +AIG++ E   L+KAV  H++ RVF+N+ +T+VF
Sbjct: 248 YKPDDLVAIGRDTETVALSKAVKYHLEHRVFLNQDRTVVF 287


>gi|241663346|ref|YP_002981706.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12D]
 gi|240865373|gb|ACS63034.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12D]
          Length = 288

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/285 (45%), Positives = 182/285 (63%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV    + L +
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFV-PQGLPLDL 62

Query: 62  A----DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +V
Sbjct: 63  ATLRDRFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           SNH    +L  +Y +PF +LP+   T+  K + E ++  I ++  ++L++LARYMQILSD
Sbjct: 123 SNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQILSD 182

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ++ 
Sbjct: 183 DLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQEIE 242

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 243 RVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|290955281|ref|YP_003486463.1| formyltetrahydrofolate deformylase [Streptomyces scabiei 87.22]
 gi|260644807|emb|CBG67892.1| putative formyltetrahydrofolate deformylase [Streptomyces scabiei
           87.22]
          Length = 293

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 183/279 (65%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKLF 60
           Y+LT++CP +  +   +  YL     NIL+  QF+D    + FMR+ F     N  ++  
Sbjct: 14  YVLTLSCPDSAGLVHAVSGYLVRNSGNILESQQFDDRLQGRFFMRVHFDVSDPNVDLEGL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ Q + + +S+ +    T+TLI+VS+  HCLNDLL+R   G L + I  +VSNH
Sbjct: 74  RYRFGPVAQAYGISWSLSDASTPTRTLIMVSKFGHCLNDLLFRQRAGALNIEIPAIVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +KL E Y +PF+++P+T + K E+E +L+ ++   +++L++LARYMQILSD LC ++
Sbjct: 134 RDFEKLAETYDVPFHHVPVTRETKPEAEARLLELVRDLDIDLVVLARYMQILSDDLCKEL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QAY+ GVK++GATAHY   +LD G IIEQDVVRV H+ 
Sbjct: 194 DGRAINIHHSFLPSFKGARPYDQAYDRGVKLVGATAHYVTSDLDEGQIIEQDVVRVDHSL 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              + + +G+++EA+VL  AV  H + RV +   +T+VF
Sbjct: 254 DPGELVTVGRDVEAQVLAHAVKWHSENRVMVEGNRTVVF 292


>gi|116669675|ref|YP_830608.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116609784|gb|ABK02508.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 286

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 175/278 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S+Y+LT++CP    I   +   L   GCNI D  Q+    T   FMR+            
Sbjct: 8   SAYVLTLSCPDRPGIVHAVAGALLVAGCNITDSQQYGSQTTGTFFMRVEVTTAASQSDVH 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A  +P+   F +Q+S+       +TL++ S+  HCLNDLL+    GTL + I  +VSNH 
Sbjct: 68  AALEPVAVAFGMQWSLNPAGRKVRTLLMASKSAHCLNDLLFLQRSGTLPIEIPAIVSNHE 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               L E Y +PF+Y+P+T   K+++E +L  II + +VEL +LARYMQILS+ LC ++T
Sbjct: 128 DLAGLAEFYGIPFHYIPVTADTKVQAEDQLRKIIAEEDVELTVLARYMQILSNELCTELT 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+ INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V+RV H +T
Sbjct: 188 GKAINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTAALDEGPIIEQEVIRVDHRRT 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E ++ +G+++E + L +AV  H + RV ++  +T+VF
Sbjct: 248 AEQFVQMGRDVEGRTLAQAVQWHAEHRVLLDGNRTVVF 285


>gi|154248622|ref|YP_001419580.1| formyltetrahydrofolate deformylase [Xanthobacter autotrophicus Py2]
 gi|154162707|gb|ABS69923.1| formyltetrahydrofolate deformylase [Xanthobacter autotrophicus Py2]
          Length = 289

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 185/280 (66%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLF 60
           +ILT +CP+   I + +  +L  +GCNIL+  QF+D +T++ FMR+ F        +   
Sbjct: 8   FILTFSCPNKPGIVAGVSTFLFEKGCNILEAQQFDDTETNRFFMRVVFNVVASEASLSEI 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  + + F+L +++R   E  + L+L S+ DHCL DLLYRW IG + ++I G++SNH
Sbjct: 68  REGFTAVAEGFALNWTLRPKAEKRRVLLLASKFDHCLADLLYRWRIGEIPMDITGIISNH 127

Query: 121 TTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                   ++  +PF++LP+T+  K+E E K+  I + +  EL +LARYMQ+LSD L  K
Sbjct: 128 PRETYAHLDFDGIPFHHLPVTKATKLEQETKIWEIFQSSGSELAVLARYMQVLSDGLTAK 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++G+ INIHHSFLP FKGA PY QA+  GVK++GAT+HY   +LD GPIIEQDV R++H 
Sbjct: 188 LSGKCINIHHSFLPGFKGAKPYHQAHARGVKLMGATSHYVTSDLDEGPIIEQDVERISHQ 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  G++IE +VL +A++ H+Q RV +N  +T+VF
Sbjct: 248 DSPEDLVRKGRDIERRVLARAISWHLQDRVLLNGSRTVVF 287


>gi|84494622|ref|ZP_00993741.1| formyltetrahydrofolate deformylase [Janibacter sp. HTCC2649]
 gi|84384115|gb|EAP99995.1| formyltetrahydrofolate deformylase [Janibacter sp. HTCC2649]
          Length = 296

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 186/278 (66%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           +LT++CP    I + +  +L  +  NI +  QF+D  T + FMR+ F     N  ++ + 
Sbjct: 18  VLTLSCPDRPGIVARVTQHLFERQANIEESQQFSDHRTGRYFMRVRFDTGDANVDVERWR 77

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           ++F  +  +F + + +R    A +TL++VS+  H LNDLL+RW  G +  +IVG+VSNH 
Sbjct: 78  SEFASVAIEFEMVWELRRAVTAYRTLLMVSKFGHVLNDLLFRWKSGQVNADIVGIVSNHP 137

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + +  +Y +PF+++P+T   K E+E KL+ ++ +++VEL+ LARYMQ+LSD LC ++ 
Sbjct: 138 DLEPMARSYGIPFHHIPVTRDTKAEAEAKLLELVAEHDVELITLARYMQVLSDDLCRQLG 197

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQD+ RV H   
Sbjct: 198 GRVINIHHSFLPSFKGAKPYHQAYARGVKVIGATAHYVTADLDEGPIIEQDIHRVDHRMD 257

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED ++ G+ +E++V  +AV  H + RV +N+ +T+VF
Sbjct: 258 AEDLVSAGEEVESRVFARAVKWHCESRVILNEDRTVVF 295


>gi|218885296|ref|YP_002434617.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756250|gb|ACL07149.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 183/281 (65%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           S YILTI+CP    I + +  +L+ Q CNILD +QF D ++ + F+RI F          
Sbjct: 3   SPYILTISCPDRIGIVATVSTFLAVQRCNILDSAQFGDRESKRFFLRIHFEMPDDGPGRP 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F +++ + +     + L+LVS+  HCLND+++R   G L   I  +VS
Sbjct: 63  ELERLFAGVAATFDMEWQLIDAGSTARILVLVSRFGHCLNDIMFRCETGALNATIPAIVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E + +PF+YLP++++NK E E+++  IIE+ +++L++LARYMQILS   C 
Sbjct: 123 NHQDFQRIAEMHDIPFHYLPISKENKAEQEERIARIIEEQSIDLVVLARYMQILSPGFCA 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GR+INIHHSFLPSFKGA+PY QA+  GVK+IGATAHY    LD GPIIEQ+V RV H
Sbjct: 183 RFKGRVINIHHSFLPSFKGASPYHQAFARGVKLIGATAHYVTENLDEGPIIEQEVARVDH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   +D +A+G+++E   L +AV  HI+ RV +N  KT+VF
Sbjct: 243 SHMPDDLVAVGRDVECLALARAVRFHIEHRVLLNGSKTVVF 283


>gi|291302650|ref|YP_003513928.1| formyltetrahydrofolate deformylase [Stackebrandtia nassauensis DSM
           44728]
 gi|290571870|gb|ADD44835.1| formyltetrahydrofolate deformylase [Stackebrandtia nassauensis DSM
           44728]
          Length = 281

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/276 (43%), Positives = 179/276 (64%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CP    I   +  +L+ +  NI D  QF+D  + + FMR+ F  +T +    AD
Sbjct: 5   FVLTLSCPDKVGIVYAVAGFLADRDGNISDSQQFSDPGSGRFFMRVQFHAHTTVDQLRAD 64

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P    +++ + + +     + LIL S+  HCLNDLLYR+  G L   +  V SNH   
Sbjct: 65  FGPTAAPYNMDWQLHDLAVKPRVLILASKQGHCLNDLLYRFRSGALRGELTAVASNHLDW 124

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
            +L E+ ++PF++LP+T   +   EQ+L+++I  + +++++LARYMQIL+D  C K+ G+
Sbjct: 125 AELTESSKVPFHHLPLTPDTRANQEQRLLDLIAADRIDVVVLARYMQILTDDFCAKLPGQ 184

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLPSFKGA PY QAYE GVK+IGATAHY   ELD GPIIEQ+  RV HA    
Sbjct: 185 IINIHHSFLPSFKGAQPYHQAYERGVKLIGATAHYVTAELDEGPIIEQETARVDHAMAPS 244

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             IA G+++E+ VL +A++ H+  RV +N  +T+VF
Sbjct: 245 RLIATGRDLESTVLARALSWHLDHRVLLNGHRTVVF 280


>gi|220911959|ref|YP_002487268.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
 gi|219858837|gb|ACL39179.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
          Length = 286

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 177/277 (63%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +Y+LT++CP    I   +   L   G NI+D  Q+    T   FMR+            A
Sbjct: 9   AYVLTLSCPDRPGIVHAVAGALLVAGSNIMDSQQYGSPATGNFFMRVEVTTAAPASELRA 68

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
             +P+   FS+Q+S+    +  +TLI+ S   HCLNDLL++   GTL + I  +VSNH  
Sbjct: 69  ALEPVAAAFSMQWSLNTVGDKVRTLIMASTSAHCLNDLLFQQRSGTLPIEIPAIVSNHRD 128

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L E Y +PF+Y+P+T+  K ++E KL  ++ ++++EL +LARYMQILSD LC  +TG
Sbjct: 129 LAGLAEFYGVPFHYIPVTKDTKEQAEDKLRALLAEHDIELTVLARYMQILSDELCTDLTG 188

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           + INIHHSFLPSFKGA PY QA+  GVK+IGATAH+    LD GPIIEQ+V+RV HA+T 
Sbjct: 189 KAINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHFVTAALDEGPIIEQEVIRVDHARTP 248

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           E ++ +G+++E + L +AV  H + RV ++  +T+VF
Sbjct: 249 EQFVQMGRDVEGRTLVQAVQWHAEHRVLLDGNRTVVF 285


>gi|319796076|ref|YP_004157716.1| formyltetrahydrofolate deformylase [Variovorax paradoxus EPS]
 gi|315598539|gb|ADU39605.1| formyltetrahydrofolate deformylase [Variovorax paradoxus EPS]
          Length = 291

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 178/278 (64%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           +YIL ++CP    I   +  +L  +G NI + +Q+ND  T   FMR+ F  +   +  + 
Sbjct: 13  AYILNLSCPDRTGIVHAVSGFLLERGANIEEAAQYNDHGTGLFFMRVRFACSDHSEAALR 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            + +     F +   +    E  KT+ILVS+  HCLNDLL+RW  G L++++  ++SNH 
Sbjct: 73  EELKTFAAGFGMNLQLHAAAEPMKTVILVSKEGHCLNDLLFRWKSGLLSIDVRAIISNHR 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  +Y +PF+++P+T   K ++E K + IIE    EL++LARYMQ+LS+ LC  + 
Sbjct: 133 DFYQLAASYNVPFHHIPVTAATKPQAEAKQLEIIEAEGAELVVLARYMQVLSNDLCKSLA 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T
Sbjct: 193 GRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHTDT 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED  A G++ E++VL +AV  H + RV +N  +T+VF
Sbjct: 253 VEDLTARGRDTESQVLARAVKWHSEHRVLLNGHRTVVF 290


>gi|330809036|ref|YP_004353498.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327377144|gb|AEA68494.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 288

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 184/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YIL ITCP+   I + I   L+ Q C I +++QF+D  T + FMR  F FNT +   I  
Sbjct: 8   YILKITCPAASGIIAAISACLARQQCYISELAQFDDEFTGQFFMRAVFRFNTGVDGDIGT 67

Query: 64  FQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +     +   F +Q+ + ++++ T+ L++VS+ DHCL DLLYR   G + ++I  VVSN
Sbjct: 68  LREGLGDLAGGFDMQWQLFSSRQPTRVLLMVSKFDHCLTDLLYRHRKGEMDMHITAVVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T+ +K   E +L+ I+E    +L++LARYMQILSD LC +
Sbjct: 128 HLDLRAMAEREGIRFIYLPITKDSKASQEAELMRIVEDTQTDLVVLARYMQILSDELCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ++ RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTSDLDEGPIIEQEIQRVDHT 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +  +AIG++ E   L+KA+  H++ RVFIN+ KT++F
Sbjct: 248 HLPDSLVAIGRDTETVALSKALKYHLEHRVFINQDKTVIF 287


>gi|311104133|ref|YP_003976986.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans A8]
 gi|310758822|gb|ADP14271.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans A8]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F     +    
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDEETGRFFLRVHFDVPAAVSADD 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +  ++ ++  + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDGMSAEYGMELKLHDARRKERLLIMVSKQGHCLNDLLFRVHSGHLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP+T   K + EQ+++ ++EK  ++L++LARYMQILS+ +C  
Sbjct: 124 HNDYASLAASYGIPFHHLPVTADTKAQQEQQVLALVEKEGIDLVVLARYMQILSEDMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAQDLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|187929153|ref|YP_001899640.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12J]
 gi|187726043|gb|ACD27208.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12J]
          Length = 288

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 131/285 (45%), Positives = 182/285 (63%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      L +
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFV-PQGQPLDL 62

Query: 62  AD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +V
Sbjct: 63  ATLRDCFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           SNH    +L  +Y +PF +LP+   T+  K + E ++  I ++  ++L++LARYMQILSD
Sbjct: 123 SNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQILSD 182

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
           +LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ++ 
Sbjct: 183 NLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQEIE 242

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 243 RVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|149926683|ref|ZP_01914943.1| formyltetrahydrofolate deformylase [Limnobacter sp. MED105]
 gi|149824612|gb|EDM83828.1| formyltetrahydrofolate deformylase [Limnobacter sp. MED105]
          Length = 284

 Score =  272 bits (696), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 179/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  YILTI+CP    I   +  +L  Q CNILD +QF D  T+  F+R+ F      +L 
Sbjct: 1   MRDYILTISCPDTTGIVYNVSKFLFDQQCNILDSAQFGDESTNLFFLRVHFSLPLESQLT 60

Query: 60  ---FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                A+F  +   F+++Y   + +   + L++VS+  HCLNDLL+RW  G L   I  +
Sbjct: 61  EVELQANFAKVAAPFAMKYQFFDARVKPRVLLMVSKFGHCLNDLLFRWKSGQLPCEIPAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     L  +Y +PFY+LP+  + K   E ++  IIE+  ++L++LARYMQILS  L
Sbjct: 121 VSNHQDFALLAASYGVPFYHLPVKAEAKELQETQIRQIIEREKIDLVVLARYMQILSPEL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  M GR+INIHHSFLPSFKGA PY+QA++ GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 181 CRDMLGRVINIHHSFLPSFKGAKPYQQAFDRGVKLIGATAHYVTSDLDEGPIIEQDVARV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E+  A G++ E  VL +AV  H + RV +N  KT+VF
Sbjct: 241 DHSLTPEELTARGRDTECMVLARAVKWHCEHRVVLNGSKTVVF 283


>gi|330809024|ref|YP_004353486.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327377132|gb|AEA68482.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 288

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 183/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA- 62
           +I+ ITCP+   I + +  YL+  GC I +++QF+D  + + FMR  F FN   +  I  
Sbjct: 8   FIIKITCPAVSGIVAAVTTYLADNGCYIGEMAQFDDDFSGRFFMRAVFRFNDGHQGNIQQ 67

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + F + + + +T+E  + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  IKDGFADVARAFEMTWELHDTREPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T+  K   E +L+ I++    EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVTQDTKARQEAELMKIVDDTGTELVVLARYMQILSDDLCKR 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A G++ E   L+KAV  H++ RVF+N+ +T++F
Sbjct: 248 YLPDDLVATGRDTETVALSKAVKYHLEHRVFLNQDRTVIF 287


>gi|309782420|ref|ZP_07677144.1| formyltetrahydrofolate deformylase [Ralstonia sp. 5_7_47FAA]
 gi|308918757|gb|EFP64430.1| formyltetrahydrofolate deformylase [Ralstonia sp. 5_7_47FAA]
          Length = 288

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 131/285 (45%), Positives = 181/285 (63%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      L +
Sbjct: 4   SGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFV-PQGQPLDL 62

Query: 62  AD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  +V
Sbjct: 63  ATLRDCFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           SNH    +L  +Y +PF +LP+   T+  K + E ++  I ++  ++L++LARYMQILSD
Sbjct: 123 SNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQILSD 182

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ++ 
Sbjct: 183 DLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQEIE 242

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 243 RVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|66045466|ref|YP_235307.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63256173|gb|AAY37269.1| Formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330974423|gb|EGH74489.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 288

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 179/280 (63%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKAGFDAVASDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T + K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVTRETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 248 YLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|209963484|ref|YP_002296399.1| formyltetrahydrofolate deformylase [Rhodospirillum centenum SW]
 gi|209956950|gb|ACI97586.1| formyltetrahydrofolate deformylase [Rhodospirillum centenum SW]
          Length = 281

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 182/280 (65%), Gaps = 1/280 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKL 59
           M SY+LT++CP    I + +   L+    NILD +QF D  + + F+RISF V +  +  
Sbjct: 1   MQSYVLTLSCPDAVGIVATLSGLLAGHDANILDSAQFGDRISGRFFLRISFEVEDGRVDT 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                  + ++F +   + +     + +ILVS+  HCLNDLLYR+ IG LA++I  +VSN
Sbjct: 61  LRRALAEVAERFRMDLHLHDAGRRPRVMILVSRFGHCLNDLLYRYRIGALAMDIPAIVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H    +L   + +PF++LP+   NK   E++L+ IIE   ++L++LARYMQ+LS  LC +
Sbjct: 121 HRDFYQLAAWHDVPFHHLPVNGGNKERQEERLLEIIEGERIDLVVLARYMQVLSPTLCER 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ V RV H 
Sbjct: 181 LPGRCINIHHSFLPSFKGAKPYHQAFARGVKLIGATAHYVTTDLDEGPIIEQAVERVDHT 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A+G++IE  VL +AV  H+++RV +N  KT+VF
Sbjct: 241 LGPDDLVAVGRDIECMVLARAVKYHLERRVLLNGSKTVVF 280


>gi|325283327|ref|YP_004255868.1| formyltetrahydrofolate deformylase [Deinococcus proteolyticus MRP]
 gi|324315136|gb|ADY26251.1| formyltetrahydrofolate deformylase [Deinococcus proteolyticus MRP]
          Length = 287

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 173/276 (62%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT++C     I   +   +   G NI+   QF D DT   FMR+          F   
Sbjct: 11  FILTLSCMDRPGIVHAVSGAIMGAGGNIIQSQQFGDTDTGLFFMRVEADLPGGEDAFREQ 70

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
              + Q F + +++       +T+I+VS+  HCL+DLL+R     L L+IV VV NH   
Sbjct: 71  MAALAQTFGMTWTLDRQGRPIRTVIMVSKEGHCLSDLLFRQRSRHLPLDIVAVVGNHADL 130

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L E Y +PF +LP+T   K ++E  L+ ++E+ NVEL++LARYMQILSD LC +M+GR
Sbjct: 131 APLAEFYGVPFVHLPVTPDTKAQAEAALLELVERENVELVVLARYMQILSDTLCGRMSGR 190

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLPSFKGA PY QAY  GVK++GATAHY   +LD GPIIEQDV R+THA ++ 
Sbjct: 191 IINIHHSFLPSFKGARPYAQAYARGVKLMGATAHYVTADLDEGPIIEQDVTRITHADSVA 250

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +  G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 251 AMVQQGQDVERRVLAQAVTWHAEHRVLLNGHRTVVF 286


>gi|302188787|ref|ZP_07265460.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae 642]
          Length = 288

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKAGFDAVANDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T++ K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVTKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 248 YLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|289673367|ref|ZP_06494257.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae FF5]
 gi|330942954|gb|EGH45439.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 288

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 179/280 (63%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI-- 61
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN   +  I  
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDIQQ 67

Query: 62  --ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKAGFDAVANDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T + K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVTRETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 248 YLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|302555897|ref|ZP_07308239.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302473515|gb|EFL36608.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 287

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 119/277 (42%), Positives = 189/277 (68%), Gaps = 3/277 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LT++CP    +   +  +L     NI +  QF+D    + FMR+ F  +   T ++  
Sbjct: 11  FVLTLSCPDRSGLVHAVTGFLVRHSGNIQESQQFDDRLQDRFFMRVHFDVSDPGTSIEDL 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F P+ + + + + + +    T+TLI+VS+  HCLNDLL+R + G+L + +  +VSNH
Sbjct: 71  KSGFAPVAEAYRISWQLFDASTPTRTLIMVSKFGHCLNDLLFRRSTGSLNIEVPAIVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L E+Y +PF+++P+T + K E+E +L+ ++++ +++L++LARYMQILS+ LC ++
Sbjct: 131 RDFEPLAESYGIPFHHVPVTRETKPEAEARLLQLVDELDIDLVVLARYMQILSNDLCKQL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDV+RV HAQ
Sbjct: 191 EGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTPDLDEGPIIEQDVIRVNHAQ 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTI 277
             +  +A+G+++EA+VL +AV  H Q RV +N  +T+
Sbjct: 251 RPDSLVALGRDVEAQVLARAVEWHSQSRVMVNGNRTV 287


>gi|190572330|ref|YP_001970175.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           K279a]
 gi|190010252|emb|CAQ43860.1| putative formyl transferase [Stenotrophomonas maltophilia K279a]
          Length = 283

 Score =  271 bits (694), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 177/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI--A 62
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +  + L    A
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDAGLPLETVHA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               + + F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMATLAEGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+T   +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAPLAASYQVPFHHLPVTADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMAP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|294629923|ref|ZP_06708483.1| formyltetrahydrofolate deformylase [Streptomyces sp. e14]
 gi|292833256|gb|EFF91605.1| formyltetrahydrofolate deformylase [Streptomyces sp. e14]
          Length = 294

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 186/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT++CP  + I   +  YL   GCNI+D  QF D D+   FMR+ F   + + +    
Sbjct: 16  YVLTLSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDQDSGLFFMRVHFSAESPVTVDKLR 75

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F  I   F +++ I    E  + +++VS+  HCLNDLL+R  IG L + I  VVSNHT
Sbjct: 76  ASFAAIGDSFGMEWQIHRADEKMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNHT 135

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +LV +Y +PF+++P+T   K E+E +L+ ++ +  VEL++LARYMQ+LSD LC +++
Sbjct: 136 DFAELVASYDIPFHHIPVTRDTKAEAEARLLELVREEEVELVVLARYMQVLSDDLCKQLS 195

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  T
Sbjct: 196 GRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDVT 255

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 256 PDQLVALGRDVECQALARAVKWHAEHRILLNGRRTVVF 293


>gi|332669642|ref|YP_004452650.1| formyltetrahydrofolate deformylase [Cellulomonas fimi ATCC 484]
 gi|332338680|gb|AEE45263.1| formyltetrahydrofolate deformylase [Cellulomonas fimi ATCC 484]
          Length = 291

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 118/276 (42%), Positives = 180/276 (65%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CP    I   +   L+  G NI +  QF D  +   FMR+        ++    
Sbjct: 15  WVLTLSCPDRPGIVRAVAGVLADHGGNITESQQFGDPLSGLFFMRVQVSAYAPREVLAGA 74

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
              + + F++ +S+       +TL++ S   HCLNDL +R     L +++V VVSNHT+ 
Sbjct: 75  MSTVARTFAMTWSLDVVGRPVRTLVMGSTAAHCLNDLAFRQRSEKLPVDLVAVVSNHTSL 134

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L E Y +PF+++P+T   K ++E +L+ ++E+ +VEL++LARYMQILSD LC ++ GR
Sbjct: 135 APLAEFYDIPFHHVPVTSATKAQAEARLLELVEELDVELVVLARYMQILSDDLCRRLAGR 194

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           +INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H ++++
Sbjct: 195 VINIHHSFLPSFKGARPYAQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVERVDHTRSVD 254

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           D +A+G+++E + L +AV  H + RV ++  +TIVF
Sbjct: 255 DLVALGQDVERRALARAVRWHAEHRVLLDGHRTIVF 290


>gi|187479291|ref|YP_787316.1| formyltetrahydrofolate deformylase [Bordetella avium 197N]
 gi|115423878|emb|CAJ50430.1| formyltetrahydrofolate deformylase [Bordetella avium 197N]
          Length = 284

 Score =  271 bits (693), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 179/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F     +      
Sbjct: 6   YILTLSCPDRTGIVYRVSGLLFDLGCNILDSQQFGDEETGRFFLRVHFDLPASVSAASLR 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +     + + I + +   + LI+VS+  HCLNDLL+R + G L   +  ++SNH 
Sbjct: 66  ERFGALAGNDGMDWQIHDARRKARLLIMVSKQGHCLNDLLFRVSSGQLPAEVAAIISNHN 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            +  L  +Y +PF++LP+T   K E E+++++I+E+  ++L++LARYMQILS  LC  ++
Sbjct: 126 DYAGLAASYGIPFHHLPVTADTKAEQEKQVLDIVERERIDLVVLARYMQILSADLCRALS 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD+ RV H+ T
Sbjct: 186 GRAINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQDIERVDHSMT 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +    +G ++E+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 246 AQALTQVGSDVESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|171059964|ref|YP_001792313.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170777409|gb|ACB35548.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 282

 Score =  271 bits (692), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 126/281 (44%), Positives = 183/281 (65%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +YILT++CP    I   +   L   G NIL+ +Q+ND  T   FMR+ F    C K   A
Sbjct: 4   TYILTLSCPDQPGIVHGVAGLLFMHGGNILEAAQYNDEQTGLFFMRVQF---ACAKTPRA 60

Query: 63  DFQPIVQQ----FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           D +  +Q+    +++ + +    +   T+I+VSQ  HC+NDLL+R+  G L ++I  +VS
Sbjct: 61  DLEHALQELAAVWTMSFELHAGAQRMATVIMVSQHGHCINDLLFRFKSGLLPIDIKAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K E+E K + +I     EL+ILARYMQ+LSD +C 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKQEAEAKQLEVIRAEGAELVILARYMQVLSDPMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 ALNGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T++D  +IG++ E++VL +AV  H ++RV +N  KT++F
Sbjct: 241 SLTVDDLTSIGRDTESQVLARAVKWHSERRVLLNGHKTVIF 281


>gi|312797333|ref|YP_004030255.1| Formyltetrahydrofolate deformylase [Burkholderia rhizoxinica HKI
           454]
 gi|312169108|emb|CBW76111.1| Formyltetrahydrofolate deformylase (EC 3.5.1.10) [Burkholderia
           rhizoxinica HKI 454]
          Length = 289

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 183/283 (64%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL + C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 6   SFILKLACADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLHA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF +++ + +    ++ +I+VS+  HCLNDLL+R+  G LA+ I  +VSN
Sbjct: 66  LRASFATLAEQFGMRWELHDANAKSRVMIMVSKIGHCLNDLLFRYRTGQLAIEIPAIVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF+YLP+   T Q K   E +++ ++E + V+L++LARYMQILS  L
Sbjct: 126 HQDFYQLAASYNIPFHYLPLADGTPQAKAAQEARVLELVEHHGVDLVVLARYMQILSGEL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEKLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 DHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNDTKTVVF 288


>gi|146308474|ref|YP_001188939.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576675|gb|ABP86207.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 284

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 182/283 (64%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ YIL I+CP+   I + +  YL+ + C + +++QF+D  T + FMR  F FN   +  
Sbjct: 1   MNHYILKISCPATSGIVAAVTTYLAGRDCYLSELAQFDDEFTGRFFMRAVFRFNDTTRAD 60

Query: 61  I----ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           I      F  I   F++ + +  ++   + L++VS+ DHCL DLLYR + G L + I  +
Sbjct: 61  IDALRQGFDDIAVPFAMDWELFESQRPMRVLLMVSKFDHCLVDLLYRHHKGELDMQITAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + + E   + F YLP+T   K + E  L+ I+++   EL++LARYMQILSD L
Sbjct: 121 VSNHLDLRPMAEREGIRFIYLPVTRDTKAQQEAALMKIVDETQTELVVLARYMQILSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 181 CQQLSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA   +D +AIG++ E   L+KA+  H++ RV +N  KT++F
Sbjct: 241 DHAYLPDDLVAIGRDTETVALSKALKYHLEHRVLLNGDKTVIF 283


>gi|85090213|ref|XP_958310.1| formyltetrahydrofolate deformylase [Neurospora crassa OR74A]
 gi|28919659|gb|EAA29074.1| formyltetrahydrofolate deformylase [Neurospora crassa OR74A]
          Length = 287

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 182/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           +ILT++CP    I   +    + QG NILD+ QF+D  + K FMR+ F        +  I
Sbjct: 9   HILTLSCPDKPGIVHAVTGVFAQQGHNILDLQQFSDPVSEKFFMRVHFGPTPTPSTEHLI 68

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +   + ++Y IR   + T+ LI+VS+  HCLNDLL+R   G L ++I  +VSNH 
Sbjct: 69  EPFNKLATDYQMEYKIRPVAQKTRVLIMVSKIGHCLNDLLFRAKTGQLPIDIPLIVSNHP 128

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + L ++Y + F++LP+T+  K + E +++ + +++ +EL++LARYMQ+LS  LC  M+
Sbjct: 129 TFEPLAQSYGIEFHHLPVTKDTKAQQESQVLELAKQHGIELIVLARYMQVLSPTLCEAMS 188

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H   
Sbjct: 189 GRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVTRVDHGMG 248

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +  G N+E++VL  AV  + +QR+F+N  KT+VF
Sbjct: 249 PERLVDEGSNVESQVLAAAVKWYAEQRLFLNNGKTVVF 286


>gi|326386838|ref|ZP_08208453.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208641|gb|EGD59443.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 357

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 125/279 (44%), Positives = 184/279 (65%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLFI 61
           +++T++CP+   I + +   L     NIL+  Q++DL T K FMR+ F        +   
Sbjct: 77  FVITLSCPNQPGIVARVCTLLYAHRGNILEAHQYDDLATGKFFMRMVFNLGEGGDARELT 136

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF  + Q++++Q+ IR+  E  K L++VS+  HCL DLLYRW IG L ++IVG+V+NH 
Sbjct: 137 RDFALVGQEYAMQWQIRSLSERQKVLLMVSKFHHCLADLLYRWRIGELPMDIVGIVANHP 196

Query: 122 THKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                  ++  +PF+YLP+T+  K + E ++  ++E+   EL++LARYMQILSD +   +
Sbjct: 197 LESFAGLDFGDIPFHYLPITKDTKPQQEAQIKAVVEETGAELVVLARYMQILSDDMAAYL 256

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R+THA+
Sbjct: 257 SGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQDVERITHAE 316

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED +  G++IE +VL +A++ H+  R  +N   T+VF
Sbjct: 317 TPEDLVCKGRDIERRVLARAISMHLSGRALVNGSTTVVF 355


>gi|319761222|ref|YP_004125159.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           BC]
 gi|330823089|ref|YP_004386392.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           K601]
 gi|317115783|gb|ADU98271.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           BC]
 gi|329308461|gb|AEB82876.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           K601]
          Length = 282

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 183/281 (65%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           +YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +      +K
Sbjct: 4   AYILTLSCPDRLGLVHAVSGFLLEHGGNIEEAAQYNDDATGLFFMRVQFACSQHDGATLK 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A F    + +++++S+    EA +T++LVS+  HCLNDLL+R   G L +++  ++S
Sbjct: 64  EHLARF---AEPYAMRWSLHAKAEAMRTVLLVSREGHCLNDLLFRVKSGLLPIDVRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E +   IIE    EL++LARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKAQAEARQYEIIESEGAELVVLARYMQVLSNELCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 RLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|194363991|ref|YP_002026601.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           R551-3]
 gi|194346795|gb|ACF49918.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           R551-3]
          Length = 283

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 176/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI--A 62
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +  + L    A
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDAGLPLETVHA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               +   F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMATLAAGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+T   +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAALAASYQVPFHHLPVTADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMVP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|197105876|ref|YP_002131253.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
 gi|196479296|gb|ACG78824.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
          Length = 280

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 176/280 (62%), Gaps = 8/280 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD- 63
           ILT++CP    I + +   L  +G NILD  QF+D +T + FMR+ F           D 
Sbjct: 2   ILTLSCPDQPGIVARVSALLFERGANILDAQQFDDEETGRFFMRVVFDPGQADVAAWRDA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT- 122
           F P+ +Q+ + + +R   E  + +IL SQ DHCL DL++RW  G L ++I  VVSNH   
Sbjct: 62  FAPLGEQYGMTWQMRARGERRRVMILASQQDHCLADLIWRWRQGELPMDITAVVSNHPAS 121

Query: 123 ---HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
              H  L   + + F++LP+T   K + E +L  +I++   EL++LARYMQILSD L  K
Sbjct: 122 TYPHTDL---HGIAFHHLPITADTKPQQEARLWKLIQETGTELVVLARYMQILSDDLSGK 178

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++H 
Sbjct: 179 LEGRCINIHHSFLPGFKGARPYHQAHARGVKVIGATAHYVTADLDEGPIIEQDVERISHR 238

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D +  G++IE +VL +AV  H++ RV +N RKT+VF
Sbjct: 239 DHPRDLVRKGRDIERRVLARAVRWHLEDRVLLNGRKTVVF 278


>gi|229589818|ref|YP_002871937.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229361684|emb|CAY48565.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 288

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 182/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YIL ITCP+   I + I   L+ Q C I +++QF+D  T + FMR  F FNT +   I  
Sbjct: 8   YILKITCPAASGIVAAISACLAQQQCYISELAQFDDEFTGQFFMRAVFRFNTGVSGDIGA 67

Query: 64  FQ----PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +     +   F + + + ++++ T+ L++VS+ DHCL DLLYR   G + ++I  VVSN
Sbjct: 68  LRNGLGDLAGGFDMHWQLFSSRQPTRVLLMVSKFDHCLTDLLYRHRKGEMDMHITAVVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T+  K   E +L+ I+E    +L++LARYMQILSD LC +
Sbjct: 128 HLDLRAMAEREGIRFIYLPITQDTKARQEAELMRIVEDTQTDLVVLARYMQILSDGLCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ++ RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTSDLDEGPIIEQEIQRVDHT 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +  +AIG++ E   L+KA+  H++ RVFIN+ KT++F
Sbjct: 248 HLPDSLVAIGRDTETVALSKALKYHLEHRVFINQDKTVIF 287


>gi|218515366|ref|ZP_03512206.1| formyltetrahydrofolate deformylase protein [Rhizobium etli 8C-3]
          Length = 263

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 119/226 (52%), Positives = 166/226 (73%), Gaps = 2/226 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MRSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELD 224
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLD 226


>gi|289624011|ref|ZP_06456965.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650514|ref|ZP_06481857.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868170|gb|EGH02879.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 288

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 181/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKTGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCKQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|28869649|ref|NP_792268.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971222|ref|ZP_03399339.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|301383929|ref|ZP_07232347.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061526|ref|ZP_07253067.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302131040|ref|ZP_07257030.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28852891|gb|AAO55963.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923975|gb|EEB57553.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
          Length = 288

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +VSN
Sbjct: 68  LKAGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRAMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|269128050|ref|YP_003301420.1| formyltetrahydrofolate deformylase [Thermomonospora curvata DSM
           43183]
 gi|268313008|gb|ACY99382.1| formyltetrahydrofolate deformylase [Thermomonospora curvata DSM
           43183]
          Length = 287

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 182/284 (64%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S YILT++CP    I + +   L+ +GCNI++  Q+ D  T + FMR+ F         +
Sbjct: 3   SDYILTLSCPDRPGIVAAVSGLLAERGCNIVESQQYGDPITGRFFMRVQFTVPGPEPGAV 62

Query: 62  AD-----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA-LNIVG 115
           AD        +V +F+L + + +    T+ LILVS+  HCLNDLLYR   G L+ ++IV 
Sbjct: 63  ADGLRTALAALVPEFALDWRLYDASVPTRVLILVSKAGHCLNDLLYRRRSGQLSTIDIVA 122

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V SNH   + L ++Y + +++LP+    K   E +++ ++E   V+L++LARYMQ+LSD 
Sbjct: 123 VASNHPDLRPLTQSYGIDYHHLPIGPGGKAAQEAEILALVEHYRVDLVVLARYMQVLSDE 182

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +C K+ GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   ELD GPIIEQ+V R
Sbjct: 183 MCGKLPGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTPELDEGPIIEQEVAR 242

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  +  D +A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 243 VDHTHSPADLMAVGRDMECLALARAVRWHSEHRILLNGDKTVVF 286


>gi|330888410|gb|EGH21071.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 288

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 182/280 (65%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKTGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCKQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPEDLVAEGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|269955556|ref|YP_003325345.1| formyltetrahydrofolate deformylase [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304237|gb|ACZ29787.1| formyltetrahydrofolate deformylase [Xylanimonas cellulosilytica DSM
           15894]
          Length = 291

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 178/278 (64%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + ++LTI+CP    I S I   L+ +G NI +  QF D  +   F+R+  V     +  +
Sbjct: 13  TEWVLTISCPDGPGIVSAITGALAARGDNITESQQFGDPASGLFFLRLQVVSTATREELV 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A   P    F++ +++       +TL+LVS+  HCL DLLYR     + +++VGVV NH 
Sbjct: 73  AALTPAFDAFAMTWNLDVVGRRMRTLLLVSKAAHCLVDLLYRERSQGMPIDVVGVVGNHP 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               +   Y  PF+ +P+T+  K E+E +L  ++ + +VEL++LARYMQILSD LC  ++
Sbjct: 133 DLADIAAFYGKPFHRVPVTQATKAEAEDRLRALVAELDVELVVLARYMQILSDDLCRDLS 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA++ GVKIIGAT+HY   +LD GPIIEQDV RV H++ 
Sbjct: 193 GRIINIHHSFLPSFKGARPYAQAHDRGVKIIGATSHYVTGDLDEGPIIEQDVERVDHSRA 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + D +AIG+++E   L +AV  H + RV +N  +T++F
Sbjct: 253 VADLVAIGEDVERATLARAVRWHAEHRVLLNGHRTVIF 290


>gi|293603576|ref|ZP_06685997.1| formyltetrahydrofolate deformylase [Achromobacter piechaudii ATCC
           43553]
 gi|292818012|gb|EFF77072.1| formyltetrahydrofolate deformylase [Achromobacter piechaudii ATCC
           43553]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F     +    
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDEETGQFFLRVHFDLPAAVAPDD 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +   + +   + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDTLSADYGMDLKLHDARRKQRLLIMVSKQGHCLNDLLFRVHSGHLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF+YLP+T   K E E++++ I E++N +L++LARYMQILS  +C  
Sbjct: 124 HNDYASLAASYGIPFHYLPVTADTKAEQEKQVLRIAEQSNTDLVVLARYMQILSADMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAADLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|331019500|gb|EGH99556.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 288

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +VSN
Sbjct: 68  LKAGFDAVTKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRAMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|163855162|ref|YP_001629460.1| formyltetrahydrofolate deformylase [Bordetella petrii DSM 12804]
 gi|163258890|emb|CAP41189.1| formyltetrahydrofolate deformylase [Bordetella petrii]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 175/278 (62%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLFI 61
           YILT++CP    I   +   L   GCNILD  QF D +T++ F+R+ F            
Sbjct: 6   YILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDDETNRFFLRVHFNLPAAATEASLR 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +   + + + I + +   + LI+VS+  HCLNDLL+R   G L   I  +VSNH 
Sbjct: 66  EQFGALAGAYGMDWQIHDARRKARLLIMVSKQGHCLNDLLFRVQSGQLHAEIAAIVSNHN 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            +  L  +Y +PF++LP++   K E E++++ ++E   ++L++LARYMQILS  +C  +T
Sbjct: 126 DYAGLAASYGIPFHHLPVSADTKAEQEKQVLALVESEQIDLVVLARYMQILSPEMCVALT 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H  T
Sbjct: 186 GRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQDIERVDHTMT 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D   +G ++E+ VL +AV +H++ R+ +N+ KT+VF
Sbjct: 246 AADLTQVGSDVESLVLARAVRSHVEHRILLNRNKTVVF 283


>gi|33594158|ref|NP_881802.1| formyltetrahydrofolate deformylase [Bordetella pertussis Tohama I]
 gi|33598126|ref|NP_885769.1| formyltetrahydrofolate deformylase [Bordetella parapertussis 12822]
 gi|33603019|ref|NP_890579.1| formyltetrahydrofolate deformylase [Bordetella bronchiseptica RB50]
 gi|33564232|emb|CAE43521.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33566684|emb|CAE38894.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis]
 gi|33568650|emb|CAE34408.1| putative formyltetrahydrofolate deformylase [Bordetella
           bronchiseptica RB50]
 gi|332383573|gb|AEE68420.1| formyltetrahydrofolate deformylase [Bordetella pertussis CS]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 174/278 (62%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           YILT++CP    I   +   L   GCNI D  QF D +T + F+R+ F            
Sbjct: 6   YILTLSCPDRTGIVFRVSGLLFELGCNIRDSQQFGDEETGRFFLRVHFDLPRAAAESALR 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +   + +Q+ I +     + LI+VS+  HCLNDLL+R + G L   +  +VSNH 
Sbjct: 66  EQFAALANGYDMQWQIHDAHRKARLLIMVSKQGHCLNDLLFRVSSGQLRAEVAAIVSNHN 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            +  L  +Y +PF+++P+T   K   E++++ ++E+  ++L++LARYMQILS  +C  + 
Sbjct: 126 DYASLAASYGIPFHHMPVTPDTKAAQERQVLELVEREQIDLVVLARYMQILSADMCQALA 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H  T
Sbjct: 186 GRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQDIERVDHTMT 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 246 AADLTQVGSDIESLVLSRAVRSHVEHRILLNRSKTVVF 283


>gi|258653769|ref|YP_003202925.1| formyltetrahydrofolate deformylase [Nakamurella multipartita DSM
           44233]
 gi|258556994|gb|ACV79936.1| formyltetrahydrofolate deformylase [Nakamurella multipartita DSM
           44233]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 123/281 (43%), Positives = 175/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM-K 58
            S++LT++CP    I   +   L+  GC+I +  QF+D    KLF+R +F      C+  
Sbjct: 3   GSFVLTLSCPEQPGIVHAVTTVLNDHGCDITEHQQFDDPMNGKLFLRTAFTAPAGGCVAD 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F++ + + +    T+ LI+ S+ DHCL DLLYRW  G+L   +  VVS
Sbjct: 63  ALRTGFASIADAFAMTWQLHDATHRTRILIMASKFDHCLTDLLYRWRTGSLGGQVAAVVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L +  ++PF ++P+T  +K  +E  L+ +I++ +++L++LARYMQ+LSD LC 
Sbjct: 123 NHQDLAHLADTARVPFVHIPVTADSKPAAEHHLLQVIDQQDIDLVVLARYMQVLSDPLCR 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSF GA PY QAYE GVK +GATAHY   ELD GPIIEQ++ RV H
Sbjct: 183 TLHGRAINIHHSFLPSFTGAKPYHQAYERGVKYVGATAHYVTAELDEGPIIEQELTRVDH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  ED IA+G++ E   L +AV  H Q R+ +N  +TIVF
Sbjct: 243 RRAPEDLIAVGRDAERLALARAVTWHCQHRILLNGNRTIVF 283


>gi|145589336|ref|YP_001155933.1| formyltetrahydrofolate deformylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047742|gb|ABP34369.1| formyltetrahydrofolate deformylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 284

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 181/277 (65%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           Y LT+TCP+   I + +  Y+   G +I +  QF+D  + + FMR+SF   T      + 
Sbjct: 6   YYLTLTCPNKPGIIAAVSTYIFQAGGDIEEAQQFDDKASKQFFMRVSFSCPTDGNTLRSG 65

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F  I ++F L + +R  K+  + LI+ S+ DHCL DLLYRW IG L + I G+VSNH   
Sbjct: 66  FIEIAKRFELTWDLRAVKDLKRVLIMASKLDHCLVDLLYRWRIGELPMIICGIVSNHPRE 125

Query: 124 -KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
               ++   +PFY+LP+T + K   E KL+ II  N V+++ILARYMQILSD+L  +++G
Sbjct: 126 VYASIDFADIPFYHLPVTAETKPAQEAKLLEIIADNKVDMVILARYMQILSDNLSSELSG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R IN+HHSFLPSFKGA PY QA+  G+K+IGATAH+   +LD GPIIEQDV RVTH  T 
Sbjct: 186 RCINVHHSFLPSFKGAKPYHQAHARGIKLIGATAHFVTSDLDEGPIIEQDVTRVTHGDTP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G+++E  VL++A+  ++  RV IN   ++VF
Sbjct: 246 EDLVRKGRDLERTVLSRALRYYLHDRVLINGATSVVF 282


>gi|119964276|ref|YP_947011.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
 gi|119951135|gb|ABM10046.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
          Length = 311

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 181/278 (65%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +++++T++CP    I   +   L   GCNI D  Q+    T   FMR+     +      
Sbjct: 33  TAFVVTLSCPDRPGIVHAVAGALLDAGCNIADSQQYGSPTTGNFFMRVEATTASSQDELA 92

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A  +P+ + F + + I    +  +T+IL S+  HCLNDLL++   GTL +++  +VSNH 
Sbjct: 93  AALRPVAESFGMTWQINPVGQKVRTIILCSKDAHCLNDLLFQQRTGTLPIDVPAIVSNHR 152

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L E Y +PF+++P+T + K ++E +L+ +I +++VEL +LARYMQ+LS+ LC ++ 
Sbjct: 153 DLESLAEFYGIPFHHIPVTPETKPQAEAELLKLIAEHDVELTVLARYMQVLSNDLCTELN 212

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ+V+RV HA+T
Sbjct: 213 GKAINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTADLDEGPIIEQEVIRVDHART 272

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++ +G+++E + L +AV  H + RV ++  +T+VF
Sbjct: 273 AAQFVQMGRDVEGRTLAQAVQWHAEHRVLLDGTRTVVF 310


>gi|71733652|ref|YP_275141.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257486081|ref|ZP_05640122.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|71554205|gb|AAZ33416.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323632|gb|EFW79716.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320328271|gb|EFW84275.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878650|gb|EGH12799.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330989331|gb|EGH87434.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 288

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 181/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKTGFDVVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCKQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|330876862|gb|EGH11011.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 288

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +VSN
Sbjct: 68  LKAGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLCRQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHV 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|331006342|ref|ZP_08329654.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC1989]
 gi|330419847|gb|EGG94201.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC1989]
          Length = 288

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 185/281 (65%), Gaps = 8/281 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MKL 59
           +L ++C     I + + +  + QG NI   SQF D+  S+ FMR   VF +C     ++ 
Sbjct: 8   VLKLSCKDQPGIVAAVANLFALQGFNIRASSQFEDVSASRFFMRT--VFESCEGGKPLED 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               FQP+ +++ + + + +T+   K LI VSQ  HCL+ LL  W  G+LA++IVGVVSN
Sbjct: 66  VKVCFQPLAERYGMSWELVDTQNKPKVLIAVSQWGHCLSHLLNAWKRGSLAVDIVGVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN-NVELMILARYMQILSDHLCH 178
           H   + L + Y++PFY+LP+T + K + E +L+ +++     + ++LARYMQILS+ +C 
Sbjct: 126 HEVMRSLCDWYEVPFYFLPITAETKPQQEAQLLTLMDDTLGADFLVLARYMQILSNGMCE 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ V RV+H
Sbjct: 186 QLAGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTTDLDEGPIIEQSVERVSH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A + E+ + IG++IEA VL +AV  H + RV IN  KT+VF
Sbjct: 246 ANSPEELVEIGQDIEAIVLNRAVRWHAEYRVLINGEKTVVF 286


>gi|46579951|ref|YP_010759.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602635|ref|YP_967035.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris DP4]
 gi|46449367|gb|AAS96018.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562864|gb|ABM28608.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris DP4]
 gi|311234051|gb|ADP86905.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris RCH1]
          Length = 284

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           S+YILTI CP    I + +  +L+ Q CNI+D +QF D DT + F+RI F          
Sbjct: 3   SAYILTIACPDRIGIVATVSTFLAVQQCNIIDSAQFGDPDTRRFFLRIHFEMPDDGPGRP 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F +Q+ + +    ++ +I+VS+  HCLNDLL+R + GTL   I  +VS
Sbjct: 63  ELERLFAGVAATFDMQWELHDAGRKSRLMIMVSRFGHCLNDLLFRCSTGTLQAEITAIVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E + +PF++LP+T+  K E E  +  +IE    ++++LARYMQ+LS   C 
Sbjct: 123 NHADFERIAEMHGIPFHHLPVTKDTKREQEAAVAQVIEDTRSDVVVLARYMQVLSAEFCS 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLPSFKGA+PY QAY  GVK+IGATAHY    LD GPIIEQ+V RV H
Sbjct: 183 RYPGRIINIHHSFLPSFKGASPYHQAYARGVKLIGATAHYVTENLDEGPIIEQEVSRVDH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   +  + +G+++E+ VL++AV  H++ RV +N  +T+VF
Sbjct: 243 AHLPDALVNVGRDVESLVLSRAVRYHVEHRVLLNGHRTVVF 283


>gi|148256983|ref|YP_001241568.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. BTAi1]
 gi|146409156|gb|ABQ37662.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. BTAi1]
          Length = 287

 Score =  269 bits (687), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 181/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLF 60
           Y+LT++CP    I S +  +L+  G NILD  QF D +T   FMR+ F        +   
Sbjct: 6   YVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFGDFETDHFFMRVVFTAADLAVNLPAL 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I ++FS+ + +R+     + ++LVS+ DHCL D+LYRW    L++    +VSNH
Sbjct: 66  QTGFAAIAERFSMDWQMRDRAAQRRVMLLVSKFDHCLVDILYRWRTRDLSMIPTAIVSNH 125

Query: 121 TTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                   ++  +PF+++P+T++ K + EQ ++ ++E+   +L++LARYMQILSD +   
Sbjct: 126 PRETYAGLDFGDIPFHHMPVTKETKRDQEQAILKLVEETKTDLVVLARYMQILSDEMSAS 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPII+QDV R++H 
Sbjct: 186 LSGRCINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTRDLDEGPIIDQDVERISHR 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +  G++IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 246 DTPDDLVRKGRDIERRVLARAIRYHLEDRVILNGRKTVVF 285


>gi|113868472|ref|YP_726961.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
 gi|113527248|emb|CAJ93593.1| formyltetrahydrofolate hydrolase [Ralstonia eutropha H16]
          Length = 288

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 179/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           + +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F        + 
Sbjct: 4   TGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDEYAGRFFMRVHFTPAAGGPDLD 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F P+  QFS+Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  +VS
Sbjct: 64  TLKAAFAPVGDQFSMQWELNDAAVKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF++LP+   + + K   E ++ +++++  ++L++LARYMQ+LSD 
Sbjct: 124 NHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFDVVQEQKIDLVVLARYMQVLSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ++ R
Sbjct: 184 LCRKLAGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|167645075|ref|YP_001682738.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
 gi|167347505|gb|ABZ70240.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
          Length = 303

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 180/280 (64%), Gaps = 5/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YIL + CP  + + + +  +L+    +I++ S FND    + +MR  F  +  M   I D
Sbjct: 24  YILILQCPDRKGVVAAVSGFLADNDASIVESSHFNDGLADQFYMRTVFRPDGAMP-GIDD 82

Query: 64  ----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+ I ++F + +++ +     K LI VS+  HCL DLL+RW  G L + IVGVVSN
Sbjct: 83  LRQGFELIAKRFGMTWALHDANAKPKVLIAVSKFGHCLFDLLHRWRAGLLPVEIVGVVSN 142

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +   E   LP+++LP T  NK E E+  + +++  NV+L++LARYMQILS  LC +
Sbjct: 143 HEDMRSFTEWSGLPYFHLPTTNTNKAEQEEAFLRLVDDLNVDLVVLARYMQILSPALCAR 202

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLPSFKGA PY QA+E GVKIIGATAHY   +LD GPIIEQ V RV H+
Sbjct: 203 LSGRCINIHHSFLPSFKGAKPYHQAFERGVKIIGATAHYVTTDLDEGPIIEQGVHRVDHS 262

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +A+G+++E  VL +AV  H++ RV I   KT+VF
Sbjct: 263 HTPDDLVALGRDVECTVLARAVTWHVEHRVLIAGAKTVVF 302


>gi|254786909|ref|YP_003074338.1| formyltetrahydrofolate deformylase [Teredinibacter turnerae T7901]
 gi|237683770|gb|ACR11034.1| formyltetrahydrofolate deformylase [Teredinibacter turnerae T7901]
          Length = 288

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 175/278 (62%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI---SFVFNTCMKLFI 61
           IL  +C     I + +    S QG NI + SQF D+ T + FMR    S      +    
Sbjct: 9   ILKFSCDDQPGIVASVASLFSLQGFNIRESSQFEDVTTKRFFMRTLLESVEGPKSLHDVE 68

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           + F  I  ++ + + + + ++  K LI VSQ  HCLN+LL  W  GTL + IVGVVSNH 
Sbjct: 69  SAFHSIADRYRMDWCLCDGRKKAKVLIAVSQWGHCLNNLLNSWKRGTLPVEIVGVVSNHE 128

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L E Y +P++YLP+T++ K E E +++ ++     EL++LARYMQILSD LC  + 
Sbjct: 129 EMRSLTEWYSVPYHYLPVTKETKREQEAQILKVMGDAGAELLVLARYMQILSDDLCRALA 188

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   ELD GPIIEQ V RVTHA +
Sbjct: 189 GRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTAELDEGPIIEQAVERVTHANS 248

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E+ + +G++ EA VL +AV  H + R+ +N  KT+VF
Sbjct: 249 PEELVELGRDTEAVVLQRAVRWHAENRILLNGGKTVVF 286


>gi|271968574|ref|YP_003342770.1| formyltetrahydrofolate deformylase [Streptosporangium roseum DSM
           43021]
 gi|270511749|gb|ACZ90027.1| formyltetrahydrofolate deformylase [Streptosporangium roseum DSM
           43021]
          Length = 284

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 181/282 (64%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           + Y+LT++CP    + + +   L+ QGCNI++  QF D    + FMR+ F   + +  ++
Sbjct: 5   AQYVLTLSCPDRPGVVAAVSGLLAEQGCNIIESQQFGDPVAERFFMRVQFSCPLSDAELR 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             IA   P    F +   +R+     + L++VS+  HCLNDLLYR   G L + IV V S
Sbjct: 65  TAIAALAP---DFGMDVRLRDLAVKPRVLVMVSKFGHCLNDLLYRTRSGLLDIEIVAVAS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L ++Y + +++LP+T   K   E +++++++    +L++LARYMQ+LS+ LC 
Sbjct: 122 NHPDMRPLTQSYGIDYHHLPVTSATKSRQEAEILSLVDHYEADLVVLARYMQVLSEDLCV 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ G +INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 182 KLAGNVINIHHSFLPSFKGAKPYHQAHSRGVKLIGATAHYVTADLDEGPIIEQEVARVNH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             + ED  AIG+++E + L +AV  H +QRV ++  KTIVFP
Sbjct: 242 THSAEDLAAIGRDVECQALARAVRWHTEQRVLLDGHKTIVFP 283


>gi|315497228|ref|YP_004086032.1| formyltetrahydrofolate deformylase [Asticcacaulis excentricus CB
           48]
 gi|315415240|gb|ADU11881.1| formyltetrahydrofolate deformylase [Asticcacaulis excentricus CB
           48]
          Length = 292

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 179/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----M 57
           S Y+L I CP    I + +  YL+    +I++ +QFND      ++R+ F         M
Sbjct: 10  SHYVLIIKCPDTRGIVAAVSGYLNDNDISIVESNQFNDSQGDMFYVRVVFKQAGARMPPM 69

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            +    F+PI  +FS+++ I N     + +I VS+  HCL +LL+RW  G L + I  VV
Sbjct: 70  SILREGFKPIAHRFSMEWDIHNLSVRPRVVIAVSKFGHCLYELLHRWRSGLLPVEIAAVV 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +  VE   LP+ +LP+T+  K E E + +++IE +  +L++LARYMQILSD   
Sbjct: 130 SNHEDMRSFVEWNGLPYVHLPITKDTKAEQEAQFLSLIETHQADLVVLARYMQILSDEFS 189

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLPSFKGA PY QA++ GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 190 RRLEGRCINIHHSFLPSFKGAKPYHQAHQRGVKIIGATAHYVTSDLDEGPIIEQDVQRVH 249

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +AIG++IEA+VL +AV  H ++RV IN  KTIVF
Sbjct: 250 HGLTPEQLVAIGQDIEARVLARAVTWHAERRVIINGGKTIVF 291


>gi|329115224|ref|ZP_08243979.1| Formyltetrahydrofolate deformylase [Acetobacter pomorum DM001]
 gi|326695667|gb|EGE47353.1| Formyltetrahydrofolate deformylase [Acetobacter pomorum DM001]
          Length = 281

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 184/280 (65%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT +CP    I + +   L+ +G +I +  QF++  +  LFMR++F  N      +A+
Sbjct: 3   FILTFSCPDQPGIVAAVTSVLAERGADITETHQFSNRKSGTLFMRLAF--NAPAPGNLAE 60

Query: 64  ----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P+ Q+F ++  + +     + +I+VS+ DH L +LLY+  +G L  +IV +VSN
Sbjct: 61  INTILAPVAQRFDMKMRLHDAAMLPRIIIMVSRFDHALLNLLYQVRVGWLKADIVAIVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT      E   +P+Y  P+T+QNK E E KL  +I++   +L++LARYMQ+LSD L  +
Sbjct: 121 HTDSAATAEQAGIPYYCWPVTKQNKAEQEDKLRALIKETKADLVVLARYMQVLSDSLSAE 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+  RVTH 
Sbjct: 181 LSGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIEQETARVTHN 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++EDYIA G+ +E++VL +AV  H++ RV IN  +T+VF
Sbjct: 241 LSVEDYIATGRGVESQVLARAVKMHVEHRVMINGHRTVVF 280


>gi|184201462|ref|YP_001855669.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
 gi|183581692|dbj|BAG30163.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
          Length = 290

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 184/279 (65%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR---ISFVFNTCMKLF 60
           ++LT  CP    + S +   L+ QGC+I D+  F+D   ++ F+R   IS       +  
Sbjct: 11  HVLTAHCPEAYGLVSAVASNLTGQGCDIFDVKHFSDRHDNEFFIRCHTISAPGTVTTESL 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +  F+P+ ++  +++ +   +  T+ L++VS+  HCL DLL+R ++G+L + IV VVSNH
Sbjct: 71  VEGFRPVAEKHGMRFRLVEARRKTRVLVMVSKISHCLADLLHRAHVGSLPVEIVAVVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T  + LV+ Y +PF+++P+T   K ++E +L+ +++ ++ EL++LARYMQILSD L   +
Sbjct: 131 TDLRPLVDFYGVPFHHVPVTPDTKAQAEAELLRLVDAHDTELVVLARYMQILSDELTRSL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QAYE GVK++GATAHY   +LD GPII QDV+ V HA 
Sbjct: 191 AGRCINIHHSFLPSFKGAKPYHQAYERGVKMVGATAHYVTPDLDEGPIIAQDVIPVDHAH 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D ++ G + EA+ L++AV  H + RV I+  +TIV 
Sbjct: 251 TPADLVSAGSDAEAQTLSRAVRWHAEGRVVISGNRTIVL 289


>gi|317402315|gb|EFV82892.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans C54]
          Length = 284

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 179/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKL 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F          
Sbjct: 4   NDYILTLSCPDRTGIVFRVSGLLFESGCNILDSQQFGDEETGRFFLRVHFDLPAGAAPDA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +  ++ ++  + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDEMAAEYGMELQLHDARRKERLLIMVSKQGHCLNDLLFRVHSGQLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP+T   K E E++++ ++++  ++L++LARYMQILS  +C  
Sbjct: 124 HNDYASLAASYGIPFHHLPVTPDTKAEQERQVLALVDRYEIDLVVLARYMQILSADMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAH+   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHFVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAQDLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|293189946|ref|ZP_06608626.1| formyltetrahydrofolate deformylase [Actinomyces odontolyticus
           F0309]
 gi|292821165|gb|EFF80112.1| formyltetrahydrofolate deformylase [Actinomyces odontolyticus
           F0309]
          Length = 294

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 176/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 15  AQLVVTLSCPDRPGIVHAVTGVIGGSGGNVIQSQQFGDSDTGTFFMRVEVDSPKGRAPID 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F+  Y + +     +T+I+VS+  HCL DLLYR     + ++++ VV NH 
Sbjct: 75  EGLARVAEEFAATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGMPIDVIAVVGNHP 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K ++E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 135 DLAPVAQFYGVPFLNIPVTKDTKAQAERQLLDLIASENVELVVLARYMQILSDEVCRAMQ 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 195 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 255 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 292


>gi|83312671|ref|YP_422935.1| formyltetrahydrofolate hydrolase [Magnetospirillum magneticum
           AMB-1]
 gi|82947512|dbj|BAE52376.1| Formyltetrahydrofolate hydrolase [Magnetospirillum magneticum
           AMB-1]
          Length = 286

 Score =  268 bits (685), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 184/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           +++LTITCP    I + +  +LST  C I + +QF D  +S+ FMRI F        M  
Sbjct: 6   AWVLTITCPDTVGIVAAVSGFLSTHDCFITEAAQFGDPLSSRFFMRIVFGAGAMTPPMAE 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  QF + + + + ++  + +ILVS+  HCLNDLL+R++ G+L + I  V+SN
Sbjct: 66  LEKLFTGVAAQFQMIWKLHDGRQKARVVILVSKFGHCLNDLLHRYHTGSLPIEIPAVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE + +P++YL + + +K+  E +++ +IE+ + +L++LARYMQILS  +C +
Sbjct: 126 HQEMRSIVEWHGIPYHYLAVDKHDKLTQENRVMEVIERADADLVVLARYMQILSTDMCVR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H 
Sbjct: 186 LQGKAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTPDLDEGPIIEQGVERVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +AIG++IE  VL +AV  H + RV +N  KT+VF
Sbjct: 246 HTPDDLVAIGRDIENVVLARAVRWHTEHRVLLNGSKTVVF 285


>gi|82408427|gb|ABB73053.1| putative 10-formyltetrahydrofolate deformylase [Arthrobacter
           globiformis]
          Length = 312

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 185/285 (64%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
           + ++LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F F+  ++   
Sbjct: 28  AEFVLTLACPERPGIVRAITTFLADRGFDIVEHQQFDDHVSGKLYLRTAFGFDQLIERDQ 87

Query: 60  -----FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                  A+F  +  +F + +SI + +   + L++VS+  HCLNDL++RW  G+L   I 
Sbjct: 88  QTAESLTAEFAAVAGEFGMDFSIHDGR-PQRLLVMVSKFGHCLNDLIFRWRAGSLGAEIA 146

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH   + + E   LPF ++P+T   K E+E +L+ ++ + + +L++LARYMQ+LSD
Sbjct: 147 VVVSNHEDLRPMAEAAGLPFIHVPVTAATKPEAEARLLELVAEYDADLVVLARYMQVLSD 206

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC ++ GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V 
Sbjct: 207 DLCRQLRGRAINIHHSFLPGFKGAKPYHQAYDRGVKMVGATAHYVTADLDEGPIIEQEVF 266

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV HA   +  + +G++ E + L++AV  H Q RV +NK +T+VF
Sbjct: 267 RVDHALDPDALVTVGRDAETQALSRAVKWHCQHRVLLNKTRTVVF 311


>gi|192360988|ref|YP_001982082.1| formyltetrahydrofolate deformylase [Cellvibrio japonicus Ueda107]
 gi|190687153|gb|ACE84831.1| formyltetrahydrofolate deformylase [Cellvibrio japonicus Ueda107]
          Length = 286

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 181/277 (65%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FIA 62
           +LT +C  ++ + + +    +T G NI + SQF D++ ++ FMR  F       L    +
Sbjct: 8   VLTFSCQDSKGLVAAVATLFATLGFNIRESSQFEDVERNRFFMRTVFECPDGYNLGQIRS 67

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F+P+ +Q+ + ++I +++   + LI VSQ  HCLN LL  W  G+L ++IVGV SNH  
Sbjct: 68  LFKPLGEQYKMDWNIFDSQSKPRVLIAVSQWGHCLNALLNSWKNGSLPIDIVGVASNHNV 127

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L E Y+LPF+YLP+T   K + E ++  +++    + ++LARYMQILSD LCHK+ G
Sbjct: 128 MRDLTEWYELPFHYLPITADTKPQQEAQVWQLLQDVQADFLVLARYMQILSDDLCHKLNG 187

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QAY+ GVK+IGATAH+   +LD GPIIEQ V RV+H  + 
Sbjct: 188 RAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHFVTADLDEGPIIEQAVERVSHVNSP 247

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           E+   IG++IEA VL +AV  H + RV +N  KT+VF
Sbjct: 248 EEMAEIGRDIEAVVLNRAVRWHAEHRVLLNGNKTVVF 284


>gi|154507743|ref|ZP_02043385.1| hypothetical protein ACTODO_00225 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797377|gb|EDN79797.1| hypothetical protein ACTODO_00225 [Actinomyces odontolyticus ATCC
           17982]
          Length = 292

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 176/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 13  AQLVVTLSCPDRPGIVHAVTGVIGGSGGNVIQSQQFGDSDTGTFFMRVEVDSPKGRAPID 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F+  Y + +     +T+I+VS+  HCL DLLYR     + ++++ VV NH 
Sbjct: 73  EGLARVAEEFAATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGMPIDVIAVVGNHP 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K ++E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 133 DLAPVAQFYGVPFLNIPVTKDTKAQAERQLLDLIATENVELVVLARYMQILSDEVCRAMQ 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 193 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 253 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 290


>gi|315606024|ref|ZP_07881055.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|315312306|gb|EFU60392.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 180
           str. F0310]
          Length = 311

 Score =  268 bits (684), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 174/278 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 32  AQLVVTLSCPDRPGIVHAVTGVIGESGGNVVQSQQFGDSDTGTFFMRVEVDSPKGRAPID 91

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F   Y + +     +T+I+VS+  HCL DLLYR     L ++++ VV NH 
Sbjct: 92  EGLAAVAEEFDATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGLPIDVIAVVGNHP 151

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K  +E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 152 DLAPVAQFYGVPFLNIPVTKDAKAHAERQLLDLIASENVELVVLARYMQILSDEVCRAME 211

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 212 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 271

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 272 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 309


>gi|220914326|ref|YP_002489635.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
 gi|219861204|gb|ACL41546.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
          Length = 298

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 176/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKLF 60
           ++LT+ CP    I   +  +L   GC+I+D  QF +      FMR+ FV    ++ + + 
Sbjct: 19  HVLTLDCPEGPGIVHAVSGFLLEHGCDIIDNKQFGERSEGHFFMRVHFVSEGDDSTLDVL 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ ++F +++ +       K LI+VS+  HCLNDLL+R  IG L +++V VVSNH
Sbjct: 79  RDSFAPVAEKFGMRWQLERQGSKRKVLIMVSKFGHCLNDLLFRARIGELPVDVVAVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             H+ LVE + +PF+++P+T   K  +E +L+ +++  +VEL++LARYMQ+LSD L  K+
Sbjct: 139 RDHQALVEWHGIPFHHIPVTADTKPAAEAELMELVDGLDVELVVLARYMQVLSDDLTRKL 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H  
Sbjct: 199 DGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNAELDEGPIISQQVVDVDHTY 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED +A G++ E K L+ AV  H + RV +   +T+V 
Sbjct: 259 GPEDLVAAGRDTECKALSNAVKWHCEGRVILQGNRTVVL 297


>gi|296134953|ref|YP_003642195.1| formyltetrahydrofolate deformylase [Thiomonas intermedia K12]
 gi|295795075|gb|ADG29865.1| formyltetrahydrofolate deformylase [Thiomonas intermedia K12]
          Length = 291

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 174/284 (61%), Gaps = 9/284 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCMKL 59
           ++LT++CP    I   +   L   GCNI+D  Q+ D DT   FMR+ F          +L
Sbjct: 8   FVLTLSCPDAPGIVHSVSGLLYQAGCNIMDSQQYGDADTGLFFMRVHFSAPEHLQDAAQL 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +  F  + ++F +Q    + +   K +I VSQ  HCLNDLLYRW  G LA++I  VVSN
Sbjct: 68  ALL-FGDVRKRFDMQAQFHDLRIRPKVVIAVSQYGHCLNDLLYRWKAGQLAMDIAAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIES----EQKLINIIEKNNVELMILARYMQILSDH 175
           HTT   L  +Y + F++LP+      E+    EQ L  +++++   L++LARYMQILS  
Sbjct: 127 HTTFADLTRSYGIEFHHLPLKAGEAAETKRAQEQALFGVMQQSGAALLVLARYMQILSAE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
            C ++ GR INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 187 FCAQLEGRAINIHHSFLPSFKGARPYAQAYARGVKLIGATAHYVTADLDEGPIIEQDVER 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  +  D  A+G+++E+ VL +AV   ++ R+  N  KT+VF
Sbjct: 247 VDHTMSAADLTAVGQDVESVVLARAVRWQVEHRILRNGHKTVVF 290


>gi|146342112|ref|YP_001207160.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. ORS278]
 gi|146194918|emb|CAL78943.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Bradyrhizobium sp. ORS278]
          Length = 287

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 183/281 (65%), Gaps = 6/281 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLF 60
           Y+LT++CP    I S +  +L+  G NILD  QF D +T   FMR+ F        +   
Sbjct: 6   YVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFGDFETGHFFMRVVFTAADLAVNLPAL 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I ++F++ + +R+     + ++LVS+ DHCL D+LYRW    L++    +VSNH
Sbjct: 66  QTGFAAIAERFAMDWQMRDRAGQRRVMLLVSKFDHCLVDILYRWRTRDLSMIPTAIVSNH 125

Query: 121 --TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
              T+  L +  ++PF+++P+T++ K + EQ ++ +++    +L++LARYMQILSD +  
Sbjct: 126 PRETYAGL-DLGEIPFHHMPVTKETKRDQEQAILKLVDDTKTDLVVLARYMQILSDEMSA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPII+QDV R++H
Sbjct: 185 SLSGRCINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTRDLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T ED +  G++IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 245 RDTPEDLVRKGRDIERRVLARAIRYHLEDRVILNGRKTVVF 285


>gi|269796086|ref|YP_003315541.1| formyltetrahydrofolate deformylase [Sanguibacter keddieii DSM
           10542]
 gi|269098271|gb|ACZ22707.1| formyltetrahydrofolate deformylase [Sanguibacter keddieii DSM
           10542]
          Length = 302

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 178/276 (64%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CP    I   +   L+  G NI +  QF D +T   FMR+        +   A 
Sbjct: 26  WVLTLSCPDRAGIVHAVAGALAEHGGNITESQQFGDPETQLFFMRVQVESTASREELDAA 85

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
              + + FS+ + +       +TL+LVS   HCLNDLL+R     L ++IVGVV NH   
Sbjct: 86  IGALAETFSMTWRLDVVGRPVRTLVLVSTAAHCLNDLLFRQRSENLPIDIVGVVGNHRDL 145

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
           + L E Y   F+++P+T+  K E+E +L+ ++ + +VEL++LARYMQILSD LC  + G+
Sbjct: 146 EPLTEFYGKEFHHIPVTKDTKAEAEARLLALVRELDVELVVLARYMQILSDDLCRDLEGQ 205

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           +INIHHSFLPSFKGA PY QA++ GVK+IGAT+H+   +LD GPIIEQDV RV H + +E
Sbjct: 206 VINIHHSFLPSFKGAKPYHQAHDRGVKLIGATSHFVTGDLDEGPIIEQDVERVDHTRKVE 265

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           D +A+G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 266 DLVALGQDVERRVLARAVRWHAEHRVLLNGHRTVIF 301


>gi|119962169|ref|YP_949510.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
 gi|119949028|gb|ABM07939.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
          Length = 299

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
            ++LT+ CP    I   +  +L   GC+I+D  QF D      FMR+ F  +   + +  
Sbjct: 19  EHVLTLDCPEGPGIVHAVSGFLLDHGCDIIDNKQFGDRAEGHFFMRVHFASDGDDSTVDQ 78

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ +++ + + +       + LI+VS+  HCLNDLL+R  IG L +++VGVVSN
Sbjct: 79  LRNAFAPVAEKYGMNWQLERQGYKRRVLIMVSKFGHCLNDLLFRARIGELPIDVVGVVSN 138

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT H+ L E + +PF+++P+T   K  +E +L+ II++ +VEL++LARYMQ+LSD L  K
Sbjct: 139 HTDHQGLAEWHGIPFFHVPVTAATKPAAEGRLLEIIDELDVELIVLARYMQVLSDDLARK 198

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 199 LDGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNGELDEGPIIAQQVVEVDHT 258

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A G++ E K L+ AV  H + R+ +N  +TIV 
Sbjct: 259 FGPDDLVAAGRDTECKALSNAVRWHCEGRIILNGNRTIVL 298


>gi|257055905|ref|YP_003133737.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
 gi|256585777|gb|ACU96910.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
          Length = 282

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 180/277 (64%), Gaps = 3/277 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR--ISFVFNTCMKLFIA 62
           ILT++CP+   I   +  YL  QGC+I++  QF+D    ++FMR  +S    T ++   A
Sbjct: 6   ILTLSCPNRTGIVRAVSGYLFEQGCDIVEHRQFDDAARDRVFMRTQVSAPGGTDIERLSA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           DF P+  +F + Y   N+    + LI+VS+  HCLNDL++RW  G+L  +IV VVSNH  
Sbjct: 66  DFAPVATEFRMTYEF-NSDRKARILIMVSKLGHCLNDLIFRWREGSLNADIVAVVSNHED 124

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + + E+  LPF+++P+T + K  +E +L+ +++   VEL++LARYMQILS+  C  + G
Sbjct: 125 LRPMAESAGLPFFHIPVTPKKKETAEARLLRLVDDYEVELVVLARYMQILSEKTCKALHG 184

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R+INIHHSFLP FKGA PY QAY+ GVK++GATAHY   ELD GPIIEQ+V+R+ H    
Sbjct: 185 RVINIHHSFLPGFKGAKPYHQAYQRGVKLVGATAHYVTPELDEGPIIEQEVIRIDHTYDP 244

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 G++ EA  L +AV  H ++RV +N   T+VF
Sbjct: 245 RALQIAGRDAEALALYRAVRWHCERRVLLNGDSTVVF 281


>gi|71275363|ref|ZP_00651649.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Dixon]
 gi|170730340|ref|YP_001775773.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M12]
 gi|71163663|gb|EAO13379.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Dixon]
 gi|167965133|gb|ACA12143.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M12]
          Length = 283

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 181/280 (64%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F       L  A+
Sbjct: 5   YILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDLADSSSL--AE 62

Query: 64  FQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            Q     + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VVSN
Sbjct: 63  LQNQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y +PF +LP+  +N+ E E +++ I+E+  ++L+ILARYMQILS  LC  
Sbjct: 123 HNEFAPLTASYGVPFQHLPVNGENRTEQEARILQIVEREQIDLVILARYMQILSPALCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H+
Sbjct: 183 LLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 243 MTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|94311174|ref|YP_584384.1| formyltetrahydrofolate deformylase [Cupriavidus metallidurans CH34]
 gi|93355026|gb|ABF09115.1| formyltetrahydrofolate hydrolase [Cupriavidus metallidurans CH34]
          Length = 288

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 119/284 (41%), Positives = 177/284 (62%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           + +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F        + 
Sbjct: 4   TGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDAFAGRFFMRVHFSAAPGGPDLA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  +VS
Sbjct: 64  ELRAAFAPVGDQFGMQWEVHDATVKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF++LP+   + + K   E ++  ++ + N++L++LARYMQ+LSD 
Sbjct: 124 NHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFEVVREQNIDLVVLARYMQVLSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ++ R
Sbjct: 184 LCRKLQGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|288960694|ref|YP_003451034.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
 gi|288913002|dbj|BAI74490.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
          Length = 287

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/283 (43%), Positives = 187/283 (66%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMK 58
           ++  +LT++CP+   I + +  YL  QGCNI +  Q++D++T + FMR+ F  V  TC+ 
Sbjct: 3   VTQAVLTLSCPNQPGIVARVSTYLFEQGCNIGEAHQYDDVETGRFFMRLVFNQVNETCLF 62

Query: 59  LFIAD-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             I + F  I   + + +++R   E  + ++LVS+ DHCL DLLYR  IG + ++I  +V
Sbjct: 63  PAIREGFAAIAATYGMDWTMRPAGEHRRVMLLVSKFDHCLADLLYRRRIGEIPMDITAIV 122

Query: 118 SNHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           SNH        ++  +PF++LP+T+ +K+E E ++  ++ +   EL++LARYMQ+LSD L
Sbjct: 123 SNHPRETYADHDFGDIPFHHLPVTKDSKLEQEAQIWRLVRETGTELIVLARYMQVLSDDL 182

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K+ G  INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R+
Sbjct: 183 SAKLAGHCINIHHSFLPGFKGAKPYHQAHKRGVKLIGATAHYVTADLDEGPIIEQDVERI 242

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  + ED +  G++IE +VL +A+  H+Q RV  N  KT+VF
Sbjct: 243 SHHDSAEDLVRKGRDIERRVLARAIAWHLQDRVIPNGHKTVVF 285


>gi|188989731|ref|YP_001901741.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167731491|emb|CAP49666.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris]
          Length = 283

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 176/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPPRTDIAQ 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +   F + + + + +   + L+LVS+  HCLNDLL+R +   L ++IV VVSN
Sbjct: 63  LEQQFSQLAASFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIVAVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP+T   + E E +L+ ++E+  V+L++LARYMQILS  LC  
Sbjct: 123 HTDFAPLAASYGIAFHHLPVTADTRAEQETQLLALVERLQVDLVVLARYMQILSPALCRA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLVRLGSDTESLVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|329847336|ref|ZP_08262364.1| formyltetrahydrofolate deformylase [Asticcacaulis biprosthecum C19]
 gi|328842399|gb|EGF91968.1| formyltetrahydrofolate deformylase [Asticcacaulis biprosthecum C19]
          Length = 297

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 180/288 (62%), Gaps = 11/288 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL----DTSKLFMRISFVFNTC- 56
           S Y+L I CP    I + +  YL+    +I++ +QFND     D   +F  +  VF    
Sbjct: 10  SHYVLIIKCPDTRGIVAAVSGYLNDNDISIVESNQFNDAHRSEDRGDMFY-VRVVFKQAG 68

Query: 57  -----MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLAL 111
                M+     F+PI  +FS+ + + N     + LI VS+  HCL +LL+RW  G L +
Sbjct: 69  PKTPPMETLRDGFKPIAHRFSMDWQVFNLSHKPRVLIAVSKFGHCLYELLHRWKAGLLPV 128

Query: 112 NIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            I GV+SNH   +  VE   +PF YLP+ +QNK E E   +++I+++  +L++LARYMQI
Sbjct: 129 EITGVMSNHEDMRSFVEWNDIPFVYLPVNKQNKDEQESAFLSLIDRHQADLVVLARYMQI 188

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LSD L  ++ GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ
Sbjct: 189 LSDDLARRLQGRCINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQ 248

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           DV RV H  T E  + IG++IE++VL +AV  H ++RV IN  KT+VF
Sbjct: 249 DVQRVHHGLTPEQLVVIGRDIESRVLARAVTWHAERRVIINGGKTVVF 296


>gi|320591949|gb|EFX04388.1| formyltetrahydrofolate deformylase [Grosmannia clavigera kw1407]
          Length = 316

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 182/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           ++ILT++CP    I   +   L+ Q  N+LD+ QF+D  +   FMR+ F  +        
Sbjct: 37  THILTLSCPDRPGIVHAVTGILAAQKLNVLDLQQFSDRASETFFMRVHFGPSEVDSTAAL 96

Query: 63  D--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           D  F  + + FS+ Y IR+     + LI+VS+  HCLNDLL+R   G L + +  VVSNH
Sbjct: 97  DEPFAQLARDFSMTYDIRSVARKVRVLIMVSKIGHCLNDLLFRMRTGQLHVEVPLVVSNH 156

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                LV +Y + F +LP+T+ +K   E++++ +I ++N+EL++LARYMQ+LS  LC  M
Sbjct: 157 GEFADLVRSYGIDFAHLPVTKDSKAAQEERILELITEHNIELVVLARYMQVLSPKLCQVM 216

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H+ 
Sbjct: 217 SGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHSM 276

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  +  G N+E++VL  AV  + +++VF+N  KT+VF
Sbjct: 277 SPKALVDEGSNVESQVLAAAVKWYAERKVFLNGTKTVVF 315


>gi|302383240|ref|YP_003819063.1| formyltetrahydrofolate deformylase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193868|gb|ADL01440.1| formyltetrahydrofolate deformylase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 286

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 179/279 (64%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFI 61
           ++T++C     + + +   L  +G NI++  QFND D  + FMR+ F  +     +    
Sbjct: 6   VVTLSCDDQPGLVAKVAGLLFERGANIIEAQQFNDQDAGRFFMRVLFALDDDGIELPALK 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A F P+ +  ++ +S+R+T E  K L+LVS+ DHCL DLLYR   G L +++VG+VSNH 
Sbjct: 66  AAFTPLAESHAMTWSMRSTTERRKVLLLVSKFDHCLGDLLYRNRTGELPMDVVGIVSNHP 125

Query: 122 THKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               L+      PF++LP+T++ K E E ++  I+E+   EL++LARYMQ+LSD L   +
Sbjct: 126 REALLISLIGDAPFHHLPVTKETKSEQEARIKQIVEETGAELVVLARYMQVLSDDLSAYL 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLP FKGA PY QA+  GVK IGATAHY   +LD GPII QDV  VTHA 
Sbjct: 186 SGRCINIHHSFLPGFKGAKPYHQAHARGVKSIGATAHYVTADLDEGPIIAQDVEAVTHAD 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +D +  G++IE +VL +AV  H+Q RV +N  KT+VF
Sbjct: 246 RPDDLVRKGRDIERRVLARAVAFHLQDRVLLNGSKTVVF 284


>gi|260905976|ref|ZP_05914298.1| formyltetrahydrofolate deformylase [Brevibacterium linens BL2]
          Length = 284

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 181/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TC 56
           M  Y+ T+ C     IT  +   L T G +I ++ QF+D  T +LF+RI F         
Sbjct: 1   MQDYVFTLECDERPGITHAVTGALLTHGGDIKELKQFDDQYTERLFLRIDFSLQDESQGA 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++   ADF+ I   F   + +    E  + LI+VS+ +HCLNDLL+R  +G L + I  V
Sbjct: 61  IEALRADFEGIGTDFEASWKLWPEGEKRRVLIMVSKFEHCLNDLLFRAQVGELPIEIAAV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH  H++LVE + +PF+ +P+T++ K E+E KL+ ++++  ++L++LARYMQ+LSD L
Sbjct: 121 VSNHPDHRELVEWHHIPFFRIPVTKETKPEAEAKLLELVDRFEIDLVVLARYMQVLSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             ++TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAH+   ELD GPII Q +V V
Sbjct: 181 ARELTGKAINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHFVDSELDEGPIIAQQLVEV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+   +D +A G++ E K L+ AV  H   RVF+  ++T+V 
Sbjct: 241 DHSFGPKDLVAAGRDAECKALSNAVKWHCDGRVFLAGKRTVVL 283


>gi|332285288|ref|YP_004417199.1| formyltetrahydrofolate deformylase [Pusillimonas sp. T7-7]
 gi|330429241|gb|AEC20575.1| formyltetrahydrofolate deformylase [Pusillimonas sp. T7-7]
          Length = 282

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M  YILT++CP    I   +  +L     NI+D  QF DL T + F+R+ F         
Sbjct: 1   MKDYILTLSCPDRIGIVHSVTGWLLGLHGNIIDAQQFGDLGTERFFLRVHFALPQPADTA 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F    ++F ++  I + +   + LILVS+  HCLNDLL+R + G L + I G+VS
Sbjct: 61  ELEASFAATAERFDMEAHIYDAQCKARLLILVSRQGHCLNDLLFRKHSGQLPVEIAGIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  +  + + Y +P++YLP+  + +   EQ++++I+ K  ++L++LARYMQILS++LC 
Sbjct: 121 NHKDYAAMAQAYGIPYHYLPVNAETRETQEQQILDIVAKEKIDLVVLARYMQILSNNLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H
Sbjct: 181 ALSGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTADLDEGPIIEQDIERVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   +G ++E+ VL +AV  H++ R+ +N ++T+VF
Sbjct: 241 TLESQDLTQVGSDVESLVLARAVRWHVEHRILLNGQRTVVF 281


>gi|121699986|ref|XP_001268258.1| formyltetrahydrofolate deformylase, putative [Aspergillus clavatus
           NRRL 1]
 gi|119396400|gb|EAW06832.1| formyltetrahydrofolate deformylase, putative [Aspergillus clavatus
           NRRL 1]
          Length = 285

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 182/284 (64%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M S+ILTI+CP +  I   +  +L  +  NI+D SQF D  + + FMR+ F     N  +
Sbjct: 1   MDSFILTISCPDHPGIVHAVTAFLVQRNLNIIDSSQFGDPTSKRFFMRMHFAPTEQNPAL 60

Query: 58  KL--FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P  Q   + + I    +  + LI+VS+  HCLNDLL+R + G LA+ +  
Sbjct: 61  TVDELRAAFAPTAQSLEMAFEIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQLAIEVPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF +LP+T   K E E ++++++ ++N++L++LARYMQ+LS  
Sbjct: 121 IVSNHPDFAPLAATYNVPFLHLPVTAATKQEQETRILDLVREHNIDLVVLARYMQVLSPM 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 181 LCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+ + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 VNHSLSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 284


>gi|330958762|gb|EGH59022.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 289

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 181/281 (64%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             A F+  V + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +VS
Sbjct: 68  LKAGFEAAVARDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIVS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F YLP+T+  K   E  L+ ++++   EL++LARYMQILSD LC 
Sbjct: 128 NHLDLRPMAEREGIRFIYLPVTKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLCK 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 188 QLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 VYLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 288


>gi|294338935|emb|CAZ87279.1| putative formyltetrahydrofolate deformylase PurU [Thiomonas sp.
           3As]
          Length = 291

 Score =  266 bits (680), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 174/284 (61%), Gaps = 9/284 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCMKL 59
           ++LT++CP    I   +   L   GCNI+D  Q+ D DT   FMR+ F          +L
Sbjct: 8   FVLTLSCPDAPGIVHSVSGLLYQAGCNIMDSQQYGDADTGLFFMRVHFSAPEHLQDAAQL 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +  F  + ++F +Q    + +   K +I VSQ  HCLNDLLYRW  G LA++I  VVSN
Sbjct: 68  ALL-FGDVRKRFDMQAQFHDLRIRPKVVIAVSQYGHCLNDLLYRWKAGQLAMDIAAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIES----EQKLINIIEKNNVELMILARYMQILSDH 175
           HTT   L  +Y + F++LP+      E+    EQ L  +++++   L++LARYMQILS  
Sbjct: 127 HTTFADLTRSYGIEFHHLPLKAGEAAETKRAQEQALFGVMQQSGAALLVLARYMQILSAE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
            C ++ GR INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 187 FCAQLEGRAINIHHSFLPSFKGARPYAQAYVRGVKLIGATAHYVTADLDEGPIIEQDVER 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  +  D  A+G+++E+ VL +AV   ++ R+  N  KT+VF
Sbjct: 247 VDHTMSAADLTAVGQDVESVVLARAVRWQVEHRILRNGHKTVVF 290


>gi|90420705|ref|ZP_01228611.1| formyltetrahydrofolate deformylase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334996|gb|EAS48757.1| formyltetrahydrofolate deformylase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 300

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 113/279 (40%), Positives = 188/279 (67%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           ++ILT++C     I + +   L+  G NI + +QF D  T + F+RI+F           
Sbjct: 21  AFILTLSCSDQPGIVAAVTTELADAGANIAESAQFWDRQTGRFFLRIAFTAPAAASRDAL 80

Query: 63  DFQ--PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           + Q  P+  +F ++ +I +     K +++VS+ DH L  LLY+  +G L   +V +VSNH
Sbjct: 81  ERQLAPVAARFDMKLAITDEARVPKIILMVSKFDHALLHLLYQIRVGWLRAEVVAIVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++  ++  +PF++ P+T + K E E++++ ++  ++ +L++LARYMQ+LSD+L  ++
Sbjct: 141 EDSRRTADHEGVPFHHWPVTRETKAEQEERVLKLVRDSDADLVVLARYMQVLSDNLSRRL 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G++INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RV+HA 
Sbjct: 201 SGKVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQETERVSHAM 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D++A+G+++E++VL +AV  H+++RV IN  +T+VF
Sbjct: 261 SPDDFVAVGRDVESRVLARAVKMHLERRVIINDHRTVVF 299


>gi|256831930|ref|YP_003160657.1| formyltetrahydrofolate deformylase [Jonesia denitrificans DSM
           20603]
 gi|256685461|gb|ACV08354.1| formyltetrahydrofolate deformylase [Jonesia denitrificans DSM
           20603]
          Length = 286

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 175/276 (63%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CP    I   +   ++  G NI +  QF D DT   FMR+           +A 
Sbjct: 10  WVLTLSCPDRPGIVRAVAGAIADHGGNITESKQFGDPDTGLFFMRVQGETTIARDTLLAT 69

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             P+ +QF   +++        T+I+VS+  H LNDLL++     L + +V VV NH   
Sbjct: 70  LTPLAEQFEWTWNLDTVGRRIPTIIMVSKAAHALNDLLFQQRAARLPIEVVAVVGNHNDL 129

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L   Y +PF+++P+T   K ++E +L+ +++    EL++LARYMQ+LSD LC  + GR
Sbjct: 130 ADLATFYGVPFHHIPVTADTKPQAEAELLALVQSTGAELVVLARYMQVLSDTLCRALEGR 189

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           +INIHHSFLPSFKGA PY +A++ GVK+IGAT+HY   +LD GPIIEQD+ RV H  ++E
Sbjct: 190 VINIHHSFLPSFKGARPYHRAHDRGVKLIGATSHYVTADLDEGPIIEQDIDRVDHEMSVE 249

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++IA+G+++E +VL++AV  H Q RV +N  KT+VF
Sbjct: 250 EFIALGQDVERRVLSRAVAWHAQHRVLMNGHKTVVF 285


>gi|28198933|ref|NP_779247.1| formyltetrahydrofolate deformylase [Xylella fastidiosa Temecula1]
 gi|182681642|ref|YP_001829802.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M23]
 gi|28057031|gb|AAO28896.1| formyltetrahydrofolate deformylase [Xylella fastidiosa Temecula1]
 gi|182631752|gb|ACB92528.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M23]
 gi|307580079|gb|ADN64048.1| formyltetrahydrofolate deformylase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 283

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/280 (45%), Positives = 180/280 (64%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F       L  A+
Sbjct: 5   YILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDVADSSSL--AE 62

Query: 64  FQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            Q     + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VVSN
Sbjct: 63  LQNQISILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y +PF +LP+   N+ E E ++I ++E+  ++L+ILARYMQILS  LC  
Sbjct: 123 HNEFAPLTASYGVPFQHLPVNADNRTEQEARIIQMVEREQIDLVILARYMQILSPALCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H+
Sbjct: 183 LLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 243 MTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|258541648|ref|YP_003187081.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632726|dbj|BAH98701.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635783|dbj|BAI01752.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638838|dbj|BAI04800.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641892|dbj|BAI07847.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644947|dbj|BAI10895.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648002|dbj|BAI13943.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651055|dbj|BAI16989.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654046|dbj|BAI19973.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 301

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 183/280 (65%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT +CP    I + +   L+ +G +I +  QF++ ++  LFMR++F  N      +A+
Sbjct: 23  FILTFSCPDQPGIVAAVTSVLAERGADITETHQFSNRESGTLFMRLAF--NAPAPGGLAE 80

Query: 64  ----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P+ ++F +   + +     + +I+VS+ DH L +LLY+  +G L  +IV +VSN
Sbjct: 81  INDVLAPVAKRFGMNMRLHDAAVLPRIIIMVSRFDHALLNLLYQVRVGWLKADIVAIVSN 140

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT      E   +P+Y  P+ +QNK E E KL  +I++   +L++LARYMQ+LSD L  +
Sbjct: 141 HTDSAATAEQAGIPYYCWPVNKQNKAEQEDKLRALIKETKADLVVLARYMQVLSDSLSAE 200

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+  RVTH 
Sbjct: 201 LSGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIEQETARVTHN 260

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++EDYIA G+ +E++VL +AV  H++ RV IN  +T+VF
Sbjct: 261 LSVEDYIATGRGVESQVLARAVKMHVEHRVMINGHRTVVF 300


>gi|115397175|ref|XP_001214179.1| formyltetrahydrofolate deformylase [Aspergillus terreus NIH2624]
 gi|114192370|gb|EAU34070.1| formyltetrahydrofolate deformylase [Aspergillus terreus NIH2624]
          Length = 284

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 180/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M S+ILT++CP    I   +  +L     NI+D SQF D  + + FMR+ F   +  K  
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVQHNLNIIDSSQFGDPTSQRFFMRVHFKAESSEKPS 60

Query: 61  IAD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + D    F+      S+ + +    + T+ LI+VS+  HCLNDLL+R + G LA+ I  +
Sbjct: 61  VEDLRKAFESTATDLSMDFQVVPAAQKTRVLIMVSKIGHCLNDLLFRQSTGQLAIEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     L   Y +PF +LP+T   K + E +++ +I ++N++L++LARYMQ+LS  L
Sbjct: 121 VSNHPEFAALAATYNIPFVHLPVTADTKPQQEAQVLELIREHNIDLVVLARYMQVLSPTL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVRV
Sbjct: 181 CEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 NHSMSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 283


>gi|310791431|gb|EFQ26958.1| formyltetrahydrofolate deformylase [Glomerella graminicola M1.001]
          Length = 287

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 180/279 (64%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           +ILT++CP    I   +    + Q  NILD+ QF+D  + K FMR+ F        +   
Sbjct: 8   HILTLSCPDKSGIVHAVTGVFAAQKLNILDLQQFSDPVSEKFFMRVHFGPTETESTEHLK 67

Query: 62  ADFQPIVQQFSLQ-YSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F  +     L  Y IR      +TLI+VS+  HCLNDLL+R   G L ++I  +VSNH
Sbjct: 68  APFDALAADLQLDWYRIRPVARKLRTLIMVSKIGHCLNDLLFRAKSGQLPIDIPLIVSNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L  NY + F++LP+T+  K + E++++ ++++N++EL++LARYMQ+LS  LC  M
Sbjct: 128 NEFQGLAGNYGIDFHHLPVTKDTKTQQEEEILRLVKENDIELIVLARYMQVLSPKLCEAM 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ + RV H  
Sbjct: 188 SGKIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRIARVDHGM 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D +  G NIE++VL  AV    + RVF+NK KT+VF
Sbjct: 248 SPKDLVEEGSNIESQVLAAAVKWTAEGRVFLNKTKTVVF 286


>gi|325961656|ref|YP_004239562.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323467743|gb|ADX71428.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 298

 Score =  266 bits (679), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 178/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LT+ C  +  I   +  +L   GC+I+D  QF +      FMR+ F  +   + +   
Sbjct: 19  HVLTLDCSESPGIVHAVSGFLLEHGCDIIDNQQFGERSEGHFFMRVHFASDGDASTVDTL 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F P+ ++F +++ +       K LI+VS+  HCLNDLL+R  IG L +++V VVSNH
Sbjct: 79  RAAFGPVAERFGMRWRLERQGSKRKVLIMVSKFGHCLNDLLFRARIGELPMDVVAVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T H+ LVE + +PF+++P+T + K  +E +L+ ++++ +VEL++LARYMQ+LSD+L  K+
Sbjct: 139 TDHQALVEWHGIPFFHVPVTPETKPAAEARLLELVDEFDVELVVLARYMQVLSDNLTRKL 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q  V V H  
Sbjct: 199 DGKAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNAELDEGPIIAQQTVEVNHTY 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED +A G++ E K L+ AV  H + RV +   +T+V 
Sbjct: 259 GPEDLVAAGRDTECKALSNAVRWHCEGRVILQGNRTVVL 297


>gi|306818362|ref|ZP_07452088.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35239]
 gi|304648871|gb|EFM46170.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35239]
          Length = 319

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 175/275 (63%), Gaps = 1/275 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S    +  +      
Sbjct: 45  VLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDVPS-RETVETRV 103

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           Q + Q + + +S+       +T+I+VS+  HCL+DLLYR     L +++  VV NH    
Sbjct: 104 QELAQTYDMNWSLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHPDLS 163

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM GRI
Sbjct: 164 PIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMGGRI 223

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T   
Sbjct: 224 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLTTAA 283

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 284 MQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 318


>gi|308176491|ref|YP_003915897.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307743954|emb|CBT74926.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 280

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 178/279 (63%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ YI+T++C     I   I   L   GCNI +  QF   +T   FMRI       +   
Sbjct: 1   MNQYIVTLSCIDRPGIVHAISGGLLGAGCNITESQQFLSPETGTFFMRIEVATEQSLAQI 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A   PI   F +   + +  + T+T+I+ S+  H LNDLL+    GTLA+++  +VSNH
Sbjct: 61  RAGLAPIRDDFHMSLRVDDGAKRTRTMIMCSKAGHALNDLLFAQRAGTLAIDVPVIVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K + + Y + F +LP+T++NK ++E +L+ + E   +EL++LARYMQILSD LC +M
Sbjct: 121 LDLKPMADFYGVDFVHLPVTKENKSQAEAELLKLAEDYGIELVVLARYMQILSDSLCERM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPII+Q+V  V+H +
Sbjct: 181 EGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIDQEVTHVSHTR 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  + +G+++E + LT+AV  H + RV ++ ++TIVF
Sbjct: 241 TAEQLVELGRSVEGRTLTRAVQWHAEHRVMLDGQRTIVF 279


>gi|148554079|ref|YP_001261661.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
 gi|148499269|gb|ABQ67523.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
          Length = 284

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLF 60
           ++ILT++C  +  I + +   L+  G NIL+  QF+DL T + FMR+ F  V    +   
Sbjct: 4   THILTLSCVDHPGIVAAVSTSLARHGANILEAQQFDDLLTGRFFMRVEFALVGGATIGQL 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F P+     L +  R + E  K L+L S+ DHCL DLLYRW IG LA+  VG+ SNH
Sbjct: 64  AAGFAPVAADHGLDHRFRASAERKKVLLLASKFDHCLADLLYRWKIGELAMEPVGIASNH 123

Query: 121 --TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
              T+  L +   +PF++LP+   +K   E  +  I+E+   EL++LARYMQILSD L  
Sbjct: 124 PRETYAHL-DFGDIPFHFLPVGRDSKAAQEASIKAIVEETGAELVVLARYMQILSDDLAA 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQD  RV+H
Sbjct: 183 FLAGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTADLDEGPIIEQDTERVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T +D +  G++IE +VL  AV A ++ RV +N   T+VF
Sbjct: 243 RDTPDDLVRKGRDIERRVLASAVRAVLEDRVLMNGATTVVF 283


>gi|184201794|ref|YP_001856001.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
 gi|183582024|dbj|BAG30495.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
          Length = 302

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 177/279 (63%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL----F 60
           +LT+ CP    I   +   L   G NI++++Q++D      FMR+         L     
Sbjct: 23  VLTLDCPEQPGIVHAVSGVLLEHGANIVELTQYDDRRVGHFFMRVHMAPTEGAALDQQSL 82

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             D  P+ ++F +++ +       + L++VS+  HCLNDLL+R   G L + IV VVSNH
Sbjct: 83  REDLTPVAERFGMRWELHEHGAKRRVLVMVSKFGHCLNDLLFRARTGELPVEIVAVVSNH 142

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             H++LVE + +PF+++P+T+  K E+E +L++++++  V+L++LARYMQ+LSD L  +M
Sbjct: 143 LDHQRLVEWHGIPFFHVPVTKDTKPEAEARLLDLVDRFEVDLVVLARYMQVLSDSLATRM 202

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSFKGA PY QAY+ GVK +GATAHY   ELD GPII Q VV V HA 
Sbjct: 203 EGRVINIHHSFLPSFKGAKPYHQAYDRGVKTVGATAHYVNAELDEGPIITQQVVEVNHAY 262

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED +A G++ E K L+ AV  H + RV ++  KT+V 
Sbjct: 263 GPEDLVAAGRDTECKALSDAVRWHCEGRVILHGAKTVVL 301


>gi|166713950|ref|ZP_02245157.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 283

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 176/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDIAA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VVSN
Sbjct: 63  LQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   +   E +L+ ++++  ++L++LARYMQILS H+C  
Sbjct: 123 HTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQIDLVVLARYMQILSPHVCGA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|289614542|emb|CBI58715.1| unnamed protein product [Sordaria macrospora]
          Length = 286

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           +ILT++CP    I   +    + +G NILD+ QF+D  + K FMR+ F        +  +
Sbjct: 8   HILTLSCPDKPGIVHAVTGVFAQKGHNILDLQQFSDPVSEKFFMRVHFGPTPTPSTEHLM 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +  ++ ++Y IR   + T+ LI+VS+  HCLNDLL+R   G L ++I  +VSNH 
Sbjct: 68  EPFNKLAAEYQMEYKIRPVSQKTRVLIMVSKIGHCLNDLLFRAKTGQLPIDIPLIVSNHP 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + L ++Y + F++LP+T++ K + E +++ + +++ +EL++LARYMQ+LS  LC  M+
Sbjct: 128 TFEPLAQSYGIEFHHLPVTKETKAQQEGQILELAKQHGIELIVLARYMQVLSPTLCEAMS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+  
Sbjct: 188 GRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHSMG 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +  G N+E++VL  AV  + +QR+F+N  KT+VF
Sbjct: 248 PNVLVDEGSNVESQVLAAAVKWYAEQRLFLNNGKTVVF 285


>gi|227875095|ref|ZP_03993240.1| Formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35243]
 gi|307701463|ref|ZP_07638482.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris FB024-16]
 gi|227844373|gb|EEJ54537.1| Formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35243]
 gi|307613373|gb|EFN92623.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris FB024-16]
          Length = 319

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/275 (45%), Positives = 175/275 (63%), Gaps = 1/275 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S    +  +      
Sbjct: 45  VLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDVPS-RETVETRV 103

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           Q + Q + + +S+       +T+I+VS+  HCL+DLLYR     L +++  VV NH    
Sbjct: 104 QELAQTYDMNWSLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHPDLS 163

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM GRI
Sbjct: 164 PIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMGGRI 223

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T   
Sbjct: 224 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLTTAA 283

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 284 MQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 318


>gi|289664439|ref|ZP_06486020.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668087|ref|ZP_06489162.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 289

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 174/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 9   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTEIAA 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VVSN
Sbjct: 69  LEQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y +PF++LP++   +   E +L+ +++   ++L++LARYMQILS  LC  
Sbjct: 129 HTDFAALAASYGIPFHHLPVSADTRAAQEAQLLTLVDDLQIDLVVLARYMQILSPELCRA 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 189 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D I +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 249 MTPRDLIRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|21229788|ref|NP_635705.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766665|ref|YP_241427.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21111282|gb|AAM39629.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66571997|gb|AAY47407.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 289

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 176/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 9   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPPRTDIAQ 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +   F + + + + +   + L+LVS+  HCLNDLL+R +   L ++IV VVSN
Sbjct: 69  LEQQFSQLAAGFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIVAVVSN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   + E E +L+ ++E+  V+L++LARYMQILS  LC  
Sbjct: 129 HTDFAPLAASYGIAFHHLPVSADTRAEQETQLLALVERLQVDLVVLARYMQILSPALCRA 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 189 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 249 MTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|296130345|ref|YP_003637595.1| formyltetrahydrofolate deformylase [Cellulomonas flavigena DSM
           20109]
 gi|296022160|gb|ADG75396.1| formyltetrahydrofolate deformylase [Cellulomonas flavigena DSM
           20109]
          Length = 288

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 178/275 (64%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I + +   L+  G NI +  QF D  +   FMR+    +        D 
Sbjct: 13  VLTLSCPDRPGIVAAVAGLLAQHGGNITESQQFGDPLSGLFFMRVQVTTDAGADALREDL 72

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           Q +  +F + + +       +TL++VS   HCLNDL +R     L +++V VVSNH   +
Sbjct: 73  QALAVRFEMTWRLDVVGRPLRTLVMVSTAAHCLNDLAFRQRSENLPVDLVAVVSNHDVLR 132

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + + Y +PF+++P+T   K  +E +L+ ++E+ +VEL++LARYMQILSD LC ++ GR+
Sbjct: 133 PMADFYDIPFHHVPVTAATKAAAEARLLELVEELDVELVVLARYMQILSDELCRRLEGRV 192

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV HA  +ED
Sbjct: 193 INIHHSFLPSFKGARPYAQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVERVDHAHAVED 252

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +A+G+++E + L +AV  H + RV ++ R+TIVF
Sbjct: 253 LVALGQDVERRALARAVRWHAEHRVLMDGRRTIVF 287


>gi|15838429|ref|NP_299117.1| formyltetrahydrofolate deformylase [Xylella fastidiosa 9a5c]
 gi|9106913|gb|AAF84637.1|AE004004_8 formyltetrahydrofolate deformylase [Xylella fastidiosa 9a5c]
          Length = 283

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 178/280 (63%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT++CP    +   I   L   GCNILD  QF D ++   F+R+ F       L  A 
Sbjct: 5   YILTLSCPDCTGLVYRISGELFRAGCNILDAQQFGDKESHLFFLRVHFDVADSSSL--AQ 62

Query: 64  FQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            Q     + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VVSN
Sbjct: 63  LQDQINILAEAYAMQWQLHDARRGSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y +PF +LP+   N+ E E +++ ++E+  ++L+ILARYMQILS  LC  
Sbjct: 123 HNDFAPLTASYGVPFQHLPVNADNRTEQEARILQMVEREQIDLVILARYMQILSPALCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H+
Sbjct: 183 LLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 243 MTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|302417080|ref|XP_003006371.1| Formyl transferase [Verticillium albo-atrum VaMs.102]
 gi|261353973|gb|EEY16401.1| Formyl transferase [Verticillium albo-atrum VaMs.102]
          Length = 283

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 129/280 (46%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + +ILT++CP    I   +    + Q  NILD+ QF+D  + K FMR+ F          
Sbjct: 3   NDHILTLSCPDKPGIVHAVTGIFAEQNLNILDLQQFSDPVSEKFFMRVHFGPTPSESTAH 62

Query: 62  AD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            D  F  +     ++Y IR   +  + LI+VS+  HCLNDLL+R   G L + +  +VSN
Sbjct: 63  LDEPFGALAADLKMEYDIRPVAKKLRVLIMVSKIGHCLNDLLFRTKAGQLNIEVPLIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   ++L  NY + F +LP+T+  K E EQK++++I+++++EL++LARYMQ+LS  LC  
Sbjct: 123 HPEFQQLAGNYGIGFKHLPVTKDTKAEQEQKILDLIKEHDIELVVLARYMQVLSPRLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 183 MSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVSRVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++ +  G N+E++VL  AV    + RVF+NK KT+VF
Sbjct: 243 LNPKELVEEGANVESQVLAAAVKWTAEGRVFLNKTKTVVF 282


>gi|58583965|ref|YP_202981.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428559|gb|AAW77596.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 289

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 175/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 9   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDIAA 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VVSN
Sbjct: 69  LQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   +   E +L+ ++++   +L++LARYMQILS H+C  
Sbjct: 129 HTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQTDLVVLARYMQILSPHVCRA 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 189 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 249 MTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 288


>gi|23016265|ref|ZP_00056023.1| COG0788: Formyltetrahydrofolate hydrolase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 286

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 184/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           +++LTITCP    I + +  +LST  C I + +QF D  +S+ FMRI F        M  
Sbjct: 6   AWVLTITCPDTVGIVAAVSGFLSTHDCFITEAAQFGDPLSSRFFMRIVFGAGAMTPPMAE 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + ++F + + + + ++  + +IL S+  HCLNDLL+R++ G+L + I  V+SN
Sbjct: 66  LEKLFTGVAERFQMIWKLHDCRKKARVVILASKFGHCLNDLLHRYHTGSLPIEIPAVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE + +P++YL + + +K+  E +++ +IE+ + +L++LARYMQILS  +C +
Sbjct: 126 HQDMRSIVEWHGIPYHYLAVDKHDKLTQENRVMEVIERADADLVVLARYMQILSTDMCVR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H 
Sbjct: 186 LQGKAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTPDLDEGPIIEQGVERVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +AIG++IE  VL +AV  H + RV +N  KT+VF
Sbjct: 246 HTPDDLVAIGRDIENVVLARAVRWHTEHRVLLNGSKTVVF 285


>gi|84625749|ref|YP_453121.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84369689|dbj|BAE70847.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 283

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 175/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDIAA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VVSN
Sbjct: 63  LQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   +   E +L+ ++++   +L++LARYMQILS H+C  
Sbjct: 123 HTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQTDLVVLARYMQILSPHVCRA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|167585445|ref|ZP_02377833.1| formyltetrahydrofolate deformylase [Burkholderia ubonensis Bu]
          Length = 294

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 120/288 (41%), Positives = 183/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F  N        
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFDQNGSGADVAA 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  TLDALRAQFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKDFYQLAASYDIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  +C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSQDMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|73541898|ref|YP_296418.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
 gi|72119311|gb|AAZ61574.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
          Length = 288

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 177/284 (62%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           + +ILT++CP    I   +   L   GCNI+D  Q+ D  T + FMR+ F  +     + 
Sbjct: 4   TGFILTLSCPDQPGIVHSVSGLLFQHGCNIVDSDQYGDEFTGRFFMRVHFTPSAGGPDLD 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  +VS
Sbjct: 64  ALKAAFAPVGDQFGMQWELFDASAKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF +LP+   + + K   E ++  ++   N++L++LARYMQ+LSD 
Sbjct: 124 NHRDFYQLAASYDVPFIHLPLMNASAEQKAAQEARVFEVVRDQNIDLVVLARYMQVLSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ++ R
Sbjct: 184 LCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQEIAR 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   +   ++G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPDQLTSVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|254293265|ref|YP_003059288.1| formyltetrahydrofolate deformylase [Hirschia baltica ATCC 49814]
 gi|254041796|gb|ACT58591.1| formyltetrahydrofolate deformylase [Hirschia baltica ATCC 49814]
          Length = 289

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 184/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           S+IL ++C  +  + S +  +LS +   I + + F D  T   F R+ F+  +       
Sbjct: 9   SFILRLSCKDSIGLVSEVARFLSDRRLFITESANFGDPATGLFFYRVKFIPESNAFSRSN 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F ++F+P+ +++ + + +R+ K     +ILVS+ DHCLNDLLYR   G L +NI  ++SN
Sbjct: 69  FSSEFEPVAKKWGMDWELRDAKVKPNVVILVSKGDHCLNDLLYRHRTGALNINISAIISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T   L E + +P+Y++P+ + NK ++E++++++IE    +L++LARYMQ+LSD +C K
Sbjct: 129 HLTCGWLAERHDVPYYHVPVNKDNKPQAEERMLDVIEDVKADLVVLARYMQVLSDDMCRK 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA++ GVK++GATAHY   +LD GPII Q V    H 
Sbjct: 189 LEGRCINIHHSFLPSFKGAKPYHQAFDRGVKLVGATAHYVTPDLDEGPIISQAVEPADHR 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED  A+G++ EA+VL +AV  H + R+F N+ KT+VF
Sbjct: 249 LTAEDMAALGRDTEARVLARAVKLHTEGRIFSNQNKTVVF 288


>gi|297559391|ref|YP_003678365.1| formyltetrahydrofolate deformylase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843839|gb|ADH65859.1| formyltetrahydrofolate deformylase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 295

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 124/289 (42%), Positives = 181/289 (62%), Gaps = 13/289 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----------- 52
           Y+LT++CP +  I + + + LS  GCNI +  Q+ D  T + F+R+ FV           
Sbjct: 6   YVLTLSCPDSRGIVAAVANLLSDHGCNITESQQYGDHYTGRFFLRMQFVAERGGDGVVGE 65

Query: 53  --FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
                       DF        +++++       + +++VS+  HCLNDLLYR   G L 
Sbjct: 66  DVLRGAFAALAGDFGGRGGDAFVEWTLNPRDVRPRMIVMVSKFGHCLNDLLYRQRSGLLD 125

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQ 170
            +I  VVSNH   + L ++Y + F++LP+T  +K E E +L+ +++  +V+L++LARYMQ
Sbjct: 126 ADIAAVVSNHPDLEFLADSYGVDFHHLPVTAGSKKEQEARLLELVDSYDVDLVVLARYMQ 185

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           +LS+ LC KM+GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIE
Sbjct: 186 VLSEQLCAKMSGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIE 245

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           Q+V RV H  + E   AIG+++E+  L +AVN H Q+RV +N  KT++F
Sbjct: 246 QEVSRVDHTHSPEQLTAIGRDLESVALARAVNWHAQRRVLLNGDKTVIF 294


>gi|320094409|ref|ZP_08026192.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|319978655|gb|EFW10215.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 284

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 169/278 (60%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +LT++CP    I   +   +   G N++   QF D  T   FMR+            
Sbjct: 5   AQLVLTLSCPDRPGIVHAVTGVIGAAGGNVIQSQQFGDPGTGTFFMRVEVDSPAGRAPVE 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                  +QFS  Y +       +T+I+VS+  HCL DLLYR     L + +V VV NH 
Sbjct: 65  EGLADAARQFSADYRVDELGRRLRTIIMVSREGHCLTDLLYRQRTQGLPIEVVAVVGNHP 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K  +E++L++++    VEL++LARYMQILSD +C  M 
Sbjct: 125 DLAPVAQFYGVPFLNIPITKDTKARAEEQLLDLVASEKVELVVLARYMQILSDGVCRAME 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 185 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 245 TADMVALGQDVERRVLAQAVRFHAEHRVLMNGTRTVVF 282


>gi|116672241|ref|YP_833174.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116612350|gb|ABK05074.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 303

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 176/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LT+ C  +  I   +  +L   GC+I+D  QF +      FMR+ F  +   +  +  
Sbjct: 24  HVLTLDCNESPGIVHAVSGFLLEHGCDIIDNQQFGERSEGHFFMRVHFASDGDASTAETL 83

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F P+ ++F + + +       + LI+VS+  HCLNDLL+R  IG L +++V VVSNH
Sbjct: 84  RAAFAPVAERFGMSWRLEPHGSKRRVLIMVSKFGHCLNDLLFRARIGELPVDVVAVVSNH 143

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T H+ LV  + +PF+++P+T   K E+E +L+ ++++ +VEL++LARYMQ+LSD L  K+
Sbjct: 144 TDHQALVAWHGIPFFHVPVTAATKPEAEARLLELVDEFDVELVVLARYMQVLSDGLTRKL 203

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H  
Sbjct: 204 DGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNGELDEGPIIAQQVVEVDHTY 263

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED +A G++ E K L+ AV  H + RV +   +T+V 
Sbjct: 264 GPEDLVAAGRDTECKALSNAVRWHCEGRVILRGNRTVVL 302


>gi|111221742|ref|YP_712536.1| formyltetrahydrofolate hydrolase [Frankia alni ACN14a]
 gi|111149274|emb|CAJ60960.1| formyltetrahydrofolate hydrolase [Frankia alni ACN14a]
          Length = 314

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 176/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
             ++LT++CP    I + +  YL+  G NI D +QF D D+ + FMR+          ++
Sbjct: 33  GEFVLTLSCPDRLGIVAAVSAYLAGVGGNIADAAQFGDPDSGRFFMRVHVAAEEAGLTLE 92

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   F++ ++I +     + LILVS+  HCLNDLLYR   G L ++I  V S
Sbjct: 93  ALRAGFARVAHPFAMDWAIHDLAVRPRVLILVSRFGHCLNDLLYRHRSGLLDVDIPAVAS 152

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     LV +Y +PF++LP+    +   EQ +  IIE+  ++L++LARYMQILS  LC 
Sbjct: 153 NHPDFADLVGSYAIPFHHLPVDPTTRDRQEQGIREIIERERIDLVVLARYMQILSPELCA 212

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSF GA PY QA+  GVK+IGATAHY   ELD GPIIEQDV+RV H
Sbjct: 213 SLAGRAINIHHSFLPSFSGARPYHQAHARGVKLIGATAHYVTAELDDGPIIEQDVIRVDH 272

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   +   A+G+++E + L +AV  H++ RV I+ R+T+VF
Sbjct: 273 ADGPDRLAALGRDVECRALARAVTWHVEHRVLISGRRTVVF 313


>gi|92114195|ref|YP_574123.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
 gi|91797285|gb|ABE59424.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
          Length = 288

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 179/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
           SY L ++CP    I S +  Y++  G  I + +Q +DL T + FMR      +    ++ 
Sbjct: 8   SYRLIVSCPDRVGIVSRVSSYIAGHGGWITEANQHSDLVTGRFFMRYEIKAESLALDIEA 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              DF  I  +FS+++++ +T    + +++ S+  HCL DLLYRWN G L  +I  V+SN
Sbjct: 68  LRDDFAAIADEFSMEWALSDTARRKRVVLMASRASHCLVDLLYRWNAGELDCDIPCVISN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H + + LVE + +PFY++P+   +K  +  ++  ++E+   + ++LARYMQIL  +LC +
Sbjct: 128 HESLRPLVEWHGIPFYHVPVEPHDKAAAFARVEALVEEARADAVVLARYMQILPPNLCQR 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR+INIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQD+ RVTH 
Sbjct: 188 YAGRVINIHHSFLPSFAGAKPYHQAYERGVKLIGATCHYVTEELDAGPIIEQDIQRVTHC 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D + +G+++E  VL + +  H+Q RV I+  KT+VF
Sbjct: 248 HTADDLVRLGRDVEKAVLARGLRWHLQDRVLIHGNKTVVF 287


>gi|2500006|sp|Q46339|PURU_CORS1 RecName: Full=Formyltetrahydrofolate deformylase; AltName:
           Full=Formyl-FH(4) hydrolase
 gi|927593|gb|AAC43463.1| 10-formyltetrahydrofolate hydrolase [Corynebacterium sp.]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 119/279 (42%), Positives = 179/279 (64%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA- 62
           ++LT+ CP    I   +  +L      I+++ Q++D+   +LF+R+ F  ++   L  A 
Sbjct: 7   HVLTLQCPEGIGIVHAVTGFLVRHQRTIVELKQYDDMSAGRLFLRVDFAGDSAPDLLDAL 66

Query: 63  --DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             +F  +  +F + + +R   + TK LI+VS+ +HCL DLL+R + G L + +VGV SNH
Sbjct: 67  RSEFSEVAAKFDMDWQLRERGQKTKVLIMVSKFEHCLQDLLFRMHSGDLPIEVVGVASNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             H+ LVE Y + F+++P+++  K  +E  L+ +I++   EL++LARYMQ+LSDHL  ++
Sbjct: 127 PDHRSLVEWYGIGFHHIPISKDTKPRAEAALLELIDQTGAELVVLARYMQVLSDHLASEL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H  
Sbjct: 187 TGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHTY 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +D +A G++ E K L+ AV  H + RVF+   +T+V 
Sbjct: 247 GPQDLVAAGRDSECKALSNAVRWHCEGRVFLYGNRTVVL 285


>gi|322695316|gb|EFY87126.1| formyltetrahydrofolate deformylase [Metarhizium acridum CQMa 102]
          Length = 286

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 178/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLF 60
           YILT++CP    I   +    ++ G N+LD+ QF+D  + + FMR+ F     +   +  
Sbjct: 7   YILTLSCPDKPGIIHAVTAVFASHGHNVLDLQQFSDPVSRRFFMRVHFGPKADSITAEHL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  +   + + Y IR   +  K LI+VS+  HCLNDLL+R   G L + +  +VSNH
Sbjct: 67  AQPFGELAAAYEMTYDIRPVAQKMKVLIMVSKIGHCLNDLLFRMKTGQLKIEVPVIVSNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             +K L  +Y + F++LP+T   K + E +++ ++ ++ +EL++LARYMQ+LS  LC  M
Sbjct: 127 ADYKALAASYGIEFHHLPVTGDTKAQQEAQVLELVRRHGIELVVLARYMQVLSPTLCEAM 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H+ 
Sbjct: 187 SGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHSM 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++ +  G N+E++VL  AV  +  +RVF+N  KT+VF
Sbjct: 247 DPKELVEEGSNVESQVLAAAVRWYADRRVFLNGSKTVVF 285


>gi|298487427|ref|ZP_07005473.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158046|gb|EFH99120.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 288

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKTGFDVVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD L  +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLYKQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHF 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 248 YLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|269977870|ref|ZP_06184826.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris 28-1]
 gi|269933950|gb|EEZ90528.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris 28-1]
          Length = 291

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 175/275 (63%), Gaps = 1/275 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S    +  +      
Sbjct: 17  VLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDVPS-RETVETRV 75

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           Q + Q + + +++       +T+I+VS+  HCL+DLLYR     L +++  VV NH    
Sbjct: 76  QELAQTYDMNWNLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHPDLS 135

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM GRI
Sbjct: 136 PIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMGGRI 195

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T   
Sbjct: 196 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLTTAA 255

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 256 MQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 290


>gi|302527129|ref|ZP_07279471.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
 gi|302436024|gb|EFL07840.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
          Length = 281

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 181/284 (63%), Gaps = 9/284 (3%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ + LT+ CP    I   +  +L + GC+I++  QF+D    +LF+R  F   TC    
Sbjct: 1   MTQFTLTLHCPERSGIVHAVTTFLVSNGCDIVEHQQFDDDVHGELFLRTEF---TCAGPA 57

Query: 61  IAD-----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             D     F  + + ++++Y   + +   + L++VS+  HCLNDLL+RW  G L   I  
Sbjct: 58  TVDDLTREFDLVARDYAMRYRFSD-RTPDRLLVMVSKAGHCLNDLLFRWRAGALGAEIAL 116

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V SNH   + + E   LPF ++P+T  +K E+EQ+L++++ +++++L++LARYMQ+LSD 
Sbjct: 117 VASNHEDLRPMAEAAGLPFVHIPVTPASKPEAEQRLLDLVREHDIDLVVLARYMQVLSDE 176

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLP FKGA PY QAY+ GVK +GATAHY   ELD GPIIEQ+V R
Sbjct: 177 LCQKLQGRAINIHHSFLPGFKGAKPYAQAYDRGVKYVGATAHYVTPELDEGPIIEQEVQR 236

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+ +      +G++ EA  L++AV  H ++RV +N  +T+VF
Sbjct: 237 VDHSHSPRALATVGRDAEALALSRAVRWHCERRVLLNGNRTVVF 280


>gi|254283107|ref|ZP_04958075.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
 gi|219679310|gb|EED35659.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
          Length = 282

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCM 57
           M SYIL+ +CP    + +     L+  G  I ++S + D  T + F+R  F     N  M
Sbjct: 1   MRSYILSFSCPDRLGVVARYSSLLADAGAFITEVSNYTDPVTERFFLRCVFDDRALNVTM 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 +Q +  + +  + +R + +  + ++ VS  DHCL+ LL +W  G L   IVGVV
Sbjct: 61  DTLSQRWQAVADELNATWVLRASDDLPRIVLAVSAQDHCLSALLTKWRAGALPAEIVGVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE + LPFYYLP+T++ K + EQ+++++  + + EL++LARYMQILSD LC
Sbjct: 121 SNHELSRGLVEWHGLPFYYLPVTKETKPQQEQEILSVFSELDGELLVLARYMQILSDGLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY +A+E GVK+IGATAHY   +LD GPII Q+V  + 
Sbjct: 181 QELAGRAINIHHSFLPGFKGAKPYHRAWERGVKVIGATAHYVTADLDEGPIITQEVRPID 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+E  I +G+++EA  L++AV  H +QRV +N ++T++ 
Sbjct: 241 HETTVERMIHLGQDVEANALSQAVRLHCEQRVLLNGQRTVIL 282


>gi|134101035|ref|YP_001106696.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291009540|ref|ZP_06567513.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133913658|emb|CAM03771.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 282

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 179/279 (64%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           S+ILT++CP+   I   +  YL   GC+I +  QF+D    +LF+R        + L   
Sbjct: 4   SFILTLSCPNRTGIVRAVSAYLFEHGCDIGEYQQFDDSVRDRLFLRTQVNAGREIDLDAM 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI   F + ++  +T+ A + L++VS+  HCLNDL++RW  G+L  +IV VVSNH
Sbjct: 64  ARGFEPIAADFEMTFTFSDTRNA-RMLVMVSKLGHCLNDLIFRWRAGSLGADIVAVVSNH 122

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   LPF ++P+T + K E+E +L+ ++++ + EL++LARYMQ+LSD  C  +
Sbjct: 123 EDLRPMAEGAGLPFIHVPVTPETKPEAEARLLQLVDEYDAELVVLARYMQVLSDQACKAL 182

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V+R+ H  
Sbjct: 183 HGRAINIHHSFLPGFKGAKPYHQAYDRGVKLVGATAHYVTPDLDEGPIIEQEVIRIDHTY 242

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  +G++ EA  L++AV  H ++RV +N   T+VF
Sbjct: 243 HPTALQTVGRDAEALALSRAVRWHCERRVLLNGHSTVVF 281


>gi|194290105|ref|YP_002006012.1| formyltetrahydrofolate deformylase [Cupriavidus taiwanensis LMG
           19424]
 gi|193223940|emb|CAQ69949.1| Formyltetrahydrofolate deformylase [Cupriavidus taiwanensis LMG
           19424]
          Length = 288

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 177/284 (62%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           + +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F        + 
Sbjct: 4   TGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDEFAGRFFMRVHFTPAAGGPDLG 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R   G L + I  +VS
Sbjct: 64  TLKAAFAPVGDQFGMQWELNDATVKPRVMIMVSKIGHCLNDLLFRAKAGGLPVEIAAIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NH    +L  +Y +PF++LP+   + + K   E ++ +++++  ++L++LARYMQ+LSD 
Sbjct: 124 NHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFDVVQEQKIDLVVLARYMQVLSDD 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ++ R
Sbjct: 184 LCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQEIER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+   +   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 244 VDHSMDPDQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|326774120|ref|ZP_08233402.1| formyltetrahydrofolate deformylase [Actinomyces viscosus C505]
 gi|326636259|gb|EGE37163.1| formyltetrahydrofolate deformylase [Actinomyces viscosus C505]
          Length = 290

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/275 (42%), Positives = 176/275 (64%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +          D 
Sbjct: 15  VLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELEKDL 74

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH T +
Sbjct: 75  AELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHETLR 134

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + E Y +PF+++P+T++ K  +E +L+ +++  NVEL++LARYMQILS  LC ++ G +
Sbjct: 135 DVAEFYGVPFHHIPVTKETKEAAEAELLGLVDSLNVELVVLARYMQILSPALCERLHGGV 194

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  ++  
Sbjct: 195 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDSVSV 254

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 255 LQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|46130832|ref|XP_389147.1| hypothetical protein FG08971.1 [Gibberella zeae PH-1]
          Length = 283

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 180/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           +ILT++CP    I   +    +    NILD+ QF+D  + + FMR+ F        +   
Sbjct: 5   HILTLSCPDKSGIVYAVTGIFADNKHNILDLQQFSDPVSERFFMRVHFGPTETESTEHLT 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +  ++ ++Y IR     T+ LI+VS+  HCLNDLL+R   G L + +  +VSNH 
Sbjct: 65  EAFDKLAAEYKMEYDIRPVARKTRVLIMVSKIGHCLNDLLFRMKTGQLRMEVPVIVSNHP 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            +  L E+Y + F++LP+T+  K + E +++ + +K+++EL++LARYMQ+LS  LC  M+
Sbjct: 125 EYAALAESYGIEFHHLPVTKDTKAQQEGQVLELCKKHSIELIVLARYMQVLSPTLCEAMS 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ + RV HA +
Sbjct: 185 GRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRIARVDHAMS 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +D    G N+E++VL  AV  + ++R+F+N  KT+VF
Sbjct: 245 PKDLSEEGSNVESQVLAAAVRWYAEKRLFLNGHKTVVF 282


>gi|145611995|ref|XP_362425.2| hypothetical protein MGG_08008 [Magnaporthe oryzae 70-15]
 gi|145019242|gb|EDK03470.1| hypothetical protein MGG_08008 [Magnaporthe oryzae 70-15]
          Length = 284

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/277 (45%), Positives = 180/277 (64%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT++CP    I   +    +++  NILD+ QF+D  + K FMR+ F          AD
Sbjct: 7   HILTLSCPDKPGIVHAVTGIFASRSVNILDLKQFSDTGSQKFFMRVHFGPVAETADLSAD 66

Query: 64  FQPIVQQFS-LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           F  +  Q+  + + IR   + T+ LI+VS+  HCLNDLL+R   G LA+++  +VSNH  
Sbjct: 67  FSALASQYDPMTWDIRPVAQKTRVLIMVSKIGHCLNDLLFRAQSGRLAVDVALIVSNHPD 126

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  ++ + F +LP+T++ K + E++++ + ++ +VEL++LARYMQ+LS  LC  M+G
Sbjct: 127 FAPLAASHGVEFRHLPVTKETKTQQEEEILKLAKERDVELIVLARYMQVLSPTLCEAMSG 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ + RV H  T 
Sbjct: 187 RIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRISRVDHGMTP 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  +  G +IEA VL  AV    ++RVF+N  KT+VF
Sbjct: 247 KQLVDEGSSIEALVLGAAVQWFAERRVFLNNSKTVVF 283


>gi|301632060|ref|XP_002945109.1| PREDICTED: formyltetrahydrofolate deformylase-like [Xenopus
           (Silurana) tropicalis]
          Length = 282

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 177/281 (62%), Gaps = 7/281 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK---- 58
           +Y+LT++CP    +   +  +L   GCNI + +Q+ND  T   FMR+ F    C +    
Sbjct: 4   TYVLTLSCPDRLGLVHAVSGFLLEHGCNIEEAAQYNDQATGLFFMRVQFA---CGQHDGP 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                  P  +   +++S+ +  E  +T+++VS+  HCLNDLL+R   G L ++I  ++S
Sbjct: 61  ALKGQLAPFAEGLQMRWSLHSRAETMRTVLMVSREGHCLNDLLFRVKSGLLPIDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++ ++   K ++E +   IIE    EL++LARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIAVSRDTKAQAEARQYEIIEAEGAELVVLARYMQVLSNDLCV 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 RLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  + G++ E+ VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTSRGRDTESLVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|90425638|ref|YP_534008.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB18]
 gi|90107652|gb|ABD89689.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB18]
          Length = 287

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 184/283 (65%), Gaps = 10/283 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           ++LT++CP    I S +  +L   G NILD  QF+D +T + FMR+  VFN       + 
Sbjct: 6   FVLTLSCPDLPGIVSAVSTFLFDNGQNILDAQQFDDTETGQFFMRV--VFNAAQTRVTLP 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F P+ ++F +++ +R+     + L+LVS+ DHCL DLLYRW  G L +    V+S
Sbjct: 64  VLRELFIPVAERFMMRWQMRDRGNRRRVLLLVSKSDHCLVDLLYRWRTGELEMTPTAVIS 123

Query: 119 NH--TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           NH   T++ L +  ++PF+YLP++++ + + E  +  +I     +L++LARYMQ+LSD +
Sbjct: 124 NHPRDTYEGL-DFGEVPFHYLPVSKETRRQQETAISGVIAHTKTDLVVLARYMQVLSDEM 182

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             ++ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY    LD GPII+QDV R+
Sbjct: 183 SGRLAGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTGTLDEGPIIDQDVERI 242

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H    ED +  G++IE +VL +A+  H++ RV +N +KT+VF
Sbjct: 243 SHRDRPEDLVRKGRDIERRVLARAIRYHLEDRVILNGKKTVVF 285


>gi|256397828|ref|YP_003119392.1| formyltetrahydrofolate deformylase [Catenulispora acidiphila DSM
           44928]
 gi|256364054|gb|ACU77551.1| formyltetrahydrofolate deformylase [Catenulispora acidiphila DSM
           44928]
          Length = 294

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 181/283 (63%), Gaps = 6/283 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTC-MKLF 60
           ++LT++CP    +   + +YL   GC ILD  Q+ D D+   FMR+SF  V +   ++  
Sbjct: 12  WVLTLSCPDTPGVVHGVANYLLMTGCTILDSQQYGDPDSGLFFMRVSFERVHDAVTLEQL 71

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F+ +   F + + I +  E    +++VS+  HCLNDLL+R + G L + I  VVSNH
Sbjct: 72  NSSFEAVGATFRMAWRIHDANELMPVVLMVSKFGHCLNDLLFRASTGALPVRIAAVVSNH 131

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQK---LINIIEKNNVELMILARYMQILSDHLC 177
           +  ++L  +Y + F +LP+   +     +    L+ ++E   VEL++LARYMQ+L+D +C
Sbjct: 132 SDFEELTRSYGVDFVHLPVAAGDAEGKAKAEAALLEVVESRGVELVVLARYMQVLTDEVC 191

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 192 KALEGRMINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVARVG 251

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  T E  +A+G+++E +VL +AV  H + RV +N ++T+VFP
Sbjct: 252 HGVTPEQLVAVGRDVECQVLARAVKWHAEHRVLLNGKRTVVFP 294


>gi|78045889|ref|YP_362064.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927349|ref|ZP_08188602.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|325928591|ref|ZP_08189776.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|78034319|emb|CAJ21964.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325541024|gb|EGD12581.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|325542272|gb|EGD13761.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
          Length = 283

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 174/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDIAA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  QF + + + + +   + L+LVS+  HCLNDLL+R +   L ++I  VVSN
Sbjct: 63  LEQRFAVLADQFQMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIAAVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   +   E +L+ +++   ++L++LARYMQILS  LC  
Sbjct: 123 HTDFAPLAASYGIAFHHLPVSADTRAAQEAQLLALVDDLQIDLVVLARYMQILSPQLCRA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D I +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLIRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|319782725|ref|YP_004142201.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168613|gb|ADV12151.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 293

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 182/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           +ILT++C     I + +   L+  G NI + SQF D  T++ FMRI+F+    +      
Sbjct: 16  HILTLSCEDRPGIVAAVTAELAANGANIAESSQFWDRQTNRFFMRIAFISPPGSTGDSLA 75

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +  V +F ++ ++ +     K +++VS+ DH L  LLY+  +G L   +  VVSNH 
Sbjct: 76  RALESSVDRFGMKTALVDQGRRPKIIVMVSKFDHALLHLLYQIRVGWLNAEVAAVVSNHE 135

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++  E   +P+++ P T++NK E EQKL++++++   EL+ILARYMQ+ S  L  ++ 
Sbjct: 136 DARRFAELEGIPYHHWPTTKENKAEQEQKLLDLVQRTGAELVILARYMQVFSKGLSDRLF 195

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPII+Q+  RVTHA +
Sbjct: 196 GRAINIHHSFLPSFKGAKPYHQAFDRGVKLIGATAHYVTSDLDEGPIIDQETERVTHAMS 255

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A+G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 256 AEDFVAVGRDIESRVLARAVKLHLEARVMLNGHKTVVF 293


>gi|254480116|ref|ZP_05093364.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
 gi|214039678|gb|EEB80337.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
          Length = 286

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 179/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           + YIL  TCP+   I + +  +L+ +GC I ++S F+D   + LFMR  F  +      +
Sbjct: 5   TEYILKATCPAARGIVAGVSGFLAERGCYISELSHFDDRQNANLFMRTRFHIDNGDATQE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +FQ +  +FS+ + I    +  +TLI+VSQ DHCLNDLLYR   G L + I  VVS
Sbjct: 65  SNQEEFQAVADKFSMDWQIIPVSQTVRTLIMVSQYDHCLNDLLYRLRKGELNIEITAVVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE   + F +LP+T+  K + E +L+ IIE+ + EL+ LARYMQILSD LC 
Sbjct: 125 NHQGLRPMVEREGIRFIHLPVTKDTKPQQEVRLLEIIEETDSELITLARYMQILSDTLCT 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++G++INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPI+ Q V  V H
Sbjct: 185 ELSGKVINIHHSFLPSFKGAKPYHQAFHRGVKLIGATAHYVTGDLDEGPILSQAVQEVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T E  +A+G++ E + L  AV  H + R F++  KTI+F
Sbjct: 245 TYTPEMLVAVGRDTETQALATAVKLHTEHRTFLDSNKTIIF 285


>gi|254522129|ref|ZP_05134184.1| formyltetrahydrofolate deformylase [Stenotrophomonas sp. SKA14]
 gi|219719720|gb|EED38245.1| formyltetrahydrofolate deformylase [Stenotrophomonas sp. SKA14]
          Length = 283

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/277 (42%), Positives = 173/277 (62%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +  + L     
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDASLPLDTVHA 65

Query: 65  QPIVQ--QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
                   + + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMAALAADYGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+    +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAPLAASYQVPFHHLPVNADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMAP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|325068203|ref|ZP_08126876.1| formyltetrahydrofolate deformylase [Actinomyces oris K20]
          Length = 290

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/275 (42%), Positives = 176/275 (64%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +          D 
Sbjct: 15  VLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELEKDL 74

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH T +
Sbjct: 75  AELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHETLR 134

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + E Y +PF+++P+T++ K  +E +L+ +++  NVEL++LARYMQILS  LC ++ G +
Sbjct: 135 DVAEFYGVPFHHIPVTKETKEAAETELLRLVDSLNVELVVLARYMQILSPALCERLHGGV 194

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  ++  
Sbjct: 195 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDSVSV 254

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 255 LQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|302896088|ref|XP_003046924.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727852|gb|EEU41211.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 283

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 183/280 (65%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           + +ILT++CP    I   +    ++   NILD+ QF+D  + + FMR+ F        + 
Sbjct: 3   NDHILTLSCPDKSGIVHAVTGIFASHKHNILDLQQFSDPVSDRFFMRVHFGPTETESTEH 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +  F  +  ++ + Y IR      + LI+VS+  HCLNDLL+R   G L + +  +VSN
Sbjct: 63  LVEPFDKLAAEYKMDYDIRPVARKMRVLIMVSKIGHCLNDLLFRMKTGQLRIEVPVIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L ++Y + F++LP+T+  K E E +++++++++N+EL++LARYMQ+LS  LC  
Sbjct: 123 HPDYAPLAQSYGIEFHHLPVTKDTKAEQESQVLDLVKQHNIELVVLARYMQVLSPTLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 183 MSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++    G N+E++VL  AV  + ++R+F+NK KT+VF
Sbjct: 243 MNPKELSEEGSNVESQVLAAAVRWYAERRLFLNKTKTVVF 282


>gi|284991334|ref|YP_003409888.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
 gi|284064579|gb|ADB75517.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
          Length = 283

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 184/279 (65%), Gaps = 4/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLF 60
           +ILT++CP    I   +  +L   GC+I++  QF+D     LF+R   V  T     +  
Sbjct: 5   FILTLSCPQRPGIVHAVTSFLFGHGCDIVEHQQFDDPLRGALFLRTEVVKVTGEADAEHL 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F+ + ++F + +++ + +   + L++VS+  HCLNDL++RW  G+L   +V VVSNH
Sbjct: 65  ASAFKEVAEEFGMSFTLSDDR-PQRVLVMVSRMGHCLNDLIFRWRAGSLNAELVAVVSNH 123

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   LPFY++P+T ++K ++EQ+++ I++++  E+++LARYMQ+LSD+LC K+
Sbjct: 124 EDLRPMAEAAGLPFYHVPVTPESKPQAEQRMLEIVDQHRAEVVVLARYMQVLSDNLCLKL 183

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QA++ GVK++GATAHY    LD GPIIEQ+V+R+ H  
Sbjct: 184 LGRAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTPTLDEGPIIEQEVIRIDHTY 243

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  +G++ EA  L +AV  H ++RV +N+R T+VF
Sbjct: 244 DPRALTTVGRDAEALALARAVRWHSERRVLLNERSTVVF 282


>gi|91781734|ref|YP_556940.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
 gi|91685688|gb|ABE28888.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
          Length = 289

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 180/283 (63%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  ++ 
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLEA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRASFATLAEQFGMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIAAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLMGATPEAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|145230533|ref|XP_001389575.1| formyltetrahydrofolate deformylase [Aspergillus niger CBS 513.88]
 gi|134055693|emb|CAK44067.1| unnamed protein product [Aspergillus niger]
          Length = 283

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 178/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           SYILT++CP    I   +  YL  Q  NI+D SQ+ D  + + FMR+ F   +     + 
Sbjct: 2   SYILTLSCPDRPGIVHAVTAYLVQQNLNIIDSSQYGDPTSQRFFMRVHFKDESSPAKSLD 61

Query: 63  D----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           D    FQP  +  ++ + +       + LI+VS+  HCLNDLL+R + G L + I  +VS
Sbjct: 62  DLRTAFQPTAESLTMTFQLVPASSKPRVLIMVSKIGHCLNDLLFRASTGQLPIEIPLIVS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   Y +PF +LP+T   K + E +++ +I ++N++L++LARYMQ+LS  LC 
Sbjct: 122 NHPDFATLAATYNIPFLHLPVTADTKPQQEGRILELIREHNIDLVVLARYMQVLSPMLCE 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGA PY QA++ GVKI+GATAH+   +LD GPIIEQ+VVRV H
Sbjct: 182 AMSGKIINIHHSFLPSFKGAKPYHQAFDRGVKIVGATAHFVTSDLDEGPIIEQNVVRVNH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 242 AMSPKELTHAGSNVESNVLATAVKYFAERRVLLNGHKTVVF 282


>gi|161523714|ref|YP_001578726.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189351522|ref|YP_001947150.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221200007|ref|ZP_03573050.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
 gi|221206838|ref|ZP_03579850.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|221211214|ref|ZP_03584193.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|160341143|gb|ABX14229.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189335544|dbj|BAG44614.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221168575|gb|EEE01043.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|221173493|gb|EEE05928.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|221180246|gb|EEE12650.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
          Length = 294

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERNSNILDSAQFGDSRTGEFFMRVHFEQDGAGRDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     DF P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRDDFAPLAEQFAMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++++I+++  +L++LARYMQI
Sbjct: 126 IVSNHKDFYQLAASYDIPFHHFPLVGGSSDAAKAAQEARVLDVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|294627533|ref|ZP_06706116.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667832|ref|ZP_06733042.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598164|gb|EFF42318.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602458|gb|EFF45899.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 283

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 174/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPAKTDIAA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VVSN
Sbjct: 63  LEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   +   E +L+ +++   ++L++LARYMQILS  LC  
Sbjct: 123 HTDFAALAGSYGIAFHHLPVSADTRAAQEAQLLALVDALQIDLVVLARYMQILSPQLCRA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G +IE+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLVRLGSDIESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|71898535|ref|ZP_00680706.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Ann-1]
 gi|71731659|gb|EAO33719.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Ann-1]
          Length = 283

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 179/280 (63%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F       L  A+
Sbjct: 5   YILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDVADSSSL--AE 62

Query: 64  FQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            Q     + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VVSN
Sbjct: 63  LQNQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y +PF +LP+   N+ E E +++ ++E+  ++L+ILARYMQILS  LC  
Sbjct: 123 HNEFAPLTASYGVPFQHLPVNADNRTEQEARILQMVEREQIDLVILARYMQILSPALCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHS LPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H+
Sbjct: 183 LLGRAINIHHSLLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + IG ++E+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 243 MTAHDLVRIGSDVESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|21241098|ref|NP_640680.1| formyltetrahydrofolate deformylase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21106396|gb|AAM35216.1| formyltetrahydrofolate deformylase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 283

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 174/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +  
Sbjct: 3   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPAKTDIAA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L ++I  V SN
Sbjct: 63  LEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCLNDLLFRAHSRQLRVDIAAVASN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT    L  +Y + F++LP++   + E E +L+ +++   ++L++LARYMQILS  LC  
Sbjct: 123 HTDFAALAGSYGIAFHHLPVSADTRAEQEAQLLALVDALQIDLVVLARYMQILSPQLCRA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA
Sbjct: 183 LAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 243 MTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|320532698|ref|ZP_08033490.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|320135087|gb|EFW27243.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 171
           str. F0337]
          Length = 290

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 176/275 (64%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +          D 
Sbjct: 15  VLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELEKDL 74

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH T +
Sbjct: 75  AELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHETLR 134

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + E Y +PF+++P+T++ K  +E +L+ +++  +VEL++LARYMQILS  LC ++ G +
Sbjct: 135 DVAEFYGVPFHHIPVTKETKEAAEAELLGLVDSLDVELVVLARYMQILSPTLCERLHGGV 194

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  ++  
Sbjct: 195 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDSVSM 254

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 255 LQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|16263619|ref|NP_436412.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
 gi|14524328|gb|AAK65824.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
          Length = 286

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFI 61
           ++LT+TC     I + +   L   G NI++ SQ+ D  T++ FMRI+F     T   L  
Sbjct: 8   FVLTLTCDDRAGIVAAVTSQLHVLGANIVESSQYWDRATNRFFMRIAFNPSGETSADLIE 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               P++ QF +Q  + + ++  K +I++S+ DH    LLY+  +G L   +V V+SNH 
Sbjct: 68  RGLAPVLGQFEMQGRLIDCRKPQKIVIMISRFDHAFLHLLYQIRVGWLDAEVVAVISNHD 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++      +P+++LP+  +NK + E ++  I+++   +L++LARYMQ+ SD +  ++ 
Sbjct: 128 DSRETAAWAGIPYHFLPINRENKKKQEDRIFAIVQETEADLVVLARYMQVFSDDIAGRLF 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G++INIHHSFLPSFKGA PY QA+E+GVK+IGATAHY   +LD GPIIEQ+  RV+HA +
Sbjct: 188 GKVINIHHSFLPSFKGARPYHQAHEHGVKLIGATAHYVTADLDEGPIIEQETERVSHAMS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED++A G++IE++VL +AV  H++ RV +N RKT+VF
Sbjct: 248 VEDFVAAGRDIESRVLARAVKRHLEARVMLNGRKTVVF 285


>gi|78067580|ref|YP_370349.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
 gi|77968325|gb|ABB09705.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
          Length = 294

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       T
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGADAAT 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRREFAPLAEQFAMRWEMHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS +LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNLCKQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRVVLNGTKTVVF 293


>gi|119472136|ref|XP_001258279.1| formyltetrahydrofolate deformylase, putative [Neosartorya fischeri
           NRRL 181]
 gi|119406431|gb|EAW16382.1| formyltetrahydrofolate deformylase, putative [Neosartorya fischeri
           NRRL 181]
          Length = 292

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 183/291 (62%), Gaps = 12/291 (4%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--- 57
           M S+ILT++CP    I   +  +L  +  NI+D SQF D  + + FMR+ F  +      
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA 60

Query: 58  -----KLFI----ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGT 108
                KL +    A F+P  +  ++ ++I    +  + LI+VS+  HCLNDLL+R + G 
Sbjct: 61  TDEHPKLSVEELRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ 120

Query: 109 LALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARY 168
           LA+ +  +VSNH     L   Y +PF +LP+T   K + E +++ ++ ++ ++L++LARY
Sbjct: 121 LAIEVPLIVSNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY 180

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQ+LS  LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPI
Sbjct: 181 MQVLSPMLCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI 240

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQ+VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 291


>gi|58040501|ref|YP_192465.1| formyltetrahydrofolate deformylase [Gluconobacter oxydans 621H]
 gi|58002915|gb|AAW61809.1| Formyltetrahydrofolate deformylase [Gluconobacter oxydans 621H]
          Length = 292

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           ++Y+LT++CP+   I + I   L+    NI +  QF+D D++  FMRI F      T M+
Sbjct: 9   TTYVLTLSCPNRPGIVAAISGRLAELNANITEAQQFDDRDSTVFFMRIVFEITDGQTSMQ 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   + + FS+ +++ +     K L++VS+ DHCL DLLYRW IG L +  VG+VS
Sbjct: 69  QLREALAVLGETFSMDWALHDRSVKPKVLLMVSRFDHCLVDLLYRWRIGELPIEPVGIVS 128

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++ Y +PF+YLP+T+  K   E +++++      EL+ILARYMQ+LS+ + 
Sbjct: 129 NHPREVFADLDFYGIPFHYLPVTKDTKPAQEAQILDLFAATGAELVILARYMQVLSNEMA 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             ++G  INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 189 ASLSGHCINIHHSFLPGFKGARPYHQAFARGVKLIGATAHYVTRDLDEGPIIEQDVERIS 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T +D I  G++IE +VL +AV  HI++R  IN  +T+VF
Sbjct: 249 HADTPDDLIRKGRDIERRVLARAVRYHIERRTIINGNRTVVF 290


>gi|307295747|ref|ZP_07575580.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
 gi|306878403|gb|EFN09624.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
          Length = 285

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKLFIA 62
           Y L ++CP    I S +   L + G NI +  QF+D +T K FMR+   F     + F +
Sbjct: 5   YYLKLSCPDRPGIVSAVSTALFSAGANISEAQQFDDPETGKFFMRVVARFVEGDAESFRS 64

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F+    +F + +S+R   +  K + LVS+ DHCL  LLY   IG + +++V ++SNH  
Sbjct: 65  AFEATAGRFGMDWSLRAASQRRKVVALVSKFDHCLGHLLYASRIGEIDMDVVAIISNHPK 124

Query: 123 HKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            K  ++++   +P++Y P+T   K E E ++   I     EL+ILARYMQILSD L   +
Sbjct: 125 EKLTIKSWLEDIPYHYFPVTADTKAEQEARIKETISATGAELVILARYMQILSDDLASYL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V+HA 
Sbjct: 185 SGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEPVSHAD 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED +  G++IE +VL++AV  HIQ RVFIN  KT+VF
Sbjct: 245 TPEDLVRKGRSIEQRVLSQAVLHHIQDRVFINANKTVVF 283


>gi|162146964|ref|YP_001601425.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785541|emb|CAP55112.1| putative formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 309

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 178/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           +S+ +T++CP+   I + I   L     NI +  QF+D++T   FMR+ F   T    + 
Sbjct: 26  ASFTVTLSCPNRPGIVAAIATTLYEADGNITEAQQFDDVETGLFFMRVVFSIRTDGERLD 85

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    + ++F + +++ +     + L++VS+ DHCL DLLYRW IG L +    +V+
Sbjct: 86  WLRARLGAVAERFHMNWTLHDRAVRRRVLLMVSKFDHCLADLLYRWRIGELPMTPTAIVA 145

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PF++LP+T  NK E E++L  ++ + N EL++LARYMQ+LSD L 
Sbjct: 146 NHPRAAYGHIDMADIPFHHLPVTRDNKAEQEERLWTLVRQTNSELVVLARYMQVLSDSLT 205

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 206 ARLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQDVERVS 265

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 266 HFDTPADLVRKGRDIERRVLARAVRYHLDDRVILNGNKTVVF 307


>gi|326386724|ref|ZP_08208345.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208777|gb|EGD59573.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 284

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 180/279 (64%), Gaps = 6/279 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA-- 62
           ILT++C     I S +   L   G NIL+  QF+D  +   FMR+  V +   +  +A  
Sbjct: 6   ILTLSCKDRPGIVSGVTGKLFESGANILEAQQFDDALSGNFFMRV--VLDPGAQGVVALR 63

Query: 63  -DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+P+ ++F++ + +R++    + +++VS+ DHCL DLLYR  IG LA+++V ++ NH 
Sbjct: 64  EAFRPVAEEFAMDWRLRDSGLRRRVILMVSRFDHCLGDLLYRARIGELAMDVVAIIGNHP 123

Query: 122 THKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                V  +  +P+Y+LP+T   K   E ++  I+E+   EL++LARYMQILSD + H +
Sbjct: 124 REALSVPLWSDIPYYHLPVTAATKPAQEAEIKRIVEETGAELVVLARYMQILSDDMTHYL 183

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  VTHA 
Sbjct: 184 SGRCINIHHSFLPSFKGAKPYHQAFARGVKMIGATAHYVTADLDEGPIIHQDVESVTHAD 243

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +D +  G++IE +VL +AV  H++ R  +N  KT+VF
Sbjct: 244 TPDDLVRKGRDIERRVLAEAVRLHLEDRALLNGHKTVVF 282


>gi|167917513|ref|ZP_02504604.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           BCC215]
          Length = 293

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGATAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP+      +     E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|325923741|ref|ZP_08185359.1| formyltetrahydrofolate deformylase [Xanthomonas gardneri ATCC
           19865]
 gi|325545779|gb|EGD17015.1| formyltetrahydrofolate deformylase [Xanthomonas gardneri ATCC
           19865]
          Length = 304

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/282 (43%), Positives = 174/282 (61%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F  N      I
Sbjct: 24  SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHF--NKPQATEI 81

Query: 62  AD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A     F  +  +F +Q+ + + +   + L+LVS+  HCLNDLL+R +   L ++I  VV
Sbjct: 82  AGLERRFALLADEFQMQWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIAAVV 141

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y + F++LP++   +   E +L+ ++E   ++L++LARYMQILS  LC
Sbjct: 142 SNHADFAPLAASYGIAFHHLPVSADTRAAQEAQLLALVETLQIDLVVLARYMQILSPELC 201

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 202 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 261

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA    D + +G + E+ VL +AV  H++ RV +N  +T+VF
Sbjct: 262 HAMPPRDLVRLGSDTESLVLARAVRRHVEHRVVLNGHRTVVF 303


>gi|167561509|ref|ZP_02354425.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           EO147]
 gi|167568738|ref|ZP_02361612.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           C6786]
          Length = 293

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 184/287 (64%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +   L  +G NILD +QF D  T + FMR+ F         T 
Sbjct: 6   SFILKLSCPDRRGIVHAVSGVLFDRGSNILDSAQFGDSRTGEFFMRVHFDQAGGGDAATA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P+      +     E +++ +I++++ +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHSADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|39937092|ref|NP_949368.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           CGA009]
 gi|192292926|ref|YP_001993531.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           TIE-1]
 gi|39650950|emb|CAE29473.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           CGA009]
 gi|192286675|gb|ACF03056.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           TIE-1]
          Length = 287

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 179/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    I S +  +L   G NILD  Q+ND ++   FMR+  VFN   K+    
Sbjct: 6   YVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRV--VFNAAAKVIPLA 63

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I  +F++ + +R+ +   K ++LVSQ DHCL D+LYRW +G L +    +VS
Sbjct: 64  SLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++  +PFY+ P+ +  + + E  +  +I + + +L++LARYMQILSD + 
Sbjct: 124 NHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMS 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 184 ARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 244 HRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 285


>gi|148261747|ref|YP_001235874.1| formyltetrahydrofolate deformylase [Acidiphilium cryptum JF-5]
 gi|326405242|ref|YP_004285324.1| formyltetrahydrofolate deformylase [Acidiphilium multivorum AIU301]
 gi|146403428|gb|ABQ31955.1| formyltetrahydrofolate deformylase [Acidiphilium cryptum JF-5]
 gi|325052104|dbj|BAJ82442.1| formyltetrahydrofolate deformylase [Acidiphilium multivorum AIU301]
          Length = 283

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 180/285 (63%), Gaps = 13/285 (4%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLF 60
           S ILT++C +   I   +  +L   G +I +  QF+D  + + FMR+ F  V +      
Sbjct: 2   SSILTLSCRNRPGIVGAVGHFLHAHGQDIREAQQFDDRASGRFFMRVVFAPVGDAPSSGL 61

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A+F  + ++F + + I  +    +T+ILVS+ DHCL DL+YR  IG L ++IVGV++NH
Sbjct: 62  EAEFAAVGREFGMDWEITPSGHRMRTMILVSRFDHCLVDLVYRQRIGELPMDIVGVIANH 121

Query: 121 TTHKKLVENYQ------LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
                  E+Y       +PF++LP+    K+E E ++  ++ ++  EL ILARYMQ+LSD
Sbjct: 122 PR-----ESYAHLDLDGIPFHHLPIAPDTKMEQEAEVWRLMRESGAELAILARYMQVLSD 176

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            L  K+ GR INIHHSFLP FKGA PY QAY  GVK+IGATAHY    LD GPIIEQDV 
Sbjct: 177 GLVAKLAGRCINIHHSFLPGFKGAKPYHQAYARGVKLIGATAHYVTTALDEGPIIEQDVE 236

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R++H  T E  +  G++IE +VL +AV  H+++RVFI+  KT+VF
Sbjct: 237 RISHGDTPEALVRKGRDIERRVLARAVLGHLERRVFISGSKTVVF 281


>gi|254247195|ref|ZP_04940516.1| Formyltetrahydrofolate hydrolase [Burkholderia cenocepacia PC184]
 gi|124871971|gb|EAY63687.1| Formyltetrahydrofolate hydrolase [Burkholderia cenocepacia PC184]
          Length = 351

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 63  SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 122

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 123 ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 182

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 183 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 242

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 243 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 302

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 303 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 350


>gi|170734126|ref|YP_001766073.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
 gi|169817368|gb|ACA91951.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
          Length = 294

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSTNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|116695892|ref|YP_841468.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
 gi|113530391|emb|CAJ96738.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
          Length = 306

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 175/289 (60%), Gaps = 11/289 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--------F 53
           +SYILT++CP    I   +   L   G NI+D +QF D D+++ FMR+ F          
Sbjct: 17  ASYILTLSCPDRPGIVHAVSALLVEAGANIVDSAQFGDRDSARFFMRVHFQRPLPEGQDA 76

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +    +    +     + +S+ +     + +++VS+  HCLNDLL+R+  G L + I
Sbjct: 77  GDALAALRSTLAGVAAAHEMDWSLHDAARKPRVMLMVSRIGHCLNDLLFRYRTGQLPIEI 136

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQ 170
             +VSNH    +L  +Y +PF++LP+   T Q K   E +L +++   +++L++LARYMQ
Sbjct: 137 PAIVSNHKDFYQLAASYDIPFHHLPLLNATPQGKAAQEARLWDLVCDYSIDLVVLARYMQ 196

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           +LSD LC ++ GR INIHHSFLPSFKGA PY QAYE GVK+IGATAHY   +LD GPIIE
Sbjct: 197 VLSDDLCRRLEGRAINIHHSFLPSFKGARPYAQAYERGVKLIGATAHYVTGDLDEGPIIE 256

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           Q+V RV HA       AIG+++E   L +AV  H + RV  N  +T+VF
Sbjct: 257 QEVARVDHAMDAAQLTAIGRDVECVALARAVKWHAEHRVLRNGGRTLVF 305


>gi|22417102|gb|AAM96665.1| probable formyltetrahydrofolate deformylase [Sphingobium
           chlorophenolicum L-1]
          Length = 285

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKLFIA 62
           Y L ++CP    I S +   L + G NI +  QF+D +T K FMR+   F     + F +
Sbjct: 5   YYLKLSCPDRPGIVSAVSTALFSAGANISEAQQFDDPETGKFFMRVVARFVEGDAESFRS 64

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F+    +F + +S+R   +  K + LVS+ DHCL  LLY   IG + +++V ++SNH  
Sbjct: 65  AFEAPAGRFGMDWSLRAASQRRKVVALVSKFDHCLGHLLYASRIGEIDMDVVAIISNHPK 124

Query: 123 HKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            K  ++++   +P++Y P+T   K E E ++   I     EL+ILARYMQILSD L   +
Sbjct: 125 EKLTIKSWLEDIPYHYFPVTADTKAEQEARIKETISATGAELVILARYMQILSDDLASYL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V+HA 
Sbjct: 185 SGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEPVSHAD 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED +  G++IE +VL++AV  HIQ RVFIN  KT+VF
Sbjct: 245 TPEDLVRKGRSIEQRVLSQAVLHHIQDRVFINANKTVVF 283


>gi|206559216|ref|YP_002229977.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia J2315]
 gi|198035254|emb|CAR51129.1| putative formyltetrahydrofolate deformylase [Burkholderia
           cenocepacia J2315]
          Length = 294

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|209544029|ref|YP_002276258.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531706|gb|ACI51643.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 291

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 178/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           +S+ +T++CP+   I + I   L     NI +  QF+D++T   FMR+ F   T    + 
Sbjct: 8   ASFTVTLSCPNRPGIVAAIATTLYEADGNITEAQQFDDVETGLFFMRVVFSIRTDGERLD 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    + ++F + +++ +     + L++VS+ DHCL DLLYRW IG L +    +V+
Sbjct: 68  WLRARLGAVAERFHMNWTLHDRAVRRRVLLMVSKFDHCLADLLYRWRIGELPMTPTAIVA 127

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PF++LP+T  NK E E++L  ++ + N EL++LARYMQ+LSD L 
Sbjct: 128 NHPRAAYGHIDMADIPFHHLPVTRDNKAEQEERLWTLVRQTNSELVVLARYMQVLSDSLT 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 188 ARLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQDVERVS 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 248 HFDTPADLVRKGRDIERRVLARAVRYHLDDRVILNGNKTVVF 289


>gi|255943975|ref|XP_002562755.1| Pc20g01960 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587490|emb|CAP85525.1| Pc20g01960 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 287

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 179/284 (63%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----- 56
           +S+ILT++ P    I   +  +L     NI+D SQF D  + + FMR  F          
Sbjct: 3   ASFILTLSGPDRPGIVHAVTAFLVQNNLNIIDSSQFGDPTSQRFFMRTQFATANGEDETP 62

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F+P  Q FSL + I  + +  + LI+VS+  HCLNDLL+R + G L++ +  
Sbjct: 63  ELEKLRTAFEPTAQSFSLNFEINPSVKKPRVLIMVSKIGHCLNDLLFRQSTGQLSIEVPL 122

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF++LP+T   K + E +++ ++ ++N++L++LARYMQ+LS  
Sbjct: 123 IVSNHPDFATLAATYNIPFHHLPVTADTKAQQEAQILELVSQHNIDLIVLARYMQVLSPT 182

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 183 LCSAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 242

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 243 VNHGMSPKELTHAGSNVESNVLATAVKYVTERRVILNGHKTVVF 286


>gi|70992393|ref|XP_751045.1| formyltetrahydrofolate deformylase [Aspergillus fumigatus Af293]
 gi|66848678|gb|EAL89007.1| formyltetrahydrofolate deformylase, putative [Aspergillus fumigatus
           Af293]
 gi|159124616|gb|EDP49734.1| formyltetrahydrofolate deformylase, putative [Aspergillus fumigatus
           A1163]
          Length = 292

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/291 (42%), Positives = 183/291 (62%), Gaps = 12/291 (4%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--- 57
           M S+ILT++CP    I   +  +L  +  NI+D SQF D  + + FMR+ F  +      
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA 60

Query: 58  -----KLFIAD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGT 108
                KL + D    F+P  +  ++ ++I    +  + LI+VS+  HCLNDLL+R + G 
Sbjct: 61  TEEHPKLSVEDLRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ 120

Query: 109 LALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARY 168
           LA+ +  ++SNH     L   Y +PF +LP+T   K + E +++ ++ ++ ++L++LARY
Sbjct: 121 LAIEVPLIISNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY 180

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQ+LS  LC  ++GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPI
Sbjct: 181 MQVLSPMLCEALSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI 240

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQ+VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 291


>gi|300789373|ref|YP_003769664.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
 gi|299798887|gb|ADJ49262.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
          Length = 280

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 177/282 (62%), Gaps = 9/282 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           ++ LT+ CP    I   +  +L  QGC+I++  QF+D     LF+R SF   TC +    
Sbjct: 2   TFTLTLKCPERSGIVHAVTTFLVGQGCDIVEHQQFDDDVRGSLFLRTSF---TCTEETTV 58

Query: 63  D-----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           D     F P+   F +++   +     + L++VS+  HCLNDLL+RW  G L   I  VV
Sbjct: 59  DDLTRAFAPVAGDFGMEFGFSDGT-PPRILVMVSKFGHCLNDLLFRWRAGGLGAEIAVVV 117

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   +PF ++P+T + K E+EQ+L++++ +   +L++LARYMQ+LS+ LC
Sbjct: 118 SNHEDLRPMAEAAGVPFVHVPVTPETKPEAEQRLLDLVGEYEADLIVLARYMQVLSNELC 177

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ GR INIHHSFLP FKGA PY QAY+ GVK +GATAHY   +LD GPIIEQ+V RV 
Sbjct: 178 QKLEGRAINIHHSFLPGFKGAKPYHQAYDRGVKYVGATAHYVTPDLDEGPIIEQEVQRVD 237

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +  + + +G++ EA  L++AV  H ++RV +N   T+VF
Sbjct: 238 HTYSPRELVTVGRDAEALALSRAVRWHCERRVLLNGNSTVVF 279


>gi|107023714|ref|YP_622041.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116690801|ref|YP_836424.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
 gi|105893903|gb|ABF77068.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116648890|gb|ABK09531.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
          Length = 294

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 185/288 (64%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|171057988|ref|YP_001790337.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170775433|gb|ACB33572.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 295

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 179/291 (61%), Gaps = 15/291 (5%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL----DTSKLFMRISF-----V 52
             ++LT++CP  + I   +   L   GCNI+D  QF D+     T   FMR+ F     +
Sbjct: 6   GQFVLTLSCPDTKGIVHAVSGLLYQAGCNIIDSQQFGDVLGEDATGLFFMRVHFEAPPHL 65

Query: 53  FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
            +  M   +  F  +  QF +Q  + +     + L++VS+  HCLNDLL+RW  G L ++
Sbjct: 66  GDAAMLQNL--FSHVRSQFGMQARVHSLARKPRLLLMVSKHGHCLNDLLFRWKSGQLPVD 123

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTE----QNKIESEQKLINIIEKNNVELMILARY 168
           I  +VSNH     L  +Y + F++LP+      Q K   E+++  + E+  V+L++LARY
Sbjct: 124 IPAIVSNHPDFADLAASYGIAFHHLPLKAGADAQAKRAQEREVEALFEREQVDLVVLARY 183

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQILS   C  + GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPI
Sbjct: 184 MQILSAEFCDFLAGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPI 243

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQDV RV H  + ED+ A+G+++E+ VL +AV  H++ RV +N RKT+VF
Sbjct: 244 IEQDVERVDHTHSPEDFTAVGRDVESVVLARAVRWHVEHRVLLNGRKTVVF 294


>gi|325914432|ref|ZP_08176779.1| formyltetrahydrofolate deformylase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325539440|gb|EGD11089.1| formyltetrahydrofolate deformylase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 289

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/285 (44%), Positives = 174/285 (61%), Gaps = 12/285 (4%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F      K   
Sbjct: 9   SDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHF-----DKPPA 63

Query: 62  ADFQPIVQQFS-------LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
            D   + QQFS       + + + + +   + L+LVS+  HCLNDLL+R +   L + I 
Sbjct: 64  TDIASLEQQFSVLANTFQMDWQLHDARRRARLLVLVSKHGHCLNDLLFRTHSRQLPVEIA 123

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH     L  +Y + F++LP+T   + E E KL+ +I+   ++L++LARYMQILS 
Sbjct: 124 AVVSNHADFAPLAASYGIDFHHLPVTADTRAEQEAKLLALIDDLRIDLVVLARYMQILSP 183

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC  + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV 
Sbjct: 184 GLCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVA 243

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV HA T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 244 RVDHAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|156054848|ref|XP_001593350.1| formyltetrahydrofolate deformylase [Sclerotinia sclerotiorum 1980]
 gi|154704052|gb|EDO03791.1| formyltetrahydrofolate deformylase [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 294

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/287 (43%), Positives = 183/287 (63%), Gaps = 11/287 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC------- 56
           YILT++CP    I   +  +L+    NI+D  QF D  + + FMR+ F  +         
Sbjct: 7   YILTLSCPDRPGIVHAVTGFLTKHNLNIVDSQQFGDATSLRFFMRVHFAPSVSSSPETET 66

Query: 57  MKLFIAD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
            KL + +    F+ I Q  S+ + + +  +  + LI+VS+  HCLNDLL+R +I  L + 
Sbjct: 67  KKLNVEELKGAFETIAQDMSMDFQLDSLAKKPRVLIMVSKIGHCLNDLLFRQSISQLGIE 126

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +  +VSNH   + L   Y++PF++LP+T   K E E K++ ++++NN++L++LARYMQ+L
Sbjct: 127 VPLIVSNHPDFEPLANTYKIPFHHLPVTAATKAEQESKILELVKENNIDLIVLARYMQVL 186

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC  M+G+IINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+
Sbjct: 187 SPTLCTAMSGKIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQN 246

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           VVRV H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 247 VVRVGHGLSPKELTVEGSNVESNVLATAVKWVTERRVLLNGHKTVVF 293


>gi|325961674|ref|YP_004239580.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323467761|gb|ADX71446.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 309

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 181/281 (64%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           + Y+LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F         +
Sbjct: 29  AQYVLTLACPERPGIVRAITAFLADRGFDIVEHQQFDDHMSGKLYLRTAFTPGDKEVSAE 88

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F  +  +F ++++I + +   + L++VS+  HCLNDL++RW  G+L   I  VVS
Sbjct: 89  GLSAEFAAVADEFDMEFAIHDGR-PQRVLVMVSKFGHCLNDLIFRWRAGSLGAEIAVVVS 147

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   LPF ++P+T   K ++E +L+ ++E+ + +L++LARYMQ+LSD L  
Sbjct: 148 NHEDLRPMAEAAGLPFIHVPVTADTKPQAEARLLELVEEYDADLVVLARYMQVLSDSLSE 207

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 208 TLRGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTADLDEGPIIEQEVFRVDH 267

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +      + +G++ E++ L++AV  H Q RV +N  +T+VF
Sbjct: 268 SLDPNALVTVGRDAESQALSRAVKWHCQHRVLLNNTRTVVF 308


>gi|85375737|ref|YP_459799.1| formyltetrahydrofolate deformylase [Erythrobacter litoralis
           HTCC2594]
 gi|84788820|gb|ABC65002.1| formyltetrahydrofolate deformylase [Erythrobacter litoralis
           HTCC2594]
          Length = 284

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 176/280 (62%), Gaps = 8/280 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIAD 63
           +LT++C     IT+ +  +L   GCNIL+  QFND ++ + FMRI+F            D
Sbjct: 6   VLTLSCADRPGITANVTGFLFEHGCNILEARQFNDRESDRFFMRIAFDPLEADPDALKRD 65

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT-- 121
           F     +  + + +       + LI+VS+ DHCL DLLYRW IG L +  V +VSNH   
Sbjct: 66  FAAYADRLGMDWKLAKRDRRRRVLIMVSRFDHCLADLLYRWRIGELPIEPVAIVSNHPRE 125

Query: 122 --THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
             +H  + E   +PF++LP+T + K++ E ++  I E+ + EL++LARYMQILSD     
Sbjct: 126 AISHTHIGE---VPFHHLPVTHETKLDQEAQVRAIAEETDTELVVLARYMQILSDEQAAH 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  ++HA
Sbjct: 183 FAARCINIHHSFLPGFKGAKPYHQAHARGVKMIGATAHYVTTDLDEGPIIHQDVEPISHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  G++IE++VL +AV  H+++RV IN ++TIVF
Sbjct: 243 DSPEDLVRKGRDIESRVLAEAVRMHVEERVLINGQRTIVF 282


>gi|319944247|ref|ZP_08018523.1| formyltetrahydrofolate deformylase [Lautropia mirabilis ATCC 51599]
 gi|319742542|gb|EFV94953.1| formyltetrahydrofolate deformylase [Lautropia mirabilis ATCC 51599]
          Length = 285

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 171/276 (61%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           YILT+ CP    I   I   L   G NI + +Q+ND DT   FMR+ F            
Sbjct: 9   YILTLACPDRAGIVHTITGLLLVHGGNITEAAQYNDPDTGLFFMRVQFTSPAAPTTLRDA 68

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
            Q      SL++++        T+ILVS+  HCLNDLL+R   G L ++I  ++SNH   
Sbjct: 69  LQAAASDLSLRWNLAENGRRMPTVILVSKLGHCLNDLLFRTRAGMLPIDIRAIISNHEDF 128

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
           +  VE   +PF+++P++   +  +E + + IIE +  EL++LARYMQILSD+LC ++ GR
Sbjct: 129 RPQVEAQGIPFHHVPVSAATREAAEARQLEIIESSGAELVVLARYMQILSDNLCRQLQGR 188

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
            INIHHSFLPSFKGA PY QA++ GVKIIGATAHY   ELD GPIIEQDV RV H  T++
Sbjct: 189 AINIHHSFLPSFKGARPYYQAHDRGVKIIGATAHYVTAELDEGPIIEQDVERVDHTMTVD 248

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              A+G ++E  VL +AV  H + R+ +N  KT+VF
Sbjct: 249 TLTALGGDVENVVLARAVKWHAEHRIMLNGHKTVVF 284


>gi|296161549|ref|ZP_06844354.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
 gi|295888193|gb|EFG68006.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
          Length = 289

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 178/283 (62%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  ++ 
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLEA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRTSFATLAEQFGMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIAAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T   K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLMGATPDAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|209521308|ref|ZP_03270025.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
 gi|209498254|gb|EDZ98392.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
          Length = 314

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 181/283 (63%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 31  SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSGTGEFFMRVHFQQVGGDPGLDA 90

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G + ++I  ++SN
Sbjct: 91  LRASFSTLAEQFGMRWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQINIDIPAIISN 150

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K+  E +++ +I ++  +L++LARYMQILS +L
Sbjct: 151 HKEFYQLAASYDIPFHHFPLLGGTPEAKVAQEARVLEVINEHQADLVVLARYMQILSPNL 210

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 211 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 270

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 271 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 313


>gi|83591895|ref|YP_425647.1| formyltetrahydrofolate deformylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83574809|gb|ABC21360.1| formyltetrahydrofolate deformylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 297

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 179/279 (64%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKLF 60
           ILTITCP    + + +  +L++QG  I++ + ++D DT + FMR  F  +T     +   
Sbjct: 18  ILTITCPDGFGLVAAVSGFLNSQGAFIIEAAYYSDPDTGRFFMRTVFRSDTAGLPSLGAL 77

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ ++F + + + + +   K +I VS+  HCL DLL+RW  G L + I  +VSNH
Sbjct: 78  RECFAPVAERFEMTWDLVSAERKPKVVIAVSRFGHCLYDLLHRWQAGQLHVEIPAIVSNH 137

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               +L E + +PF++LP+T   K   E+ ++ +I+ ++ +L++LARYMQILS  +   +
Sbjct: 138 KDLARLAEWHGIPFHHLPVTTGGKEAQEEAILKVIDDSSADLVVLARYMQILSPAMSSAL 197

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY    LD GPIIEQ+V RV H  
Sbjct: 198 SGRCINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTDALDEGPIIEQEVARVDHKY 257

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++D +A G+++E  VL +AV  H+++RV IN  KT+V 
Sbjct: 258 RVDDLVAAGRDLETVVLARAVRWHVERRVMINGTKTVVL 296


>gi|159044655|ref|YP_001533449.1| formyltetrahydrofolate deformylase [Dinoroseobacter shibae DFL 12]
 gi|157912415|gb|ABV93848.1| formyltetrahydrofolate deformylase [Dinoroseobacter shibae DFL 12]
          Length = 301

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           ++L ++C +   I + +   L+ QG N+++ +QF D  + + F+R++F+    T +    
Sbjct: 23  FVLNLSCAAEPGIVAAVTTALAGQGANLVETAQFWDRQSDRFFLRVAFLGQPGTDVAGIE 82

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A   P   +F +  ++ ++    + LI+VS+ DH L  LLY+  +G L+  +V +VSNH 
Sbjct: 83  AALAPTRARFGMDVTVLDSARKPRILIMVSRFDHALLHLLYQVRVGWLSAEVVAIVSNHP 142

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++ E+  +PF+++P++   K E+E +L  ++ +   +L++LARYMQ+LSD     + 
Sbjct: 143 DARRVAEHEGVPFHHIPVSRDTKPEAEARLKALVAETGADLVVLARYMQVLSDDFSRVLA 202

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  R+TH+ T
Sbjct: 203 GRVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQEAERITHSMT 262

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +D +A+G++IE++VL +AV  H++ RV +N ++T+VF
Sbjct: 263 PDDLVAVGRDIESRVLARAVKRHLEGRVMLNGQRTVVF 300


>gi|316935593|ref|YP_004110575.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           DX-1]
 gi|315603307|gb|ADU45842.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           DX-1]
          Length = 287

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 179/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    I S +  +L   G NILD  Q+ND ++   FMR+  VFN   K+    
Sbjct: 6   YVLTLSCPDRAGIVSAVSTFLYENGQNILDAQQYNDTESGHFFMRV--VFNAAAKVIPLA 63

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I  +F++ + +R+ +   K ++LVSQ DHCL D+LYRW +G L +    +VS
Sbjct: 64  SLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++  +PF++ P+ +  + + E  +  +I + + +L++LARYMQILSD + 
Sbjct: 124 NHPRETFSGFDFGDIPFFHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMS 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 184 ARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 244 HRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 285


>gi|325294563|ref|YP_004281077.1| formyltetrahydrofolate deformylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065011|gb|ADY73018.1| formyltetrahydrofolate deformylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 284

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/278 (45%), Positives = 179/278 (64%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           IL I+CP  + I + I  +++  G NIL   Q  D      FMRI +    F    +   
Sbjct: 6   ILLISCPDRKGILAEITGFIAKHGGNILHADQHIDFQKEIFFMRIEWDLSNFEIPKEKLP 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             FQPI ++F + Y I+ + +     I VS+ DHCL +LLYR+  G L  N+  V+SNH 
Sbjct: 66  ESFQPIAEKFQMDYQIKFSSDIQNVAIFVSKYDHCLYELLYRFKAGELRGNLKFVISNHP 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K +VE Y +PFY+ P +++NK+E E+K I +++K  ++L+ILARYMQILSD   ++  
Sbjct: 126 DLKPVVEMYGVPFYHFPKSKKNKLEVEEKEIELLKKEKIDLIILARYMQILSDRFVNEFR 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GA PY +AYE GVKIIGAT+HY   ELD GPIIEQDVVRV+H  +
Sbjct: 186 NKIINIHHSFLPAFVGAKPYHRAYERGVKIIGATSHYVTEELDQGPIIEQDVVRVSHRDS 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IED I  G+++E  VL +AV  H++ ++ +   KT++F
Sbjct: 246 IEDMIRKGRDLEKLVLARAVRWHLENKILVYDNKTVIF 283


>gi|67516427|ref|XP_658099.1| hypothetical protein AN0495.2 [Aspergillus nidulans FGSC A4]
 gi|40747438|gb|EAA66594.1| hypothetical protein AN0495.2 [Aspergillus nidulans FGSC A4]
 gi|259489252|tpe|CBF89369.1| TPA: formyltetrahydrofolate deformylase, putative (AFU_orthologue;
           AFUA_6G11620) [Aspergillus nidulans FGSC A4]
          Length = 289

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT------- 55
           S+ILT++CP    I S +  +L     NI+D SQF D  + + FMR+ F  +T       
Sbjct: 2   SFILTLSCPDRPGIVSAVTGFLVQHNLNIIDSSQFGDPTSHRFFMRMHFGPDTTGASDGA 61

Query: 56  ---CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
               ++     F PI    S+ + +       + LI+VS+  HCLNDLL+R + G LA+ 
Sbjct: 62  AAPSLEALREAFTPIATAHSMSFQLLPAAHKPRVLIMVSKIGHCLNDLLFRQSTGQLAIE 121

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +  +VSNH   + L   Y++PF +LP+T   K + E +++ +I++ ++EL++LARYMQ+L
Sbjct: 122 VPLIVSNHPDFETLAATYKVPFMHLPVTADTKQQQETRILELIKEYDIELVVLARYMQVL 181

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC  M+G+IINIHHSFLPSFKGA PY QAY+ GVK++GATAH+   +LD GPIIEQ+
Sbjct: 182 SPTLCDAMSGKIINIHHSFLPSFKGAKPYHQAYDRGVKLVGATAHFVTSDLDEGPIIEQN 241

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 242 VVRVNHALSPKELTHAGSNVESNVLAAAVKYFAERRVLLNGHKTVVF 288


>gi|152967926|ref|YP_001363710.1| formyltetrahydrofolate deformylase [Kineococcus radiotolerans
           SRS30216]
 gi|151362443|gb|ABS05446.1| formyltetrahydrofolate deformylase [Kineococcus radiotolerans
           SRS30216]
          Length = 285

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 175/278 (62%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   L     NI +  QF D D+    MR++F      +   A+ 
Sbjct: 7   VLTLSCPDRPGIVHAVTGALVALDANITESQQFGDPDSGLFSMRVAFDAAASEEALRANL 66

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           + +  +F L +++    E  +TL++ S+  HCLNDLL+R   G L + I  VVSNHT   
Sbjct: 67  EVVAARFGLTWTLSAADEPMRTLVMCSKQGHCLNDLLFRHRSGGLPIEIAAVVSNHTDLA 126

Query: 125 KLVENYQLPFYYLPMTEQN---KIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
            L + Y +PF ++P+T  +   K   E +L+ ++++ +VEL++LARYMQILSD LC  ++
Sbjct: 127 PLAQFYGIPFVHVPVTTGDAASKAAGEARLLELVDELDVELVVLARYMQILSDDLCRSLS 186

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ++ RV H  T
Sbjct: 187 GRAINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTADLDEGPIIEQEIERVDHRHT 246

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + + +G+++EA+ L +AV  H +QRV ++  +T+VF
Sbjct: 247 PPELVRLGQDVEARTLARAVRWHAEQRVLLDGNRTVVF 284


>gi|307728403|ref|YP_003905627.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
 gi|307582938|gb|ADN56336.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
          Length = 289

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 179/283 (63%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  ++ 
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLEA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRASFATLAEQFGMSWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|298346648|ref|YP_003719335.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 43063]
 gi|298236709|gb|ADI67841.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 43063]
          Length = 291

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 177/275 (64%), Gaps = 1/275 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   + + G NI+  +QF DLD+   FMR+      C     +  
Sbjct: 17  VLTLSCPDQPGIVHAVSGMVVSAGGNIIQSAQFADLDSGLFFMRVEMDV-PCAHDIRSRV 75

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           + +  +F + + +     A +T+I+VS+  HCL+DLLYR    ++ +++  VV NH    
Sbjct: 76  ETLAAEFDMAWELDEIGRALRTVIMVSKEGHCLSDLLYRVRDHSIPIDVKAVVGNHPDLA 135

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +   YQ+PF  +P+T+ NK E+E++L++++    VEL++LARYMQILSD LC +M+GRI
Sbjct: 136 PIATFYQVPFILVPVTKDNKPEAERQLLDLVAAEKVELVVLARYMQILSDKLCREMSGRI 195

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H  T  D
Sbjct: 196 INIHHSFLPSFKGAKPYDQAHDRGVKLIGATAHYVTADLDEGPIIEQDVSRVDHTFTAID 255

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 256 MRKQGQDVERRVLAQAVKWHAEHRVLMNGDRTVIF 290


>gi|304389643|ref|ZP_07371605.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315655196|ref|ZP_07908097.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 51333]
 gi|315656891|ref|ZP_07909778.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|304327196|gb|EFL94432.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315490451|gb|EFU80075.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 51333]
 gi|315492846|gb|EFU82450.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 287

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 177/275 (64%), Gaps = 1/275 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   + + G NI+  +QF DLD+   FMR+      C     +  
Sbjct: 13  VLTLSCPDQPGIVHAVSGMVVSAGGNIIQSAQFADLDSGLFFMRVEMDV-PCAHDIRSRV 71

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
           + +  +F + + +     A +T+I+VS+  HCL+DLLYR    ++ +++  VV NH    
Sbjct: 72  ETLAAEFDMAWELDEIGRALRTVIMVSKEGHCLSDLLYRVRDHSIPIDVKAVVGNHPDLA 131

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +   YQ+PF  +P+T+ NK E+E++L++++    VEL++LARYMQILSD LC +M+GRI
Sbjct: 132 PIATFYQVPFILVPVTKDNKPEAERQLLDLVAAEKVELVVLARYMQILSDKLCREMSGRI 191

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H  T  D
Sbjct: 192 INIHHSFLPSFKGAKPYDQAHDRGVKLIGATAHYVTADLDEGPIIEQDVSRVDHTFTAID 251

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 252 MRKQGQDVERRVLAQAVKWHAEHRVLMNGDRTVIF 286


>gi|83720563|ref|YP_441053.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|167579785|ref|ZP_02372659.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           TXDOH]
 gi|167617860|ref|ZP_02386491.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis Bt4]
 gi|257140294|ref|ZP_05588556.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|83654388|gb|ABC38451.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
          Length = 293

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 183/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGAADAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIPAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P+      +     E +++ +I+++  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|17548286|ref|NP_521626.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum GMI1000]
 gi|17430532|emb|CAD17216.1| probable formyltetrahydrofolate deformylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 290

 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 179/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           S+ILT++CPS     + +   L    C I ++S F+D  + + F+R  F       L + 
Sbjct: 9   SFILTLSCPSAPGQVAAVVGLLERHHCYIDELSVFDDELSQRFFVRCVFHPTDTHALHVD 68

Query: 63  D----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           D    F+PI Q F +Q++I + +   K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 69  DLRQEFEPIAQTFGMQWAIHDAQARPKVLIMVSKLEHCLTDLLFRWRMGELKMDIVGIAS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + ++++E +  EL+ILARYMQ+LS     
Sbjct: 129 NHPDFEPLARQHGLPFRHFPITPDTKAQQEAQWLDLLESSGAELVILARYMQVLSPETSA 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 KLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L++AV A I++RVF+N  +T+VF
Sbjct: 249 SYRPEQLLAVGRDVECLTLSRAVKAFIERRVFLNGDRTVVF 289


>gi|254251400|ref|ZP_04944718.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
 gi|124894009|gb|EAY67889.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
          Length = 325

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 118/288 (40%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +       +
Sbjct: 37  SFILKLSCPDRHGIVHAVSGFLFERNHNILDSAQFGDSRTGEFFMRVHFEQDGNGADAAS 96

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 97  ALDTLRREFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 156

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 157 IVSNHKDFYQLAASYNIPFHHFPLAGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 216

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS +LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 217 LSPNLCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 276

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 277 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 324


>gi|162138522|ref|YP_485198.2| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 287

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 179/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    IT+ +  +L   G N+LD  Q+ND ++   FMR+  VFN   ++    
Sbjct: 6   YVLTLSCPDRVGITAAVTTFLFENGQNVLDAQQYNDTESGHFFMRV--VFNAADRVVPLA 63

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VS
Sbjct: 64  ELRTGFSAIALKFTMGWHMRDRSTRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++ ++PFY+LP+T+  + + E  +  +I +   +L++LARYMQILSD + 
Sbjct: 124 NHPRDTFSGFDFGEIPFYHLPVTKDTRRQQEAAITALIAQTKTDLVVLARYMQILSDEMA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 184 GRLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 244 HRDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 285


>gi|296533007|ref|ZP_06895657.1| formyltetrahydrofolate deformylase [Roseomonas cervicalis ATCC
           49957]
 gi|296266670|gb|EFH12645.1| formyltetrahydrofolate deformylase [Roseomonas cervicalis ATCC
           49957]
          Length = 317

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 119/284 (41%), Positives = 180/284 (63%), Gaps = 13/284 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--LFI 61
           ++LT+ C +   I + +   L   G NI +  QF+D  T + FMR+ F     ++     
Sbjct: 37  FVLTLNCVNRPGIVAAVASALFEAGGNIREAQQFDDTGTGRFFMRVVFDVPAAVERAALE 96

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A    +  +F + +++R+     + ++LVS+ DHCL DLLYRW IG L + + G+VSNH 
Sbjct: 97  AALLTVATRFGMDWTLRDRAAKRRVMLLVSKFDHCLADLLYRWRIGELPMELTGIVSNHP 156

Query: 122 THKKLVENYQ------LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
                +E Y       +PF++LP+T+  K+E E ++  + +++  +LM+LARYMQ+LSD 
Sbjct: 157 -----LETYAHLDFTGVPFHHLPVTKATKMEQEAEIWRLFQESRSDLMVLARYMQVLSDG 211

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           L  K+ GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQDV R
Sbjct: 212 LSAKLPGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHFVTADLDEGPIIEQDVER 271

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++HA T ED +  G++IE +VL +A++  ++ R+ +N  KT+VF
Sbjct: 272 ISHADTAEDLVRKGRDIERRVLARAISFFLEDRIILNGNKTVVF 315


>gi|227497338|ref|ZP_03927570.1| Formyltetrahydrofolate deformylase [Actinomyces urogenitalis DSM
           15434]
 gi|226833209|gb|EEH65592.1| Formyltetrahydrofolate deformylase [Actinomyces urogenitalis DSM
           15434]
          Length = 303

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 178/275 (64%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +LT++CP    I   +   L+ +G NI +  QF D ++   FMR++ +         AD 
Sbjct: 28  VLTLSCPDRPGIVHAVTGALARRGGNITESQQFGDAESGLFFMRVAVLTRVPRTELEADI 87

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +   + +++S+       +TL++VS+  HCL+DLL+R     L +++VGVV NH T +
Sbjct: 88  AELAATYEVRWSLDEADRPIRTLLMVSKEGHCLSDLLFRAKSQGLPIDVVGVVGNHETLR 147

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + E Y +PF+++P+T+  K E+E +L+++++   VEL++LARYMQILS  LC  + G +
Sbjct: 148 DVAEFYGVPFHHIPVTKDTKAEAEAELLSLVDSLEVELVVLARYMQILSPALCETLHGNV 207

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY+QA++ GVK+IGATAHY   +LD GPIIEQDV R +HA +   
Sbjct: 208 INIHHSFLPSFKGAKPYQQAHDRGVKLIGATAHYVTPDLDEGPIIEQDVTRASHADSALQ 267

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 268 LQRKGQDVERRVLAQAVKWHAEHRVLLNGHRTVVF 302


>gi|299066468|emb|CBJ37656.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum CMR15]
          Length = 267

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/262 (46%), Positives = 170/262 (64%), Gaps = 6/262 (2%)

Query: 24  LSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFIADFQPIVQQFSLQYSIRNT 80
           L  QGCNILD  QF D  T + FMR+ FV       ++     F PI ++FS+Q+ + + 
Sbjct: 5   LFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPLDLQALRERFAPIGERFSMQWGMFDA 64

Query: 81  KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPM- 139
               + +ILVS+  HCLNDLL+R   G L + I  +VSNH    +L  +Y +PF +LP+ 
Sbjct: 65  AVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAAIVSNHRDFYQLAASYDVPFLHLPLL 124

Query: 140 --TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKG 197
             T+  K + E ++  +IE+  ++L++LARYMQILSD LC ++ GR INIHHSFLPSFKG
Sbjct: 125 KGTDAQKAQQEGRIRELIEEQQIDLVVLARYMQILSDDLCRQLEGRAINIHHSFLPSFKG 184

Query: 198 ANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVL 257
           A PY QA+E GVK+IGATAHY   ELD GPIIEQ++ RV H+   E   A+G+++E   L
Sbjct: 185 AKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQEIERVDHSMDPEQLTAVGRDVECVAL 244

Query: 258 TKAVNAHIQQRVFINKRKTIVF 279
            +AV  H + R+ +N  KT+VF
Sbjct: 245 ARAVKWHAEHRILLNGHKTVVF 266


>gi|86571730|gb|ABD06287.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 305

 Score =  258 bits (660), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 179/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    IT+ +  +L   G N+LD  Q+ND ++   FMR+  VFN   ++    
Sbjct: 24  YVLTLSCPDRVGITAAVTTFLFENGQNVLDAQQYNDTESGHFFMRV--VFNAADRVVPLA 81

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VS
Sbjct: 82  ELRTGFSAIALKFTMGWHMRDRSTRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVS 141

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++ ++PFY+LP+T+  + + E  +  +I +   +L++LARYMQILSD + 
Sbjct: 142 NHPRDTFSGFDFGEIPFYHLPVTKDTRRQQEAAITALIAQTKTDLVVLARYMQILSDEMA 201

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 202 GRLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERIS 261

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 262 HRDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 303


>gi|171318653|ref|ZP_02907799.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
 gi|171096161|gb|EDT41084.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
          Length = 294

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADGADATS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRQEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|75676567|ref|YP_318988.1| formyltetrahydrofolate deformylase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421437|gb|ABA05636.1| formyltetrahydrofolate deformylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 285

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 180/282 (63%), Gaps = 10/282 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           Y+LT++CP    I S +  +L+  G NI+D  QF+D +T + FMR+  VFN       + 
Sbjct: 6   YVLTLSCPDRPGIVSAVSTFLAHNGQNIIDAQQFDDAETGRFFMRV--VFNAADLAVRLP 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I ++F + + +R+     K ++LVS+ DHCL D+LYRW  G L +    +VS
Sbjct: 64  ALQTGFDAIAERFRMTWHMRDRAAQRKVMLLVSKSDHCLVDILYRWRTGELKMIPTAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++ ++PF+Y P+T  +K   E +++ ++E+   +L++LARYMQILS+ + 
Sbjct: 124 NHPRETYAHLDFGEIPFHYFPVT--SKASQEAQVLKLVEETGTDLVVLARYMQILSNDMS 181

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA  Y QA+E GVK+IGATAHY   +LD GPII+QDV R++
Sbjct: 182 ARLSGRCINIHHSFLPGFKGAKAYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVERIS 241

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +  G++IE +VL +A+  H+  RV +N RKT+VF
Sbjct: 242 HRDTPEALVRKGRDIERRVLARAIRHHLDDRVILNGRKTVVF 283


>gi|187922613|ref|YP_001894255.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
 gi|187713807|gb|ACD15031.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
          Length = 289

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 178/283 (62%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  ++ 
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLEA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRTSFATLAEQFGMRWEMHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T   K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLLGATPDAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|269925496|ref|YP_003322119.1| formyltetrahydrofolate deformylase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789156|gb|ACZ41297.1| formyltetrahydrofolate deformylase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 283

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 180/277 (64%), Gaps = 4/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIA 62
           L I CP  + + + I  +++    NIL   Q+   D+ + FMR+      F    + F A
Sbjct: 7   LLIDCPDRKGLIAAISSFIAMHNGNILSADQYVS-DSGRFFMRLVIEGEGFGLRKEEFGA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F P+ +Q+S+ + I  T +  +  ILVS+ DHCL DLL+RW+ G L   I  V+SNHT 
Sbjct: 66  AFTPLARQYSMNWQIYYTDQPKRVAILVSKQDHCLVDLLWRWDAGELPAEIPLVISNHTN 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
               VE Y +PFY+LP+T++ + E E K++ +++K +++L++LARYMQIL+  + +    
Sbjct: 126 AASRVEAYGIPFYHLPVTKETREEQEDKILELLDKYSIDLVVLARYMQILTPKVVNAYRQ 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R+INIHHSFLP+F GANPY QA+  GVKIIGATAHY   ELDAGPII QD+  V+H  T+
Sbjct: 186 RMINIHHSFLPAFVGANPYHQAHARGVKIIGATAHYVTEELDAGPIINQDIAHVSHRDTV 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +D I IG+ +E +VL +AV  H++ RV ++  +T+VF
Sbjct: 246 QDMIRIGREVERRVLARAVRWHLEDRVLVDGNRTVVF 282


>gi|323524693|ref|YP_004226846.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
 gi|323381695|gb|ADX53786.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
          Length = 289

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 178/283 (62%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  ++ 
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLEA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +  QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRASFDTLAAQFGMSWEMHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|169772989|ref|XP_001820963.1| formyltetrahydrofolate deformylase [Aspergillus oryzae RIB40]
 gi|83768824|dbj|BAE58961.1| unnamed protein product [Aspergillus oryzae]
          Length = 285

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 124/284 (43%), Positives = 177/284 (62%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ +ILT++CP    I   +  +L     NI+D SQF D  + + FMR  F  +      
Sbjct: 1   MTGFILTLSCPDRPGIVHAVTAFLVQHNLNIIDSSQFGDPTSHRFFMRTHFSADKDASKK 60

Query: 61  IAD-----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             D     F+P  +  S+ + +    +  + LI+VS+  HCLNDLL+R + G LA+ I  
Sbjct: 61  NIDELREAFEPTAKSLSMDFQLVPATQKPRVLIMVSKIGHCLNDLLFRTSTGQLAIEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF +LP+ +  K + E +++ +I ++N++L++LARYMQ+LS  
Sbjct: 121 IVSNHPDFATLAATYNIPFVHLPVNKDTKPQQEARILELISEHNIDLVVLARYMQVLSPT 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 181 LCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 VNHGMSPKELTHAGSNVESNVLAAAVKYFSERRVLLNGHKTVVF 284


>gi|13241955|gb|AAK16481.1|AF329477_1 putative formyltetrahydrofolate deformylase [Arthrobacter
           globiformis]
          Length = 304

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 183/280 (65%), Gaps = 3/280 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
             ++LT++C     I   +  +L  +G NI +  QF+D     L +R +F   T   L  
Sbjct: 25  GKFVLTLSCAQRAGIVQAVTTFLFERGFNIEEHQQFDDGLRQTLHLRTAFSGATGYDLQK 84

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F  I ++F +++++ +  + T+ L++VS+  HCLNDL++RW  G+L  ++  VVSN
Sbjct: 85  IEDEFGTIAERFDMKFNVHDETK-TRVLVMVSKFGHCLNDLIFRWRGGSLGGDLALVVSN 143

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H TH+ + E   LPF ++P+T + K ++E++L+ ++++ N++L++LARYMQ+LSD LC  
Sbjct: 144 HETHRAMAEAAGLPFVHIPVTPETKQDAERRLLELVDEYNIDLVVLARYMQVLSDDLCRS 203

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V+RV H+
Sbjct: 204 LEGRAINIHHSFLPGFKGARPYHQAYDRGVKLVGATAHYVTADLDEGPIIEQEVIRVDHS 263

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                   IG++ EA  L++AV  H + RV I++  TIVF
Sbjct: 264 HGPTTLSTIGQDAEALALSRAVRWHCEHRVLIDQASTIVF 303


>gi|218296480|ref|ZP_03497208.1| formyltetrahydrofolate deformylase [Thermus aquaticus Y51MC23]
 gi|218243022|gb|EED09554.1| formyltetrahydrofolate deformylase [Thermus aquaticus Y51MC23]
          Length = 285

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 180/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTC 56
           M    L ITCP    I + +  +L   G NI D+ Q + D +    FMR++F     +  
Sbjct: 1   MEEARLLITCPDRPGIVAAVTGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +V ++F + + +    E  +T ILVS+P H L +LL+R+ +G L +++  
Sbjct: 61  RPALERAFQEVVAERFGMAWRLAFASERKRTAILVSKPAHALLELLWRYRVGELPMDLRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           VVSNH  H++ VE + +P++++P+  + K E+E +++ ++E+  VEL++LARYMQILS  
Sbjct: 121 VVSNHPDHREEVERFGIPYHHVPVERERKEEAEGRILALLEEAGVELLVLARYMQILSPS 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GANPY+QAYE GVK+IGATAHY   ELD GPIIEQDV R
Sbjct: 181 FVARFPMRIINIHHSFLPAFAGANPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVAR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++E+   +G+ +E  VL +AV  H++ R+ +   KT+VF
Sbjct: 241 VSHRHSVEELRRLGQELERTVLARAVRWHLEDRILVQGNKTVVF 284


>gi|116672259|ref|YP_833192.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116612368|gb|ABK05092.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 309

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 180/279 (64%), Gaps = 4/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           Y+LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F         +  
Sbjct: 31  YVLTLACPERPGIVRAITAFLADRGFDIVEHQQFDDHISGKLYLRTAFTPGDKEVSAEGL 90

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A+F  I ++F ++++I + +   + L++VS+  HCLNDL++RW  G+L   I  VVSNH
Sbjct: 91  SAEFAAIAEEFDMEFAIHDGR-PQRLLVMVSKFGHCLNDLIFRWRAGSLGAEIAVVVSNH 149

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   L F ++P+T   K E+E +L+ ++ + N +L++LARYMQ+LS+ LC  +
Sbjct: 150 EDLRPMAEAAGLQFIHVPVTAATKPEAEARLLELVAEYNADLVVLARYMQVLSNDLCASL 209

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H+ 
Sbjct: 210 RGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTADLDEGPIIEQEVFRVDHSL 269

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                + +G++ E++ L++AV  H Q RV +N  +T+VF
Sbjct: 270 DPNALVTVGRDAESQALSRAVKWHCQHRVLLNNTRTVVF 308


>gi|254469501|ref|ZP_05082906.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
 gi|211961336|gb|EEA96531.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
          Length = 285

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/283 (42%), Positives = 185/283 (65%), Gaps = 8/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTC 56
           +++IL  TC     I S +   L+++G NI++ +QF D  T++ F+R++      +    
Sbjct: 4   TTFILRFTCVDQPGIVSTVTSALASRGANIVEANQFCDRKTNQFFLRVAVRVPENIDKAA 63

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++L ++   P V +F ++  + +     K +I+VS+ DH L  LLY+  +G L   +V +
Sbjct: 64  LELAMS---PAVDRFKMRLKVEDFSRRPKIIIMVSRFDHALLHLLYQIKVGWLDAEVVAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + + ++  +PF++ P+T+QNK+E E KL  +IE  N EL++LARYMQ+L+D +
Sbjct: 121 VSNHADSQGVADHEGIPFHHWPITKQNKLEQEAKLSELIESTNAELVVLARYMQVLTDEM 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K  G IINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+  RV
Sbjct: 181 SSKFFGMIINIHHSFLPSFKGAKPYHQAHDRGVKLIGATAHYVTPDLDEGPIIEQETERV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T ED++A G++IE++VL +AV  H++ RV +N   T+VF
Sbjct: 241 NHGMTAEDFVATGRDIESRVLARAVKYHLEGRVMLNDNSTVVF 283


>gi|307545564|ref|YP_003898043.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
 gi|307217588|emb|CBV42858.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
          Length = 349

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 180/279 (64%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLF 60
           Y L I+CP    I + +  +++  G +I + SQ +D ++ + FMR   + +T     +  
Sbjct: 70  YRLVISCPDRLGIVARVSSFITGHGGSITEASQHSDFESGRFFMRYEILADTVGMTPEAL 129

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI ++F +Q+++ +T++  + +++VS+  HCL DLLYRW  G L  +I  V+SNH
Sbjct: 130 REAFEPIAREFDMQWALTDTRQRRRVVLMVSRESHCLVDLLYRWTAGELDCDIAAVISNH 189

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LVE +++P++++P+  ++K  +  ++  ++E  + + ++LARYMQIL   +C + 
Sbjct: 190 DDLRSLVEWHEIPYHHVPVPAEDKAPAFAEIEQLVESADADCVVLARYMQILPPGICQRY 249

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR++NIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD+ RV+H  
Sbjct: 250 AGRVLNIHHSFLPSFAGAKPYHQAYRRGVKLIGATCHYVTEELDAGPIIEQDIHRVSHCH 309

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D +  G+++E  VL + V  H++ RV ++  KT+VF
Sbjct: 310 TPNDLVRFGRDVEKAVLARGVRWHLEDRVLLHGNKTVVF 348


>gi|295675425|ref|YP_003603949.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
 gi|295435268|gb|ADG14438.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
          Length = 289

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 179/283 (63%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLDA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L ++I  ++SN
Sbjct: 66  LRASFVALAEQFGMSWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIDIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K   E +++ +I ++  +L++LARYMQILS +L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLLGGTPEAKTAQEARVLEVINEHQADLVVLARYMQILSPNL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CKSLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|260907102|ref|ZP_05915424.1| formyltetrahydrofolate deformylase [Brevibacterium linens BL2]
          Length = 283

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 183/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMKLFI 61
           +IL +TCP    I   +   L++ G NI +  QF+  D+ + F+R+ FV N  +  +   
Sbjct: 5   WILRVTCPDATGIVHAVTGVLASLGANITESQQFSSPDSLQFFLRVQFVTNNDSDAETLQ 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           +       +F++  S++  ++ T+TL+LVS+  HCLN LL++ + G L ++IVGV  NH 
Sbjct: 65  SSLAEAAHRFTMTVSLQPVEKKTRTLVLVSKAAHCLNTLLFQQSSGQLPIDIVGVAGNHD 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           + + L E +   F+++P++ + K  +E +L  +++  +VEL++LARYMQILS  LC ++ 
Sbjct: 125 SLRSLAEFHGHDFHHIPISPETKDAAEARLSALVDDLDVELIVLARYMQILSPDLCARLE 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H + 
Sbjct: 185 GRVINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTPDLDEGPIIEQDVARVDHNRN 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           I D++  G+++EA VL +AV  H + RV ++  +T+VF
Sbjct: 245 IADFVQRGQDVEAAVLARAVAWHAEGRVLMDGHRTVVF 282


>gi|50085631|ref|YP_047141.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
 gi|49531607|emb|CAG69319.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
          Length = 288

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 183/282 (64%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           +  Y+L I+CP+   I + + + L+   C I +++Q++D  T + F RI F FN     +
Sbjct: 6   VDQYVLKISCPAASGIVAAVSNCLAGNDCYISEMAQYDDEITGRFFSRIVFRFNEGQGDL 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +L    F  +  +F+++      K   K LI+VS+ DHCL +LLYR + G L   I  +V
Sbjct: 66  ELLKEKFADVTAKFAMKADFYEKKNPMKVLIMVSKFDHCLLNLLYRHHKGELDFQITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+++  K + EQ+L+ I+++   EL+ILARYMQILS++LC
Sbjct: 126 SNHLDLRAIAEREGIRFIYLPVSKDTKQQQEQELLKIVDETKTELVILARYMQILSNNLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+E GVK+IGATAH+   +LD GPIIEQ+V RV 
Sbjct: 186 TQLSGRAINIHHSFLPGFKGAKPYHQAFERGVKLIGATAHFVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA   +D +++G++ E   L+KAV   ++ RVF+N  +T+VF
Sbjct: 246 HAYMPDDLVSVGRDTETVALSKAVKYFVEHRVFMNDDRTVVF 287


>gi|119962216|ref|YP_946293.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
 gi|119949075|gb|ABM07986.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
          Length = 304

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 180/278 (64%), Gaps = 3/278 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCMKLFI 61
           ++LT++C     I   +  +L  +G NI +  QF+D     L +R +F    +   +   
Sbjct: 27  FVLTLSCVERAGIVQAVTTFLFERGFNIEEHQQFDDGLRQTLHLRTAFSGPLSYSPERLE 86

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F  I  +F +++S  + +   + L++VS+  HCLNDL++RW  G+L  ++V V SNH 
Sbjct: 87  EEFSAIADRFEMKFSFHD-QTKKRVLVMVSKFGHCLNDLIFRWRGGSLGGDLVVVASNHE 145

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           TH+ + E   LPF Y+P+T   K E+EQ+L++++E+ NV+L++LARYMQ+LSD LC  + 
Sbjct: 146 THRAMAEAAGLPFVYIPVTPDTKAEAEQRLLDLVEEYNVDLVVLARYMQVLSDDLCRALE 205

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V+RV H+  
Sbjct: 206 GRAINIHHSFLPGFKGARPYHQAYDRGVKLVGATAHYVTADLDEGPIIEQEVIRVDHSYG 265

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 +G++ EA  L++AV  H + RV +++  T+VF
Sbjct: 266 PTTLSTVGQDAEALALSRAVRWHCEHRVLLDQTSTVVF 303


>gi|332528036|ref|ZP_08404069.1| formyltetrahydrofolate deformylase [Rubrivivax benzoatilyticus JA2]
 gi|332112609|gb|EGJ12402.1| formyltetrahydrofolate deformylase [Rubrivivax benzoatilyticus JA2]
          Length = 294

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 127/291 (43%), Positives = 179/291 (61%), Gaps = 19/291 (6%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD----TSKLFMRISFVFNTCMKL 59
           ++LT++C   + I   +   L   GCNI+D  QF DLD    T   FMR+ F     +  
Sbjct: 7   FVLTLSCRDTKGIVFAVSGLLYQAGCNIIDSQQFGDLDGDDATGLFFMRVHFEAPQQL-- 64

Query: 60  FIADFQPIVQQFS-------LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
             AD Q + + F+       +           + L++VSQ  HCLNDLL+RW  G L + 
Sbjct: 65  --ADVQTLDRLFAHTREQHQMDVRFHAVSRRPRLLLMVSQHGHCLNDLLFRWKSGQLPVE 122

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARY 168
           I  +VSNHTT   L ++Y +PF +LP+    + + K   E+++  II++  ++L++LARY
Sbjct: 123 IPAIVSNHTTFAGLADSYGIPFVHLPLVGGSSAETKRAQEREVEAIIDRERIDLVVLARY 182

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQILS   C  + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPI
Sbjct: 183 MQILSPEFCEVLRGRAINIHHSFLPSFKGARPYFQAHARGVKLIGATAHYVTADLDEGPI 242

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQDV RV H  + ED+ A+G++IE +VL +AV  H+++RV +N  K++VF
Sbjct: 243 IEQDVERVDHTLSAEDFTAVGRDIECRVLARAVRWHVERRVLLNGHKSVVF 293


>gi|329945902|ref|ZP_08293589.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328528350|gb|EGF55328.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 290

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 173/275 (62%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +          D 
Sbjct: 15  VLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELEKDL 74

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH T +
Sbjct: 75  AELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHETLR 134

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            + E Y +PF+++ +T+  K  +E +L+ +++  +VEL++LARYMQILS  LC ++ G +
Sbjct: 135 DVAEFYGVPFHHIAVTKDTKEAAEAELLGLVDSLDVELVVLARYMQILSPTLCERLHGGV 194

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H   +  
Sbjct: 195 INIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDPVAT 254

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 255 LQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|312220683|emb|CBY00624.1| similar to formyltetrahydrofolate deformylase [Leptosphaeria
           maculans]
          Length = 282

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 176/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
             + LT+ CP    I   +   L+ +   ILD+ QF+D D+   FMR+ F     +    
Sbjct: 4   DDHYLTLQCPDKAGIVYAVTGLLAKENLTILDLQQFSDPDSKTFFMRVHFGHAADLSALE 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              Q +  +  + Y IR      + LI+VS+  HCLNDLL+R   G L + +  +VSNH 
Sbjct: 64  TSMQQLGAEMQMDYQIRRVDAKPRVLIMVSKIGHCLNDLLFRVKSGLLKIEVPVIVSNHP 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              ++  N  + F++LP+T+  K E E +++++I ++N++L++LARYMQ+LS  LC +M+
Sbjct: 124 DFAQVARNNGIEFHHLPVTKDTKTEQESQILDLIAQHNIDLVVLARYMQVLSPRLCTEMS 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA +
Sbjct: 184 GKIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALS 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ +  G N+E++VL  AV    ++RVF+N  KT+VF
Sbjct: 244 PKELVEEGSNVESQVLAHAVKWWSEKRVFLNGVKTVVF 281


>gi|319781767|ref|YP_004141243.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167655|gb|ADV11193.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 288

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 180/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           S+ILT++C     I + +   L+  G NI + SQ  D  +++ FMRI+F     +     
Sbjct: 9   SFILTLSCEDQAGIVAAVTTELANLGTNIAESSQHWDRASNRFFMRIAFSAPAWVSADAI 68

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P+V +F L   +       K +I+VS+ DH L  L+Y+  +G L   +  ++SNH
Sbjct: 69  TKGLAPVVDRFGLSSRLLERSRRPKIVIMVSKFDHALLHLIYQIRVGWLEAEVAAIISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++      +P++ LP++++NK E E +++ +IE    +L++LARYMQ+ SD L  ++
Sbjct: 129 EDSRETAAWAGIPYHVLPISKENKQEQEGRILAVIEDVGADLVVLARYMQVYSDDLAGRL 188

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G++INIHHSFLPSFKGA PY QA+E+GVK+IGATAHY   +LD GPIIEQ+  RVTH+ 
Sbjct: 189 FGKVINIHHSFLPSFKGARPYHQAFEHGVKLIGATAHYVTAQLDEGPIIEQETERVTHSM 248

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ED+IA G++IE++VL +A+  H++ RV IN RKT+VF
Sbjct: 249 SVEDFIAAGRDIESRVLARAIKRHLEARVMINGRKTVVF 287


>gi|53724066|ref|YP_104585.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|67643417|ref|ZP_00442163.1| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|121601300|ref|YP_991418.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124385368|ref|YP_001027506.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126448392|ref|YP_001082472.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|167001023|ref|ZP_02266824.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
 gi|254174886|ref|ZP_04881547.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|254201672|ref|ZP_04908036.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|254207004|ref|ZP_04913355.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|254357483|ref|ZP_04973757.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|52427489|gb|AAU48082.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|121230110|gb|ABM52628.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124293388|gb|ABN02657.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126241262|gb|ABO04355.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|147747566|gb|EDK54642.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|147752546|gb|EDK59612.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|148026547|gb|EDK84632.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|160695931|gb|EDP85901.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|238524769|gb|EEP88200.1| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|243063095|gb|EES45281.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
          Length = 293

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 182/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R++ G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYHTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP+      +     E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|46199259|ref|YP_004926.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB27]
 gi|46196884|gb|AAS81299.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB27]
          Length = 285

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 180/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTC 56
           M    L +TCP    I + +  +L   G NI D+ Q + D +    FMR++F     +  
Sbjct: 1   MEEARLLVTCPDRPGIVAAVSGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +V  +F +Q+ +    E  +T ILVS+P H L +LL+R+ +G L + +  
Sbjct: 61  RPALERAFQEVVASRFQMQWRLAYASERKRTAILVSKPAHALLELLWRYRVGELPMELRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+    K E+E+K++ ++E   VEL++LARYMQILS  
Sbjct: 121 VISNHPDHREEVERFGIPYHHVPVERGRKEEAEEKILALLEAEGVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVERFPMRIINIHHSFLPAFAGADPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++ +   +G+ +E  VL +AV  H++ R+ +++ +T+VF
Sbjct: 241 VSHRHSVREMKRLGRELERTVLARAVRWHLEDRILVHENRTVVF 284


>gi|115526213|ref|YP_783124.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisA53]
 gi|115520160|gb|ABJ08144.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisA53]
          Length = 287

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 180/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           Y+LT++CP    I + +  +L   G NI+D  QF+D +T   FMR+  VFN       ++
Sbjct: 6   YVLTLSCPDLPGIVATVSTFLFDNGQNIVDAQQFDDSETGLFFMRV--VFNAAQTRASLQ 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ ++F +++ +R+     + ++LVSQ  HCL D+LYRW  G L +    ++S
Sbjct: 64  GLREAFMPVAERFMMRWQMRDRANRRRVMLLVSQSHHCLVDILYRWRTGELEMQPTAIIS 123

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH     K ++  ++PF+YLP+ ++ + + E  +  +I     +L++LARYMQILS+ + 
Sbjct: 124 NHPRETYKGIDFGEIPFHYLPVNKETRRQQETAISGVIAHTKTDLVVLARYMQILSNEMS 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPII+QDV R++
Sbjct: 184 GRLEGRCINIHHSFLPGFKGARPYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D    G++IE +VL++A+  H++ RV +N +KT+VF
Sbjct: 244 HRDTPADLARKGRDIERRVLSRAIRYHLEDRVILNGKKTVVF 285


>gi|53718182|ref|YP_107168.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           K96243]
 gi|76809709|ref|YP_332190.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|126439130|ref|YP_001057643.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126452460|ref|YP_001064889.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|134279777|ref|ZP_01766489.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|167718040|ref|ZP_02401276.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei DM98]
 gi|167737056|ref|ZP_02409830.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 14]
 gi|167814165|ref|ZP_02445845.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 91]
 gi|167822687|ref|ZP_02454158.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 9]
 gi|167844262|ref|ZP_02469770.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           B7210]
 gi|167892772|ref|ZP_02480174.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 7894]
 gi|167901267|ref|ZP_02488472.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei NCTC
           13177]
 gi|167909484|ref|ZP_02496575.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 112]
 gi|217419672|ref|ZP_03451178.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|226199523|ref|ZP_03795080.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242314278|ref|ZP_04813294.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|254181845|ref|ZP_04888442.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|254187777|ref|ZP_04894289.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196387|ref|ZP_04902811.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|254259682|ref|ZP_04950736.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
 gi|254296105|ref|ZP_04963562.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
 gi|52208596|emb|CAH34532.1| putative formyltetrahydrofolate deformylase [Burkholderia
           pseudomallei K96243]
 gi|76579162|gb|ABA48637.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|126218623|gb|ABN82129.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126226102|gb|ABN89642.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|134248977|gb|EBA49059.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|157805779|gb|EDO82949.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
 gi|157935457|gb|EDO91127.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169653130|gb|EDS85823.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|184212383|gb|EDU09426.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|217396976|gb|EEC36992.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|225928404|gb|EEH24434.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242137517|gb|EES23919.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|254218371|gb|EET07755.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
          Length = 293

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP+      +     E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|237810793|ref|YP_002895244.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
 gi|237506166|gb|ACQ98484.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
          Length = 293

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAETFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP+      +     E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|167835398|ref|ZP_02462281.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           MSMB43]
          Length = 293

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+             
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHAGQAGGADAAAA 65

Query: 62  -----ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIPAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P+      +     E +++ +I+++  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|55981290|ref|YP_144587.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB8]
 gi|55772703|dbj|BAD71144.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB8]
          Length = 285

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 181/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTC 56
           M    L +TCP    I + +  +L   G NI D+ Q + D +    FMR++F     +  
Sbjct: 1   MEEARLLVTCPDRPGIVAAVSGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +V  +F +Q+ +    E  +T ILVS+P H L +LL+R+ +G L + +  
Sbjct: 61  RPALERAFQEVVASRFQMQWRLAYASERKRTAILVSKPAHALLELLWRYRVGELPMELRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+ +  K E+E++++ ++E   VEL++LARYMQILS  
Sbjct: 121 VISNHPDHREEVERFGIPYHHVPVEKGRKEEAEERILALLEAEGVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVERFPMRIINIHHSFLPAFAGADPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++ +   +G+ +E  VL +AV  H++ R+ +++ +T+VF
Sbjct: 241 VSHRHSVREMKRLGRELERTVLARAVRWHLEDRILVHENRTVVF 284


>gi|170691483|ref|ZP_02882648.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
 gi|170143688|gb|EDT11851.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
          Length = 289

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 177/283 (62%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLDA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LRVSFATLAEQFGMNWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQILS  L
Sbjct: 126 HKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQILSPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 DHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|328542210|ref|YP_004302319.1| formyltetrahydrofolate deformylase [polymorphum gilvum SL003B-26A1]
 gi|326411960|gb|ADZ69023.1| Formyltetrahydrofolate deformylase [Polymorphum gilvum SL003B-26A1]
          Length = 285

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 180/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           S++LT++C     I + +   L+  G NI +  QF D  T++ FMRI+F+       +  
Sbjct: 5   SFVLTLSCEDRPGIVAAVTTELADLGANIAESDQFWDQVTNRFFMRIAFIAPEGVGREAI 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P + +F ++ ++ +     K +I+VS+ DH L  LLY+  +G L   +V +VSNH
Sbjct: 65  EKALSPAIARFDMKTTLVDRSVRPKMIIMVSKFDHALLHLLYQIRVGWLEAEVVAIVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++  +   +PF++ P+T+ NK E E+KL+ +++    +L++LARYMQILSD L  ++
Sbjct: 125 EDSRRTADYEDVPFHHWPVTKANKAEQEEKLLTLVKDTGADLVVLARYMQILSDSLSKRL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G++INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H+ 
Sbjct: 185 FGKVINIHHSFLPSFKGARPYHQAHERGVKMIGATAHYVTADLDEGPIIEQDVERVNHSL 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  D+ A G++IEA+VL +AV  H++ RV I   KTIVF
Sbjct: 245 SAADFAARGRDIEARVLARAVKYHLESRVMIVGTKTIVF 283


>gi|148553864|ref|YP_001261446.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
 gi|148499054|gb|ABQ67308.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
          Length = 283

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 180/282 (63%), Gaps = 7/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           ++Y+LT++CP    I + +   L +   NI++ +QF D +T + FMR+ F     + L +
Sbjct: 3   AAYVLTLSCPDQPGIVTRVTAELYSYRANIVEAAQFEDRETGRFFMRVVFTVPEGVTLDV 62

Query: 62  AD--FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ + + + ++IR   +  K L+L S+ DHCL DLLYR  IG L + +VG+VSN
Sbjct: 63  VRDTFTPVARHYDMHWAIRPRDQRRKVLLLASKFDHCLVDLLYRNRIGELNMEVVGIVSN 122

Query: 120 H--TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           H   T+  L +    PF++ P+T  +K E E ++  ++++   EL++LARYMQILSD L 
Sbjct: 123 HPRETYGDLGDA---PFHHFPITRDSKAEQEARIKALVDETGAELIVLARYMQILSDDLA 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV +++
Sbjct: 180 AFLAGRCINIHHSFLPGFKGAKPYHQAHARGVKMIGATAHYVTADLDEGPIIAQDVEQIS 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + E  +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 240 HADSPEALVRKGRDIERRVLARAVRHHLADRVLLNGAKTVVF 281


>gi|220909397|ref|YP_002484708.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7425]
 gi|219866008|gb|ACL46347.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7425]
          Length = 287

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 176/280 (62%), Gaps = 5/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           Y LT++CP    I + +  +++  G  I++     D D  + FMR   +    +   IA+
Sbjct: 8   YTLTLSCPDRVGIVAAVSSFIAGNGGWIMEAQHHADWDEKRFFMR-QVILAESLPFEIAE 66

Query: 64  ----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F PI   F + ++I ++    + +ILVS+ DHCL DLL RW  G LA+ I  V+SN
Sbjct: 67  LRDRFSPIAASFQMSWNITDSAVKKRVVILVSKLDHCLYDLLARWRSGELAIEIPAVISN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + LVE + +P+ Y+P+T   K  +  K+ ++  + + + M+LARYMQILS  LC +
Sbjct: 127 HETLRSLVEWHGIPYIYIPVTAATKAVAYAKIAHLFTELHGDTMVLARYMQILSSDLCDR 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G+I+NIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQDV+R+ H+
Sbjct: 187 YPGQILNIHHSFLPSFVGAKPYHQAYERGVKLIGATCHYVTTELDAGPIIEQDVIRIDHS 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ED +  G++IE  VL + +  H++ RV ++  KT+VF
Sbjct: 247 DSVEDLVRYGRDIEKNVLARGLRYHVEDRVLLHGNKTVVF 286


>gi|134296977|ref|YP_001120712.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
 gi|134140134|gb|ABO55877.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
          Length = 294

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 182/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT------- 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  + + FMR+ F  +        
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRSGEFFMRVHFEQDADGVDATA 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRREFAPLAEQFEMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|71281483|ref|YP_271006.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71147223|gb|AAZ27696.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
          Length = 286

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLF 60
           YILT  CP N  + + +   L + G  I + SQ++D  +   F RI+F           F
Sbjct: 7   YILTWQCPDNTGVLAKVSQSLFSHGAFITETSQYSDPYSETFFSRIAFDDRNLTVSSSEF 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +     + +  ++QY +R   +    LI VS+ DHCL  LL +W  G L +NIVGV+SNH
Sbjct: 67  VKALNELAKPLAMQYQLRKRADVPNVLIAVSKDDHCLVSLLTKWRSGALPINIVGVISNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L E + +PFY+LP+  + K+E E ++ +++E+ N++L++LARYMQILSD LC ++
Sbjct: 127 QYCQALSEWHNVPFYHLPVNAETKLEQEAQITDLMEELNIDLLVLARYMQILSDGLCQQL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPII Q+V  + HA 
Sbjct: 187 QGKAINIHHSFLPSFKGARPYHQAHARGVKVIGATAHYVTANLDEGPIIAQEVKPINHAF 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TIE  + +G ++EA  L+ AV  H +QRV IN  KT++ 
Sbjct: 247 TIEQMVHMGHDLEATALSHAVRIHAEQRVCINGDKTVIL 285


>gi|239787539|emb|CAX84008.1| Formyltetrahydrofolate deformylase [uncultured bacterium]
          Length = 302

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 178/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLF 60
           YILTI+CP +  I + +  +L+     I + S F D  + + FMR  F    F   + +F
Sbjct: 23  YILTISCPDSVGIVAAVSGFLAEHDAFITESSHFGDPVSRRFFMRTVFASGAFTPPIDVF 82

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +  F  I ++F + + + + +   + LI+VS+ DHCLNDLLYR+  G L + I  +VSNH
Sbjct: 83  VKTFSRIAERFQMVWGLHDARRKERLLIMVSKLDHCLNDLLYRYRTGELRVEIPAIVSNH 142

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L   +++PF++LP+    K + E +++ ++++  ++L++LARYMQ+LS  +C ++
Sbjct: 143 PDLEHLAAWHEIPFHHLPIKPDTKADQESQVMALVDQLQIDLVVLARYMQVLSSRMCERL 202

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLPSFKG+ PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H  
Sbjct: 203 RGRCINIHHSFLPSFKGSRPYHQAHARGVKIIGATAHYVTMDLDEGPIIEQGVERVDHTF 262

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED   +G++IE  VL++AV  H++ RV +N  KT++ 
Sbjct: 263 APEDLARVGRDIENVVLSRAVRYHVEHRVLLNGSKTVLL 301


>gi|170700366|ref|ZP_02891376.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
 gi|170134710|gb|EDT03028.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
          Length = 294

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 183/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-------VFNT 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F          +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADGADAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|170940393|emb|CAP65620.1| unnamed protein product [Podospora anserina S mat+]
          Length = 282

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 178/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           + + LT++CP    I   +    + +  NI+D+ QF+D  T K FMR+ F        + 
Sbjct: 3   NDHFLTLSCPDKPGIVHAVTGVFAGEKVNIIDLQQFSDPVTEKFFMRVHFGPTPTESPEF 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+ +  ++ + Y IR   +  K LI+VS+  HCLNDLL+R   G L + I  +VSN
Sbjct: 63  LRPHFEKLAGEYDMTYDIRPVAQKPKVLIMVSKIGHCLNDLLFRAKTGQLPIEIPLIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y + F +LP+T+  K   E +++ +I+++NVEL++LARYMQ+LS  LC  
Sbjct: 123 HPDFAPLAASYGIEFRHLPVTKDTKAAQEGQILELIKEHNVELVVLARYMQVLSPTLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+G+IINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 183 MSGKIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +  +  G N+E++VL  AV  + ++RVF+N  +T+VF
Sbjct: 243 LSPKALVDEGSNVESQVLAAAVKWYAERRVFLNGTRTVVF 282


>gi|332186669|ref|ZP_08388412.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
 gi|332013321|gb|EGI55383.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
          Length = 285

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           +Y++ ++C     I + I   L++ G NIL+ +QF D      F+RI+     +      
Sbjct: 5   AYVIRLSCKDQPGIVAAITTALASLGANILESNQFWDRQADHFFLRIAVTVPADVTRDAV 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
               QP + +F+L   + +  +  + +I+VS+ DH ++ LLY+  +  L  ++V +VSNH
Sbjct: 65  ERTVQPAIDRFALDLKVTDVDQRPRIIIMVSKFDHAMHHLLYQIKVRWLNADVVAIVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +   E   +PF++ P+T++NK E EQKL++++++   EL++LARYMQ+LS+ L  ++
Sbjct: 125 DAARSAAEIEGIPFHHWPVTKENKAEQEQKLLDLVDETGAELVVLARYMQVLSNDLSERL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+  RV+H+ 
Sbjct: 185 YGRVINIHHSFLPSFKGAKPYHQAHDRGVKLIGATAHYVTPDLDEGPIIEQETQRVSHSL 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED++A G++IE++VL +AV  H++ RV +N  +T+VF
Sbjct: 245 TSEDFVATGRDIESRVLARAVKYHLEGRVMLNSHRTVVF 283


>gi|307295559|ref|ZP_07575395.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
 gi|306878598|gb|EFN09818.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
          Length = 288

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 120/281 (42%), Positives = 173/281 (61%), Gaps = 5/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           S++LT+ C     I + +  +L+ +G  I D  Q+ D +  + FMR++F          +
Sbjct: 8   SWVLTLACADRVGIVAAVSQFLAERGGFITDSQQYADREAGRFFMRVAFEATDERLGDTE 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               DF  +  +F++ + +    E  + LI VS+  HCL DLL+RW  GTLA++I+GVVS
Sbjct: 68  RLREDFADVGTRFAMDWRLTAADERPRMLIAVSKGSHCLADLLHRWQTGTLAVDIMGVVS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E + +P++ LP    +K   E  L+ I E+   E +ILARYMQ+LS+ L  
Sbjct: 128 NHPDMRRITEWHGIPYHELP-PNGDKAAQEAALLGIFERTQSEYLILARYMQVLSEGLVE 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V R+ H
Sbjct: 187 ALAGRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERIDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T ED I IG++IEA+VL +AV     +RV  N  KT+VF
Sbjct: 247 RATAEDMIRIGRDIEAQVLARAVGWLADRRVLRNGGKTVVF 287


>gi|239834741|ref|ZP_04683069.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
 gi|239822804|gb|EEQ94373.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
          Length = 297

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 185/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT+ C     I + I   L+  G NI++ +QF D  T++ FMRI+F     M     +
Sbjct: 19  FVLTLDCDDKPGIVAAITTELAAIGGNIVESNQFRDRVTNRFFMRIAFSAPLGMPREAVE 78

Query: 64  --FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +P  ++F +++++ +     K +++VS+ DH +  LLY+  +G L   +V +VSNH 
Sbjct: 79  HSLKPAGERFGMKFAVADASRKPKIVLMVSKFDHAMLHLLYQIRVGWLNAEVVAIVSNHE 138

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++  E+  +P++   + + NK E E +LI+++ +   +L++LARYMQ+LSD+L +++ 
Sbjct: 139 DSRETAESAGIPYHCWGVNKDNKAEQEARLIDLVRETQADLVVLARYMQVLSDNLSNRLF 198

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RVTH+ +
Sbjct: 199 GKIINIHHSFLPSFKGAKPYHQAFERGVKLIGATAHYVTPDLDEGPIIEQETERVTHSMS 258

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 259 AEDFVATGRDIESRVLARAVKMHLEHRVMLNGHKTVVF 296


>gi|115352892|ref|YP_774731.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|172061740|ref|YP_001809392.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
 gi|115282880|gb|ABI88397.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|171994257|gb|ACB65176.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
          Length = 294

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 183/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-------VFNT 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F          +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADGADAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRQEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P+    ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|91976062|ref|YP_568721.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB5]
 gi|91682518|gb|ABE38820.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB5]
          Length = 287

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 178/282 (63%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    I + +  +L   G NILD  Q+ND ++   FMR+  VFN   ++    
Sbjct: 6   YVLTLSCPDRAGIVAAVTTFLFENGQNILDAQQYNDTESGHFFMRV--VFNAAERVAPLA 63

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VS
Sbjct: 64  ELRTGFGAVAVKFAMGWHMRDRATRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++ ++PFY++P+ ++ + + E  +  ++ +   +L++LARYMQILSD + 
Sbjct: 124 NHPRETFSGFDFGEIPFYHMPVNKETRRQQEAAITALVAQTKTDLVVLARYMQILSDEMA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 184 GRLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 244 HRDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 285


>gi|284991317|ref|YP_003409871.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
 gi|284064562|gb|ADB75500.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
          Length = 282

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 175/278 (62%), Gaps = 3/278 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           + LT++C     I   +  +L   GC+I++  QF+D    +LF+R +FV   +T  +   
Sbjct: 5   FTLTLSCQERPGIVHAVSSFLFEHGCDIVEHQQFDDALRGQLFLRTAFVCAEDTDCERLS 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           ADFQ +  +F + Y +   +   + +++VS+  HCLNDL++RW  G L   +V VVSNH 
Sbjct: 65  ADFQAVADEFGMTYQVTGER-PPRVVVMVSKLGHCLNDLIFRWRAGNLGGELVAVVSNHE 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + + E   LPF ++P+T   K E+E +L+ ++++   +L++LARYMQILSD  C  + 
Sbjct: 124 DLRPMAEAAGLPFVHVPVTPATKREAEARLLELVDEYRADLVVLARYMQILSDETCAALY 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QA++ GVK++GATAHY   +LD GPIIEQ+V+R+ H   
Sbjct: 184 GRAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTPDLDEGPIIEQEVIRIDHTFD 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 +G++ EA  L++AV  H +QRV +N   T+VF
Sbjct: 244 PRALATVGQDAEALALSRAVRWHSEQRVLLNGHSTVVF 281


>gi|218533530|ref|YP_002424345.1| formyltetrahydrofolate deformylase [Methylobacterium
           chloromethanicum CM4]
 gi|4538619|emb|CAB39401.1| purU protein [Methylobacterium chloromethanicum]
 gi|218525833|gb|ACK86417.1| formyltetrahydrofolate deformylase [Methylobacterium
           chloromethanicum CM4]
          Length = 287

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 122/286 (42%), Positives = 176/286 (61%), Gaps = 14/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKLF 60
           Y+L I+C     I + +   L  + CNI++  QF D+   + FMR+ F        ++  
Sbjct: 6   YVLKISCADRPGIVAAVSGALLERDCNIVEAKQFEDVIEKRFFMRVVFSGINGQNSLREH 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P+ Q+F + +SIR+ +   + +ILVS+ DHCL D+LYR  IG L +++  VV+NH
Sbjct: 66  QEAMTPLAQRFEMDWSIRDCETKRRVMILVSRFDHCLVDILYRKRIGELPMDLTAVVTNH 125

Query: 121 TTHKKLVENYQ------LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
                  ENY        P   LP+T + K   E KL+ +IE+   E+++LARYMQ+LS 
Sbjct: 126 AA-----ENYAHLDLCGAPLISLPVTAETKRAQEDKLLELIERTGTEVVVLARYMQVLSA 180

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            L  +++ R INIHHSFLP FKGA PY QAYE GVK++GATAHY   +LD GPIIEQDV 
Sbjct: 181 ELSARLSRRCINIHHSFLPGFKGAKPYHQAYERGVKLMGATAHYVTDDLDEGPIIEQDVE 240

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           R++H+ + ED +  G++IE +VL +A+  H+  RV +N  KT+VFP
Sbjct: 241 RISHSDSPEDLVRKGRDIERRVLARALRYHLDDRVLLNGHKTVVFP 286


>gi|85714669|ref|ZP_01045656.1| formyltetrahydrofolate deformylase [Nitrobacter sp. Nb-311A]
 gi|85698554|gb|EAQ36424.1| formyltetrahydrofolate deformylase [Nitrobacter sp. Nb-311A]
          Length = 285

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 178/282 (63%), Gaps = 10/282 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           Y+LT++CP    I S +  +L+  G NI+D  QF+D +T + FMR+  VFN       + 
Sbjct: 6   YVLTLSCPDRPGIVSAVSTFLAHNGQNIIDAQQFDDAETGRFFMRV--VFNAADLAVTLP 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I ++F + + +R+     K ++LVS+ DHCL D+LYRW    L +    +VS
Sbjct: 64  ALQTGFGAIAERFRMTWQMRDRAARRKVMLLVSKSDHCLVDILYRWRTSELKMIPAAIVS 123

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++ ++PF+YLP+T  +K   E  ++ ++ +   +L++LARYMQILS+ + 
Sbjct: 124 NHPRETFAHLDFDEIPFHYLPVT--DKASQEAAVLELVSETETDLVVLARYMQILSNDMS 181

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA  Y QA+E GVK+IGATAHY   +LD GPII+QDV R++
Sbjct: 182 AKLSGRCINIHHSFLPGFKGAKAYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVERIS 241

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +  G++IE +VL +A+  H+  RV +N RKT+VF
Sbjct: 242 HRDTPEALVRKGRDIERRVLARAIRHHLDDRVILNGRKTVVF 283


>gi|332186772|ref|ZP_08388514.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
 gi|332013105|gb|EGI55168.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
          Length = 287

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 175/282 (62%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-----FNTCM 57
            YILT+ C     I + +   L+     ILD  Q+ DL+T + F+RI F      F T +
Sbjct: 5   DYILTLACQDRVGIVAAVSGALAGIDGFILDSQQYADLETGRFFLRIVFTGQGPRFPTSV 64

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A       +F   + +    E  + LI VS+  HCLNDLL+RW   TL + IVGVV
Sbjct: 65  EGVRAALTEPAARFGFDWHVAPAAERPRMLIAVSKGSHCLNDLLHRWRTNTLPVEIVGVV 124

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE + LP+++LP+ + N+ E E  ++ ++++   + ++LARYMQ+L + L 
Sbjct: 125 SNHDGLRPLVEWHGLPWHHLPVGDANRAEQETAMLALMDETRADYLVLARYMQVLGERLV 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLP FKGA PY +A+  GVK+IGATAH+   +LD GPIIEQ V RV 
Sbjct: 185 AALPGRCINIHHSFLPGFKGAQPYHRAHARGVKLIGATAHFVTADLDEGPIIEQAVERVD 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +I+D I IG++IEA+VL +AV    ++RVF+N  +T+VF
Sbjct: 245 HRASIDDLIRIGRDIEAQVLARAVAWVGERRVFLNDNRTVVF 286


>gi|110632813|ref|YP_673021.1| formyltetrahydrofolate deformylase [Mesorhizobium sp. BNC1]
 gi|110283797|gb|ABG61856.1| formyltetrahydrofolate deformylase [Chelativorans sp. BNC1]
          Length = 286

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 180/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           ++ + ++C     I + +   L+  G NI + +QF D  T++ FMRISF    N      
Sbjct: 5   TFDINLSCEDRPGIVAAVTTELAALGANIAESNQFWDRQTNRFFMRISFTVPENIDRDAI 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P + +F+++ ++ +     K +I+VS+ DH L  LLY+  +G L   +  +VSNH
Sbjct: 65  SRALNPAIARFNMETALADRSRRPKIIIMVSKFDHALLHLLYQIRVGWLDSEVAAIVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++  E   +P+Y  P+T+ NK E E+KL+N+  +   +L+ILARYMQ+LSD L  ++
Sbjct: 125 EDSRRTAEAAGIPYYCWPVTKANKAEQEEKLLNLFRETGSDLIILARYMQVLSDQLSSRL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+IINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RVTHA 
Sbjct: 185 FGKIINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVSPDLDEGPIIEQETERVTHAM 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D++A G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 245 SPDDFVAAGRDIESRVLARAVKLHLESRVVLNGLKTVVF 283


>gi|325002227|ref|ZP_08123339.1| formyltetrahydrofolate deformylase [Pseudonocardia sp. P1]
          Length = 282

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 117/279 (41%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           S+ILT+ C +   I   +  +L  +GC+I +  QF+D    +LF+R   V    + L   
Sbjct: 4   SFILTLNCANRTGIVRAVSAFLFERGCDIGEYQQFDDPIRERLFLRTQVVAPEGVDLGTV 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+P+  +F + Y+      A + L++VS+  HCLNDL++RW  G L  +IV VVSNH
Sbjct: 64  ARAFEPVATEFGMDYAFSGDAPA-RILVMVSRLGHCLNDLIFRWRAGNLGADIVAVVSNH 122

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   LPF ++P+T + K E+E +L+  +++ + EL++LARYMQ+LSD  C  +
Sbjct: 123 PDLRPMAEAAGLPFVHIPVTPETKPEAEAQLLRTVDEFDAELVVLARYMQVLSDETCKAL 182

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V+R+ H  
Sbjct: 183 HGRAINIHHSFLPGFKGARPYHQAYDRGVKLVGATAHYVTPDLDEGPIIEQEVIRIDHGH 242

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  +G++ EA  L++AV  H ++RV ++   T+VF
Sbjct: 243 HPTALQMVGRDAEALALSRAVRWHCERRVLLSGTSTVVF 281


>gi|90417072|ref|ZP_01225000.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2207]
 gi|90331088|gb|EAS46344.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2207]
          Length = 292

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++YI T TC +   + + +  YL+ + C I  + QF+D  T K FMR  F     +  + 
Sbjct: 9   NNYIFTGTCRAGTGVVAAVTSYLAERDCYICALEQFDDDSTDKFFMRAVFRPQDGSPSID 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +  +F++ + I + K   KTLI+VS+ DHCL+D+LYR   G   + I  VVS
Sbjct: 69  SIRESFAEVSAKFAMDWHIHDPKVPVKTLIMVSKYDHCLDDILYRRRKGEFNMEITAVVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE   + F +LP+T+  K + EQ+L+ I+ +   EL+ILARYMQILS+ L  
Sbjct: 129 NHVDLRAMVEREGIAFIHLPVTKDTKPQQEQRLLEIVNETGTELVILARYMQILSNELSA 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ + RV H
Sbjct: 189 QLSGRCINIHHSFLPGFKGAKPYHQAYERGVKVIGATAHYVTSDLDEGPIIEQILTRVNH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E  + +G++ E+  L+KA+  HI++RVF++  KT+VF
Sbjct: 249 NYKPEHLVRVGRDNESTALSKAITYHIERRVFLDGNKTVVF 289


>gi|152980435|ref|YP_001352820.1| formyltetrahydrofolate deformylase [Janthinobacterium sp.
           Marseille]
 gi|151280512|gb|ABR88922.1| formyltetrahydrofolate deformylase [Janthinobacterium sp.
           Marseille]
          Length = 288

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 178/283 (62%), Gaps = 7/283 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLF 60
           YIL ++C     I   +  +L+  GCNI++ +QF D  +   FMR+ F         ++ 
Sbjct: 5   YILNLSCLDQRGIVQRVSGFLAGHGCNIIESAQFGDAQSQLFFMRVYFAAEDSSVNDEVL 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            ADF  + +   + + + + ++  + +++VS+  HCLNDLL+R+  G L + I  +VSNH
Sbjct: 65  RADFSEMAKTMQMTWQLHDAQKKPRVMLMVSKIGHCLNDLLFRYKSGLLPVEIPAIVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           T   +L  +Y +PF++LP+    +E+ K   E +++ I +   ++L++LARYMQILS H+
Sbjct: 125 TDFYQLAASYNIPFHHLPLAPGASEEAKRAQEDRVLEIAKSAEIDLVVLARYMQILSPHM 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA+E GVK+IGATAH+   +LD GPIIEQDV RV
Sbjct: 185 CQALQGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHFVTGDLDEGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA       AIG+++E  VL +AV   I+ R+ +N  KT+VF
Sbjct: 245 DHAMNPATLTAIGRDVECVVLARAVKYFIEHRILLNGHKTVVF 287


>gi|186475105|ref|YP_001856575.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
 gi|184191564|gb|ACC69529.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
          Length = 287

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 178/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S+IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 6   SFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSHTGEFFMRVHFQQVGGDPGLDA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I  ++SN
Sbjct: 66  LREAFATLAEQFGMRWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIPAIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQN-KIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H    +L  +Y +PF++ P+T  + K   E +++ +I++   +L++LARYMQILS  LC 
Sbjct: 126 HKEFYQLAASYDIPFHHFPLTSSDTKAHQEARVLEVIDECKADLVVLARYMQILSPQLCA 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 186 RLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERVDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 SMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGSKTVVF 286


>gi|220914198|ref|YP_002489507.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
 gi|219861076|gb|ACL41418.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
          Length = 306

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 178/278 (64%), Gaps = 3/278 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLFI 61
           ++LT++C     I   +  +L  +G NI +  QF+D     L +R +F  +         
Sbjct: 29  FVLTLSCGERAGIVQAVTTFLFDRGFNIDEHQQFDDSLRETLHLRTAFSGSPAYTRDTLE 88

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F+PI  +F +++S  N +   + L++VS+  HCLNDL++RW  GTL  ++V VVSNH 
Sbjct: 89  EEFRPIADRFGMKFSF-NDQTQQRVLVMVSKFGHCLNDLIFRWRGGTLGGDLVAVVSNHE 147

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           TH+ + E   LPF ++P+T   K E+E++L+ ++++   +L++LARYMQ+LS+ LC  + 
Sbjct: 148 THRAMAEAAGLPFIHIPVTPDTKAEAERRLLELVDEYQADLVVLARYMQVLSNDLCRALE 207

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V+RV H+  
Sbjct: 208 GRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVIRVDHSFG 267

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 +G++ EA  L++AV  H Q RV +++  T+VF
Sbjct: 268 PGTLSTVGQDAEALALSRAVRWHCQHRVLLDQTSTVVF 305


>gi|209884455|ref|YP_002288312.1| formyltetrahydrofolate deformylase [Oligotropha carboxidovorans
           OM5]
 gi|209872651|gb|ACI92447.1| formyltetrahydrofolate deformylase [Oligotropha carboxidovorans
           OM5]
          Length = 287

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 176/282 (62%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           ++LT++C +   I S +  +L   G NILD  QF+D +T K FMR++F  NT      + 
Sbjct: 6   FVLTLSCDNRPGIVSAVSTFLFASGQNILDAQQFDDTETGKFFMRVTF--NTVDGSSDLA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F + + +R   +  + ++LVS+  HCL DLLYRW    L +    +VS
Sbjct: 64  TLRGGFGAIAVPFGMVWQLRERGQHQRVMLLVSKSTHCLADLLYRWRYTDLPMVPTAIVS 123

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH     + +E   +PF+YLP+T + K E E ++  ++++   +L++LARYMQ+LSD L 
Sbjct: 124 NHPRETYEGIEFGDIPFHYLPITRETKAEQEAQIWQLVQETKTDLVVLARYMQVLSDDLA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTGDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    E  +  G +IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 244 HRDPPEILVRKGADIERQVLARALRYHLEDRVILNGRKTVVF 285


>gi|254284403|ref|ZP_04959371.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
 gi|219680606|gb|EED36955.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
          Length = 273

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 172/270 (63%), Gaps = 7/270 (2%)

Query: 16  ITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD-----FQPIVQQ 70
           I S +  + + +  +I++ SQ  +  + + FMR + +    M   + D     F  I + 
Sbjct: 3   IVSAVAKFFADREFSIVESSQHTEPSSRQFFMR-TLLSGKPMNAEMMDEITTAFDAIARS 61

Query: 71  FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENY 130
           F + +S R+T++  KT+I VS+ DHCL DLL+ W  G L L+IV VVSNH     +   Y
Sbjct: 62  FEMSWSFRSTEDKLKTVIAVSKWDHCLKDLLHAWKTGDLPLDIVAVVSNHDDLNSMATWY 121

Query: 131 QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHS 190
            +PFY+LP+T   K + E +++ ++E    ELM+LARYMQILSD LC K+ GR INIHHS
Sbjct: 122 GVPFYHLPVTPDTKPQQEAQMLKVMEDTGSELMLLARYMQILSDDLCKKLQGRAINIHHS 181

Query: 191 FLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGK 250
           FLP FKGA PY QAYE GVK++GATAHY   +LD GPIIEQDV RV H+  ++  +  G+
Sbjct: 182 FLPGFKGAKPYHQAYEKGVKLVGATAHYVTADLDEGPIIEQDVFRVAHSDDVDVLVTAGR 241

Query: 251 NIEAKVLTKAVNAHIQQRVFI-NKRKTIVF 279
            +E++VL +A   H + RV + + R+T+VF
Sbjct: 242 QVESRVLMRAAKWHAEGRVMMTSSRRTVVF 271


>gi|297172770|gb|ADI23735.1| formyltetrahydrofolate hydrolase [uncultured Rhodospirillales
           bacterium HF4000_38H21]
          Length = 285

 Score =  254 bits (650), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR--ISFVFNTCMKL 59
           +SYIL I C     I + +   L+++G NI++ +QF D  T++ F+R  IS         
Sbjct: 4   NSYILRIACDDQPGIVATVTSALASRGANIIESNQFWDRHTNQFFLRVGISVPAGIDKDS 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +    P V +F+++  +       K +I+VS+ DH +  LLY+  +G L   +  +VSN
Sbjct: 64  IVLTLNPSVDRFNMKLKVDVVSRRPKIIIMVSKFDHAMLHLLYQIKVGWLDAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +K+ E   +PF+Y+P+ + NK E E KL ++I++ N EL++LARYMQ+L++ L  +
Sbjct: 124 HEDARKVAEQEGIPFHYMPVNKDNKTEQEAKLADLIKQTNSELVVLARYMQVLTNELSSQ 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G IINIHHSFLPSFKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+  RV HA
Sbjct: 184 FYGMIINIHHSFLPSFKGAKPYHQAYDRGVKLIGATAHYVTPDLDEGPIIEQETERVNHA 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +D++A G++IEA+VL +AV  H++ RV +N  +T+VF
Sbjct: 244 MSADDFVATGRDIEARVLARAVKYHLEGRVMLNNHRTVVF 283


>gi|299131861|ref|ZP_07025056.1| formyltetrahydrofolate deformylase [Afipia sp. 1NLS2]
 gi|298591998|gb|EFI52198.1| formyltetrahydrofolate deformylase [Afipia sp. 1NLS2]
          Length = 287

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 175/282 (62%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-----MK 58
           ++LT++C +   I S +  +L   G NILD  QF+D +T K FMR++F  NT      + 
Sbjct: 6   FVLTLSCDNRPGIVSAVSTFLFASGQNILDAQQFDDTETGKFFMRVTF--NTVDGSSDLA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F + + +R+  E  + +++VS+  HCL DLLYRW    L +    +VS
Sbjct: 64  TLRGGFGAIAVPFGMTWQLRSRSEHQRVMLMVSKSTHCLADLLYRWRYTDLPMVPTAIVS 123

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH     + +E   +PF+YLP+T   K E E ++  ++++   +L++LARYMQ+LSD L 
Sbjct: 124 NHPRETYEGIEFGDIPFHYLPVTRDTKAEQEAQIWKLVQETQTDLVVLARYMQVLSDDLA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTGDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    E  +  G +IE +VL + +  H++ RV +N RKT+VF
Sbjct: 244 HRDPPEILVRKGADIERQVLARGLRYHLEDRVILNGRKTVVF 285


>gi|116194169|ref|XP_001222897.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88182715|gb|EAQ90183.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 284

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 125/279 (44%), Positives = 177/279 (63%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           ILT++CP    I   +    + +  NILD+ QF+D  + K FMR+ F  +          
Sbjct: 6   ILTLSCPDKPGIVHAVTGIFAREEHNILDLQQFSDPVSEKFFMRVHFGPSPRAAESTEHL 65

Query: 65  QPI----VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +PI     + + + Y IR   +  + LI+VS+  HCLNDLL+R   G L + I  +VSNH
Sbjct: 66  RPIFDSLAEDYKMTYKIRPVSQKPRVLIMVSKIGHCLNDLLFRAKAGQLPIEIPLIVSNH 125

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                L  +Y + F++LP+T++ K   E +++++I+K+++EL++LARYMQ+LS  LC  M
Sbjct: 126 PEFAALAASYGIEFHHLPVTKETKAVQEGQILDLIKKHSIELVVLARYMQVLSPTLCEAM 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+ 
Sbjct: 186 SGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHSI 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                +  G NIE++VL  AV  + + RVF+N  KT+VF
Sbjct: 246 NPNGLVDEGSNIESQVLAAAVKWYAEGRVFLNGTKTVVF 284


>gi|224826911|ref|ZP_03700010.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
 gi|224600898|gb|EEG07082.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
          Length = 289

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 177/281 (62%), Gaps = 6/281 (2%)

Query: 4   YILTITCPSNE-EITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           + LT+ CPS   E+ S + ++L  +GC I +++ F+D    + F+R  F       L + 
Sbjct: 10  FSLTLDCPSEAGEVASAV-EFLDRRGCYIDELAVFDDECQQRFFLRCIFHHRAGQALALD 68

Query: 62  ---ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               DF P+  +F +++++ +     + LI+VS+ DHCL DLL+RW +  L +++V +VS
Sbjct: 69  ELRRDFAPVAARFGMRWALHDQAVRPRVLIMVSKLDHCLADLLFRWRMDELKMDVVAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T   L E   +PF++LP+T  +K E E +L  +I  +  EL++LARYMQ+LS     
Sbjct: 129 NHDTLAPLAEANGIPFHHLPLTPDSKPEQEARLRALIAASGAELVVLARYMQVLSAAFSA 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
              GR+INIHHSFLP FKGA PY QAYE GVK+IGATAH+   ELD GPIIEQ V RV H
Sbjct: 189 DFAGRVINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHFVTDELDEGPIIEQVVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 249 SYGPERLLATGRDVECLALARAVKAFIERRVFINGNRTVVL 289


>gi|94496991|ref|ZP_01303565.1| Formyltetrahydrofolate deformylase [Sphingomonas sp. SKA58]
 gi|94423667|gb|EAT08694.1| Formyltetrahydrofolate deformylase [Sphingomonas sp. SKA58]
          Length = 279

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMK---LF 60
           +LT+ C     I + +  +L+ +G  I D  Q+ D D    FMR++F   +  M+     
Sbjct: 1   MLTLVCADRVGIVAAVSQFLAERGGFITDSQQYADRDADLFFMRVAFEATDDRMRDTQTL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            ADF  I  +F++ +S+   +   + LI VS+  HCL DLL+RW  G LA++I+GVVSNH
Sbjct: 61  RADFATIGTRFAMDWSLEEARHRPRMLIAVSKGSHCLADLLHRWQAGMLAVDIMGVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++ E + +P++ LP    +K   E  L++I E+   + +ILARYMQ+LS+ L  ++
Sbjct: 121 PDMRRITEWHGIPYHELP-PNGDKAAQEAALLDIFERGRSDYLILARYMQVLSEQLVDRL 179

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV H  
Sbjct: 180 AGRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERVDHRA 239

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED I IG++IEA+VL +AV+    +RV  N  KT+VF
Sbjct: 240 TPEDLIRIGRDIEAQVLARAVSWIADRRVLRNGGKTVVF 278


>gi|307727875|ref|YP_003911088.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
 gi|307588400|gb|ADN61797.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
          Length = 291

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 180/280 (64%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   ++   L IA 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDELSERFFVRCVFHGVDSKETLNIAA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+PI Q+F + +++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKHEFEPIAQRFHMTWAMHDVATRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIASN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +   + LPF++LP++ + K++ E  L+++ E +  ELMILARYMQILS      
Sbjct: 131 HRDLEPMATQHGLPFHHLPISAETKLQQEASLLDLFETSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAGRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQAVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|144898230|emb|CAM75094.1| formyltetrahydrofolate deformylase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 334

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 177/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +++LTITCP    I + +  +L+   C I + +Q+ D  + + FMRI F           
Sbjct: 54  TFVLTITCPDTVGIVAAVSGFLTQYDCFITEAAQYGDPVSRRFFMRIVFAGGALTPAAAE 113

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F  I  +F + + + +     + +I+VS+  HCL DLL+R++ G L + I  V+SN
Sbjct: 114 FRKLFAAIADRFQMIWQLHDLTRKPRVVIMVSKFGHCLVDLLHRYHTGQLNIEIPAVISN 173

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE + +P++YL + + +K   E +++ +I+++  EL++LARYMQILS  LC  
Sbjct: 174 HPDMRSIVEWHGIPYHYLAVDKHDKEAQEGRVMEVIDRSGAELVVLARYMQILSTTLCQT 233

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H 
Sbjct: 234 LQGRAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTADLDEGPIIEQSVERVDHT 293

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +A+G++IE  VL +AV  H++ RV +N  KT+VF
Sbjct: 294 HTPDDLVAMGRDIENLVLGRAVRWHVEHRVLLNGSKTVVF 333


>gi|33593497|ref|NP_881141.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33598018|ref|NP_885661.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis 12822]
 gi|33572853|emb|CAE42786.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33574447|emb|CAE38785.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis]
 gi|332382905|gb|AEE67752.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           CS]
          Length = 282

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M  Y+L + C     I   I   L  +GCNI + +QF++  T+  +MR+ F      C++
Sbjct: 1   MKQYVLLLKCLDRPGIVHEISGGLFQEGCNIEESAQFSESGTAVFYMRVRFSAPDRACVQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 + +        +I +  + ++ LILVS+  HCLNDLL+R   G L +++ GVVS
Sbjct: 61  KIATALKRLYNGDEAGLAIHDMDKRSRVLILVSKHGHCLNDLLFRQRSGLLNMDVAGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L  +Y +PF++ P+T Q + E E ++++++     +L++LARYMQILSD   +
Sbjct: 121 NHPDFRELAASYDIPFHHFPVTPQTRAEQEGRILDLVASTQSDLVVLARYMQILSDRASN 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   ELD GPIIEQDV RV+H
Sbjct: 181 ALSGRAINIHHSFLPGFKGARPYYQAYDRGVKLIGATAHYVTSELDEGPIIEQDVARVSH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   +    +G+++E   L +AV  H + R+ +N RKTIVF
Sbjct: 241 SLEPQALTDVGRDVECMTLARAVKWHTEHRIILNGRKTIVF 281


>gi|186472152|ref|YP_001859494.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
 gi|184194484|gb|ACC72448.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
          Length = 292

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 180/283 (63%), Gaps = 7/283 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTCMK 58
           + LT++CPS     + I  +L    C I +++ F+D  + + F+R  F       +  + 
Sbjct: 10  FALTLSCPSAAGQVAAIVGFLDRHHCYIDELTVFDDDISERFFVRCVFHGVGSAPDAALH 69

Query: 59  L--FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     +F+PI   F + +++ + +   K LI+VS+ +HCL DLL+RW +G L ++I G+
Sbjct: 70  IDTLRHEFRPIAADFDMTWAMHDLEMRPKVLIMVSKLEHCLADLLFRWRMGELKMDIAGI 129

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
            SNH   + L   + LPF++ P+T   K + E +++++ +K+  ELMILARYMQILSD  
Sbjct: 130 ASNHPDFQPLAAQHGLPFHHFPLTPDTKAQQEAQILDLFDKSGAELMILARYMQILSDET 189

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K++GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ+V RV
Sbjct: 190 SRKLSGRAINIHHSFLPGFKGARPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQEVQRV 249

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+   E  +A+G+++E   L +AV A +++RVFIN  +T+V 
Sbjct: 250 DHSYGPERMLAVGRDVECITLARAVKAFVERRVFINGDRTVVL 292


>gi|331010429|gb|EGH90485.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 269

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/259 (44%), Positives = 169/259 (65%), Gaps = 4/259 (1%)

Query: 25  STQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKLFIADFQPIVQQFSLQYSIRNT 80
           +  GC I +++QF+D  +   FMR  F FN      ++     F  + + F++Q+ + +T
Sbjct: 10  AGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDIQQLKTGFDVVAKDFAMQWELHDT 69

Query: 81  KEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMT 140
           +   + L++VS+ DHCL DLLYR++ G + + I  +VSNH   + + E   + F YLP++
Sbjct: 70  RRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSNHLDLRPMAEREGIRFIYLPVS 129

Query: 141 EQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANP 200
           ++ K   E  L+ ++++   EL++LARYMQILSD LC ++ GR INIHHSFLP FKGA P
Sbjct: 130 KETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCKQLAGRAINIHHSFLPGFKGAKP 189

Query: 201 YKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKA 260
           Y QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H    ED +A G+N E   L++A
Sbjct: 190 YHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDHVYLPEDLVAAGRNNETIALSRA 249

Query: 261 VNAHIQQRVFINKRKTIVF 279
           V  H++ RVF+N  +T++F
Sbjct: 250 VKYHLEHRVFLNTDRTVIF 268


>gi|308178492|ref|YP_003917898.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307745955|emb|CBT76927.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 286

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 176/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA- 62
           ++LT+ CP    I + +  +L      I+++ QF+D+   +LF+R+ F       L    
Sbjct: 7   HVLTLQCPEGMGIVNAVTGFLVKHERTIVELKQFDDVSAGRLFLRVEFSGEAEENLLAEL 66

Query: 63  --DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             +F  I  +F + + +R   + T+ LI+VS+ DHCLNDLL+R   G L + IV V SNH
Sbjct: 67  REEFTAIAAKFEMDWQLRERGQKTRVLIMVSKYDHCLNDLLFRSRTGELPIEIVAVASNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LV+ + + ++++P++++ K ++E KL+ +I +   EL++LARYMQ+LSDHL  ++
Sbjct: 127 EDSRDLVQWHGIEYHHIPISKETKPQAEAKLLELISQTGAELVVLARYMQVLSDHLATEL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H  
Sbjct: 187 TGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHTF 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              + IA G++ E + L+ AV  H + RVF+   +T++ 
Sbjct: 247 GPSELIAAGRDSECRALSNAVRWHCEGRVFLYGNRTVIL 285


>gi|330818331|ref|YP_004362036.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
 gi|327370724|gb|AEA62080.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
          Length = 293

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 179/287 (62%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT------C 56
           S+IL ++CP    I   +  +L  +  NI+D +QF D  T + FMR+ F   T       
Sbjct: 6   SFILKLSCPDKHGIVHAVSGFLFERDTNIVDSAQFGDSRTGEFFMRVHFDQTTNSDAEST 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     +F P+ ++F++ + + +  +  + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDTLRNEFAPLAERFAMHWEMHDALKKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIAAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P+      E     E +++ +I ++  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDVPFHHFPLAAGASAEAKAAQEARVLEVIGEHATDLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPQLCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T E   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRILLNGTKTVVF 292


>gi|189188610|ref|XP_001930644.1| formyltetrahydrofolate deformylase hydrolase [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187972250|gb|EDU39749.1| formyltetrahydrofolate deformylase hydrolase [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 282

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 179/274 (65%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT++CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F     +    +  +
Sbjct: 8   LTLSCPDKAGIVYAVTGLLAKENLTILDLQQFSDPVSKTFFMRVHFGHAADVSALQSSME 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +  + S+ Y I+      + LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLAAEMSMTYQIQRVDAKPRVLIMVSKIGHCLNDLLFRVKSGQLKIAVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           L +N  + F++LP+T+  K   E +++++I+++N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 LAKNNGIEFHHLPVTKDTKEHQETQILDLIKQHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  G N+E++VL  AV    ++RVF+N +KT+VF
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGQKTVVF 281


>gi|119714891|ref|YP_921856.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
 gi|119535552|gb|ABL80169.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
          Length = 284

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 179/281 (63%), Gaps = 9/281 (3%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTCMK 58
           ILT++C     I + +  +L+ +G +I D  QF D D+   F+R+         F+T   
Sbjct: 6   ILTLSCKDRPGIVAAVAGFLADRGFSIRDSQQFGDEDSELFFIRVHAASEMPVEFDTLRA 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F      +++     +++ +     + L++VS+  HCLNDLL+R   G+LA ++V +VS
Sbjct: 66  EFDTTIGSVLEA---SWALHDPSVKHRLLLMVSRQGHCLNDLLHRVRTGSLAADVVAIVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++LVE + +PF+++P+T ++K  +E +L  ++   + + +ILARYMQILSD LC 
Sbjct: 123 NHEDFRELVEWHGIPFHHVPVTAESKDWAEDELRKLVAAYDADSVILARYMQILSDSLCR 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHS LPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD +RV H
Sbjct: 183 DLAGRAINIHHSLLPSFKGARPYYQAHARGVKVIGATAHYVTADLDEGPIIEQDFIRVDH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +++  D  AIG+++EA  L +AV AH + RV +N  +T+VF
Sbjct: 243 SKSAADLTAIGRDLEALALARAVTAHTEHRVLMNGSRTVVF 283


>gi|63002616|dbj|BAD97821.1| 10-formyltetrahydrofolate hydrolase [Corynebacterium sp. U-96]
          Length = 281

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 116/271 (42%), Positives = 173/271 (63%), Gaps = 3/271 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LT+ CP    I   +  +L      I+++ QF+D+  S+ FMR+ F        ++  
Sbjct: 7   HVLTLQCPEGLGIVHAVSKFLLDHERTIVELKQFDDMPASRFFMRVEFAGAEEPGLLEKL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI   + + + +   ++ TK LI+VS+ DHCLNDLL+R   G L + +V VVSNH
Sbjct: 67  RTGFEPIAASYQMDWKLHPREKRTKVLIMVSKFDHCLNDLLFRARTGELPIEVVAVVSNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LVE + + ++++P++++ K ++E +L+ +IE    EL++LARYMQ+LSD L  ++
Sbjct: 127 PDSRSLVEWHGIDYHHVPISKETKPQAEAELLRLIESTGAELVVLARYMQVLSDGLSREL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H  
Sbjct: 187 TGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHTY 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFI 271
             +D +A G++ E K L+ AV  H + RVF+
Sbjct: 247 GPQDLVAAGRDTECKALSNAVRWHCEGRVFL 277


>gi|88855797|ref|ZP_01130460.1| formyletrahydrofolate deformylase [marine actinobacterium PHSC20C1]
 gi|88815121|gb|EAR24980.1| formyletrahydrofolate deformylase [marine actinobacterium PHSC20C1]
          Length = 284

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 116/277 (41%), Positives = 179/277 (64%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +I+T+TC     I   I   +   G NI +  QF+  DT + FMR+    +     F   
Sbjct: 7   WIVTLTCDDKPGIVHAISGAIVEAGGNITESQQFSSGDTGRFFMRLQVESDASRDDFETA 66

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             P+ +++++++ +       +TL+L S+  HC+NDLLYR   G LA+ +  ++SNH   
Sbjct: 67  LAPVTERYTMEWQLDVVGRPLRTLVLASKSGHCVNDLLYRQRAGQLAIEMPLIMSNHPDL 126

Query: 124 KKLVENYQLPFYYLPMTEQN-KIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
             L E Y++PF   P+T    K+  E +++ ++E++++EL++LARYMQILS  LC +++G
Sbjct: 127 GSLAEFYEVPFESHPVTTPGQKLAFEDRILEVVEQHDIELVVLARYMQILSPELCKQLSG 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLP FKGANPYKQA+  GVK+IGATAH+   +LD GPIIEQ+VVRV HA T 
Sbjct: 187 KIINIHHSFLPGFKGANPYKQAHARGVKLIGATAHFVTSDLDEGPIIEQNVVRVDHASTA 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ++IG++ E++ LT+AV    + RV ++  +TI+F
Sbjct: 247 SELVSIGQDEESRTLTQAVKWFAEDRVLLDGARTIIF 283


>gi|297571827|ref|YP_003697601.1| formyltetrahydrofolate deformylase [Arcanobacterium haemolyticum
           DSM 20595]
 gi|296932174|gb|ADH92982.1| formyltetrahydrofolate deformylase [Arcanobacterium haemolyticum
           DSM 20595]
          Length = 282

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 118/277 (42%), Positives = 174/277 (62%), Gaps = 1/277 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           S I TI+CP    I   +   L+  G N+    Q+ D    + ++R+            A
Sbjct: 6   SLIFTISCPDQPGIVYAVTGLLTQVGANVTQSQQYRDPSQDRFYIRLQADVPGGRPTIDA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +  ++++ Y+I +     +T+I+ S+  HCL+DLL +   G L LN+  VVSNH T
Sbjct: 66  AFAALGARYNMDYTISDAS-PMRTIIMCSKEPHCLSDLLAKQREGRLPLNVAAVVSNHET 124

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L E Y++PF ++P+T+  K E+E +L+ ++E+   EL++LARYMQ+LSD +C K+ G
Sbjct: 125 LRLLAEFYEVPFTHIPVTKDTKPEAEAQLLKLVEETGAELVVLARYMQVLSDSICEKLAG 184

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+HA  +
Sbjct: 185 KIINIHHSFLPSFKGARPYAQAHARGVKLIGATAHYVTADLDEGPIIEQDVARVSHAHDV 244

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  A+G  +E +VL++AV  H + RV     +T+VF
Sbjct: 245 TELQAMGAEVERQVLSRAVRWHAEHRVLHAGLRTVVF 281


>gi|294146545|ref|YP_003559211.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
 gi|292676962|dbj|BAI98479.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
          Length = 285

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 172/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKLFI 61
            +IL ++CP    I + +   L + G NI D  QFND +T+K FMR+   F +     F 
Sbjct: 4   DHILKLSCPDRPGIVAAVSAALFSAGANITDAQQFNDPETNKFFMRVVARFPDDRTVAFE 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +   F +Q+S+R   +  + + LVS+ DHCL  LLY   IG + +++V ++SNH 
Sbjct: 64  NMFIDVAAGFGMQWSLRPAAQRRRVVALVSKFDHCLGHLLYGSRIGEIDMDVVAIISNHP 123

Query: 122 THKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                + ++   +P+++ P+   N+   E ++   I  +  EL++LARYMQILSD L   
Sbjct: 124 KEALTIRSWLEDIPYHHFPVARDNRAAQEARIKETIVASGAELVVLARYMQILSDDLAAF 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V+HA
Sbjct: 184 LAGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEMVSHA 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T E  +  G+NIE +VL++AV  H+Q RVFIN  KT+VF
Sbjct: 244 DTPEALVGKGRNIEQRVLSRAVQYHVQDRVFINANKTVVF 283


>gi|238028647|ref|YP_002912878.1| formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
 gi|237877841|gb|ACR30174.1| Formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
          Length = 293

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 180/287 (62%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +  NI+D +QF D  T + FMR+ F         T 
Sbjct: 6   SFILKLSCPDKHGIVHAVSGFLFERDTNIVDSAQFGDSRTGEFFMRVHFDQASAADAGTA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +      F P+ ++F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDTLRDAFAPLAERFAMRWELHDASIKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIAAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQ----KLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P+      +++     +++ +I++++ +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDVPFHHFPLVAGASAQAKAAQEARVLEVIDEHSADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  +C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SQDMCRRLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T E   AIG+++E   L +AV  H++ R+  N  KT+VF
Sbjct: 246 VERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRILQNGTKTVVF 292


>gi|193213317|ref|YP_001999270.1| formyltetrahydrofolate deformylase [Chlorobaculum parvum NCIB 8327]
 gi|193086794|gb|ACF12070.1| formyltetrahydrofolate deformylase [Chlorobaculum parvum NCIB 8327]
          Length = 289

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 183/281 (65%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S  +L ++CP    + + I +++  +G NILD+++  D+D  + F+R+S+    F+    
Sbjct: 8   SKAVLLLSCPDRVGLVARIANFIYERGGNILDLNEHVDVDERQFFLRVSWSLDNFSIPAD 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ ++F   ++IR +    +  + VS+ DHCL ++L+R ++G   ++I  V+S
Sbjct: 68  DLESAFAPLAREFRANWTIRFSGTRNRMAVFVSKYDHCLREILWRHSLGEFDIDIPLVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     LVE + +PF+ +P+T + K  +EQ+ + + E++ ++ ++LARYMQ+LS     
Sbjct: 128 NHPDLAPLVEAHGIPFHVVPVTPETKAAAEQRQMALCEEHGIDTIVLARYMQVLSPEFTG 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F G NPY+QAY  GVK+IGAT+HY   ELD GPIIEQD++R+TH
Sbjct: 188 RWAGRIINIHHSFLPAFVGGNPYRQAYRRGVKLIGATSHYVTDELDEGPIIEQDIIRITH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T++D +  G+++E  VL +A+  H   R+ IN RKT+VF
Sbjct: 248 RDTLDDLVRKGRDLERLVLARALRLHCDHRILINGRKTVVF 288


>gi|254514739|ref|ZP_05126800.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR5-3]
 gi|219676982|gb|EED33347.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR5-3]
          Length = 286

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TC-MKL 59
           SYILT +CP +  + +   +     G NI +IS + D  ++  F+R  F  +  +C ++ 
Sbjct: 7   SYILTFSCPDSIGVVARYANLFYECGINITEISNYTDPVSNTFFLRCVFDVSGMSCSLEQ 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A  +P+V    + Y++R      K +I VS+ DHCL  LL +   G L   IV VVSN
Sbjct: 67  FEARLKPVVDDLRMDYTLRCATTWPKVVIAVSRYDHCLTALLTKQRAGALPAEIVAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L E + +PFYYLP+T + K   EQ+L+ I+E  + +L++LARYMQILSD LC K
Sbjct: 127 HEDCRALSEWHNIPFYYLPITRETKPAQEQELLGILENCDADLLVLARYMQILSDDLCAK 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPII Q+V  + H 
Sbjct: 187 LAGRAINIHHSFLPGFKGARPYHQAYDRGVKVIGATAHYVTADLDEGPIIAQEVRPIDHE 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++E  + +G + EA  L++AV  H +QRV +N ++T++ 
Sbjct: 247 ISVEQMVHLGHDTEATALSQAVRLHCEQRVILNGQRTVIL 286


>gi|227819894|ref|YP_002823865.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|36958741|gb|AAQ87209.1| Formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227338893|gb|ACP23112.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 283

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 184/282 (65%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S++ LT++C     I + +   L+  G NI + +QF D  +++LFMRI+F      K+  
Sbjct: 3   SNFTLTLSCEDRPGIVAAVTTELAACGANIAESNQFWDRQSNRLFMRIAFT--APEKISR 60

Query: 62  AD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            D     +P+  +F ++  + ++    K +I+VS+ DH +  LLY+  +G L   +  +V
Sbjct: 61  DDVERSLKPVTDRFDMKTKLVDSDRKPKIIIMVSKFDHAMLHLLYQIRVGWLNAEVAAIV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH       +   +P+Y+  +T++NK E E++LI ++     +LMILARYMQ+LSD+L 
Sbjct: 121 SNHEDSAATAKLEGIPYYHWKVTKENKAEQEERLIELVRDTGADLMILARYMQVLSDNLS 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G++INIHHSFLPSFKGA PY QA++ GVK+IGAT+HY   +LD GPIIEQ+  RVT
Sbjct: 181 TRLFGKVINIHHSFLPSFKGAKPYHQAFDRGVKLIGATSHYVTPDLDEGPIIEQETERVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T +D++A G++IE++VL +AV  H++ RV +N  KTIVF
Sbjct: 241 HAMTADDFVATGRDIESRVLARAVKMHLECRVMLNGHKTIVF 282


>gi|300310922|ref|YP_003775014.1| formyltetrahydrofolate deformylase [Herbaspirillum seropedicae
           SmR1]
 gi|300073707|gb|ADJ63106.1| formyltetrahydrofolate deformylase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 289

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 178/286 (62%), Gaps = 13/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTCM 57
           YILT++C     I   +  +L+  GCNI+D +QF D  +   FMR+ F      V +  +
Sbjct: 6   YILTLSCLDQRGIVHRVSGFLADHGCNIIDSAQFGDAQSKLFFMRVHFSSEDASVSDAAL 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   ADF  +     + + + +  +  + +++VS+  HCLNDLL+R+  G L + I  +V
Sbjct: 66  R---ADFGVLGDALQMNWQLHDAGKKPRVMLMVSKIGHCLNDLLFRYKSGLLPVEIPAIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIE----SEQKLINIIEKNNVELMILARYMQILS 173
           SNHT   +L  +Y +PF++LP+     +E     EQ+++ I+E N ++L++LARYMQILS
Sbjct: 123 SNHTDFYQLAASYNIPFHHLPLATGAPMEVKRAQEQRIMEIVEANQIDLVVLARYMQILS 182

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             +C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 183 PEMCEALRGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHFVTGDLDEGPIIEQGV 242

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV H+   +   AIG++IE  VL +AV    + R+ +N  KT++F
Sbjct: 243 ERVDHSMGPDTLTAIGRDIECVVLARAVKWFTEHRILLNGHKTVIF 288


>gi|322712667|gb|EFZ04240.1| formyltetrahydrofolate deformylase [Metarhizium anisopliae ARSEF
           23]
          Length = 316

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 179/311 (57%), Gaps = 33/311 (10%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           + YILT++CP    I   +    +  G N+LD+ QF+D  + + FMR+ F         +
Sbjct: 5   NDYILTLSCPDKPGIVHAVTAVFAAHGHNVLDLQQFSDPASRRFFMRVHFGPKAGAVTAE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV---- 114
                F  +   + + Y IR   +  K LI+VS+  HCLNDLL+R   G L + +     
Sbjct: 65  HLARPFDELAAAYEMAYDIRPVAQKMKVLIMVSKIGHCLNDLLFRMKTGQLKMEVYVFHA 124

Query: 115 --------------------------GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESE 148
                                      +VSNH  ++ L  +Y + F++LP+T+  K + E
Sbjct: 125 SPAFIINKKNREARREEHQLTPRQVPVIVSNHADYEPLAASYGIEFHHLPVTKDTKAQQE 184

Query: 149 QKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYG 208
            ++++++ ++ +EL++LARYMQ+LS  LC  M+GRIINIHHSFLPSFKGA PY QAYE G
Sbjct: 185 ARVLDLVRRHGIELVVLARYMQVLSPTLCEAMSGRIINIHHSFLPSFKGAKPYHQAYERG 244

Query: 209 VKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQR 268
           VKIIGATAH+   +LD GPIIEQ V RV H+   ++ +  G N+E++VL  AV  +  +R
Sbjct: 245 VKIIGATAHFVTADLDEGPIIEQRVARVDHSMGPQELVEEGSNVESQVLAAAVRWYADRR 304

Query: 269 VFINKRKTIVF 279
           VF+N  KT+VF
Sbjct: 305 VFLNGSKTVVF 315


>gi|21674639|ref|NP_662704.1| formyltetrahydrofolate deformylase [Chlorobium tepidum TLS]
 gi|21647842|gb|AAM73046.1| formyltetrahydrofolate deformylase [Chlorobium tepidum TLS]
          Length = 289

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 185/281 (65%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S  IL ++CP    + + I +++  +G NILD+++  D+D  + F+R+S+    F+   +
Sbjct: 8   SKAILLLSCPDRVGLVARIANFIYERGGNILDLNEHVDVDERQFFLRVSWSLDHFSIPAE 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ ++F   + IR + + ++  + VS+ DHCL ++L+R ++G   +++  V+S
Sbjct: 68  DLESAFAPLGREFRANWQIRLSGKRSRMAVFVSKYDHCLREILWRHSLGEFDIDLPLVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     LVE + +PF+ +P+T + K  +EQ+ + + +++ ++ ++LARYMQ+LS     
Sbjct: 128 NHPDLAPLVEAHGIPFHVIPVTPEAKAAAEQRQMALCDEHGIDTIVLARYMQVLSPEFTR 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F G NPY+QAY  GVK+IGAT+HY   ELD GPIIEQD++R+TH
Sbjct: 188 RWVGRIINIHHSFLPAFVGGNPYRQAYRRGVKLIGATSHYVTDELDEGPIIEQDIIRITH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED +  G+++E  VL +A+  H   R+ +N RKT+VF
Sbjct: 248 RDTLEDLVRKGRDLERLVLARALRLHCDHRILLNGRKTVVF 288


>gi|25169086|emb|CAD47922.1| putative formyltetrahydrofolate deformylase [Arthrobacter
           nicotinovorans]
          Length = 287

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 177/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR--ISFVFNTCMKLFIA 62
           IL+++C     I   +  +L + GCNIL   QF+D    + FMR  IS      +    +
Sbjct: 10  ILSLSCRDRIGIVHAVSGFLVSHGCNILASQQFDDAAERRFFMRVHISCPATVSIGDLKS 69

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +   + +++++ +  +  K  +LVS+ +HCLNDLL+RW  G L ++   + SNH T
Sbjct: 70  AFLAVASTYEMEWTLVDASDRPKVALLVSKAEHCLNDLLFRWRSGQLKVDFPFIASNHAT 129

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + + + + +PF+++P+T + K E+E+ L+ ++ ++ VEL +LARYMQ+LSD+LC ++ G
Sbjct: 130 LQPVADAHGIPFFHIPVTPETKQEAEEHLLALLAEHEVELTVLARYMQVLSDNLCRELAG 189

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           + INIHHSFLP FKGA PY QA++ GVK++GATAHY   ELD GPIIEQ+V+RV H  + 
Sbjct: 190 KAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTAELDEGPIIEQEVLRVGHDYSP 249

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 G++ E   L++AV  H +QR+ +N  +T+VF
Sbjct: 250 AQLAVAGQDAERLALSRAVQWHAEQRILLNGHRTVVF 286


>gi|169617319|ref|XP_001802074.1| hypothetical protein SNOG_11837 [Phaeosphaeria nodorum SN15]
 gi|111059761|gb|EAT80881.1| hypothetical protein SNOG_11837 [Phaeosphaeria nodorum SN15]
          Length = 282

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 120/274 (43%), Positives = 175/274 (63%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT+ CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F  +  +       +
Sbjct: 8   LTLQCPDKAGIVYAVTGLLAKENLTILDLQQFSDPMSKTFFMRVHFGHSAELNGLQESMK 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +     + Y IR      K LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLAADMQMDYQIRRVDAKPKVLIMVSKIGHCLNDLLFRVKSGQLKVEVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           + +N  + F++LP+T+  K + E +++++I K+N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 VSKNNGIEFHHLPVTKDTKEQQETQILDLIAKHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  G N+E++VL  AV    ++RVF+N  KT+VF
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGAKTVVF 281


>gi|254299819|ref|ZP_04967267.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
 gi|157809744|gb|EDO86914.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
          Length = 291

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 176/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +   L+   C + +++ F+D  +++ F+R  F           D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLARHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVD 69

Query: 64  -----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+VS
Sbjct: 70  ALRREFEPIAERFRMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPEASA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 RLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|238027291|ref|YP_002911522.1| putative formyltetrahydrofolate deformylase protein [Burkholderia
           glumae BGR1]
 gi|237876485|gb|ACR28818.1| Putative formyltetrahydrofolate deformylase protein [Burkholderia
           glumae BGR1]
          Length = 333

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 173/295 (58%), Gaps = 19/295 (6%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT--------------SKLFMRI 49
           ++L ++CP +  +   +   L   GCNI+D  QF+D D                + FMR+
Sbjct: 38  FVLRLSCPDSRGVVYAVSRALYEAGCNIVDAQQFSDFDACATPAGTDGTAAAPGRFFMRV 97

Query: 50  SF--VFNTCMKLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNI 106
                        IA    P+ + + +Q  + +     +  ILVS+  HCLNDL++R ++
Sbjct: 98  HLEAPGRAAGPEAIARLLDPLRRDYDMQIEVHDAGWRPRAAILVSREGHCLNDLMFRQSV 157

Query: 107 GTLALNIVGVVSNHTTHKKLVENYQLPFYYLPM--TEQNKIESEQKLINIIEKNNVELMI 164
           G L + I  VVSNH   +++ E   L F++LP+      K   E +L+ ++E+  VEL++
Sbjct: 158 GQLPVEIAAVVSNHEDLREMAERSGLAFHHLPLDAAAGGKPAQEARLLGLLERERVELVV 217

Query: 165 LARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELD 224
           LARYMQILS  LC ++ GR INIHHSFLPSFKGA PY+QA+  GVK+IGATAHY   +LD
Sbjct: 218 LARYMQILSPELCERLRGRAINIHHSFLPSFKGAQPYRQAHARGVKLIGATAHYVTSDLD 277

Query: 225 AGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            GPIIEQDV RV HA    +  AIG++IE  VL +A+  H + RV +N  +T+VF
Sbjct: 278 EGPIIEQDVERVDHAAGPRELAAIGRDIECVVLARALKWHCEHRVLMNGARTVVF 332


>gi|118591547|ref|ZP_01548944.1| probable formyltetrahydrofolate deformylase [Stappia aggregata IAM
           12614]
 gi|118435875|gb|EAV42519.1| probable formyltetrahydrofolate deformylase [Stappia aggregata IAM
           12614]
          Length = 285

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 186/280 (66%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKL 59
           S Y+LT++C     I + +   L+  G NI +  QF D  T++ F+RI+ +      ++ 
Sbjct: 4   SLYVLTLSCADKPGIVAAVTTELADFGANIAESDQFWDRVTNQFFLRIAMLAPEGVTLES 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P++ +F ++  + +T +  K +++VS+ DH +  LLY+  +G +   +V +VSN
Sbjct: 64  VQKALDPVISRFDMKAKLVDTAKRPKVIVMVSKFDHAMLHLLYQIRVGWMDAEVVAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT  ++  E+  + +++ P+ ++NK E E+KL+ ++++   +L++LARYMQ+LSD+L  +
Sbjct: 124 HTDSQRTAEHEGIAYHHWPVNKENKAEQEEKLLKLVKETGADLVVLARYMQVLSDNLSKR 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD  RV+HA
Sbjct: 184 LFGKIINIHHSFLPSFKGAKPYHQAHTRGVKMIGATAHYVTPDLDEGPIIEQDAERVSHA 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +D++A G++IE++VL +AV  H++ RV I   KTIVF
Sbjct: 244 LSADDFVARGRDIESRVLARAVKYHLENRVMIVGNKTIVF 283


>gi|50955477|ref|YP_062765.1| formyletrahydrofolate deformylase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951959|gb|AAT89660.1| formyletrahydrofolate deformylase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 290

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/277 (42%), Positives = 172/277 (62%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT +C     I   +   +     NI +  QF   DT + FMR+        + F   
Sbjct: 13  WVLTFSCADRPGIVHAVSGAIVAARGNITESQQFASTDTGRFFMRLQVESAADREEFERA 72

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             PIV QF + + + N     +TL+LVS   HCLNDLL+R   G L + I  V+SNH T 
Sbjct: 73  LAPIVTQFGMSHRVDNVGRPLRTLVLVSTAAHCLNDLLFRQRAGHLPVEIPLVLSNHGTL 132

Query: 124 KKLVENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
           + L   Y +PF   P+T+  +K   E++ +  +E++ +EL++LARYMQILS  LC ++ G
Sbjct: 133 RDLAGFYGVPFESAPVTDPASKAAFEERTLAAVEEHGIELVVLARYMQILSPELCERLAG 192

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGANPY+QA+  GVK+IGATAH+   +LD GPIIEQ+VVRV HA ++
Sbjct: 193 RAINIHHSFLPGFKGANPYRQAHARGVKLIGATAHFVTSDLDEGPIIEQNVVRVDHASSV 252

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +AIG++ E++ LT+AV    + RV ++  +TI+F
Sbjct: 253 PELVAIGQDEESRTLTQAVKWFAEDRVLLDGARTIIF 289


>gi|296117377|ref|ZP_06835967.1| formyltetrahydrofolate deformylase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976143|gb|EFG82931.1| formyltetrahydrofolate deformylase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 288

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 181/288 (62%), Gaps = 10/288 (3%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFN 54
           MS YILT+ C +   I + I   L   GC+I +  QF+  ++   FMR+ F         
Sbjct: 4   MSVYILTLRCMNRPGIVAAISSTLFGAGCDITEAQQFDAWESRSFFMRVVFRMPVHAAAE 63

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
           T ++  +A    + ++F + +++R   + T+T+++VS+ DHCL DLLYRW IG L+++ V
Sbjct: 64  TTLRDAVAT---MAREFEMHWTLRARAQPTRTVLMVSRFDHCLVDLLYRWRIGELSIDPV 120

Query: 115 GVVSNHTTHKKL-VENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
            +++NH       ++   + F+YLP+T   +   E ++ +I+     EL++LARYMQ+LS
Sbjct: 121 AIIANHPRETYADIDFGDIAFHYLPVTAATRPVQEARIWDIVSGTGAELVVLARYMQVLS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D L  ++ GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQDV
Sbjct: 181 DSLVSRLAGRCINIHHSFLPGFKGARPYHQAFARGVKLIGATAHFVTGDLDEGPIIEQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
            R++HA + +D +  G++IE +VL +AV    + R+  + RKTIVF A
Sbjct: 241 ERISHADSPDDLVRKGRDIERRVLARAVRYFTECRIIPDGRKTIVFSA 288


>gi|330917643|ref|XP_003297896.1| hypothetical protein PTT_08452 [Pyrenophora teres f. teres 0-1]
 gi|311329197|gb|EFQ94027.1| hypothetical protein PTT_08452 [Pyrenophora teres f. teres 0-1]
          Length = 282

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 179/274 (65%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT+ CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F     +    +  +
Sbjct: 8   LTLCCPDKAGIVYAVTGLLAKENLTILDLQQFSDPVSKTFFMRVHFGHAADVSALQSSME 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +  + ++ Y I+      + LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLASEMNMTYQIQRVDAKPRVLIMVSKIGHCLNDLLFRVKSGQLKVAVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           L +N  + F++LP+T+  K + E +++++I+++N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 LAKNNGIEFHHLPVTKDTKEQQETQILDLIKQHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  G N+E++VL  AV    ++RVF+N +KT+VF
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGQKTVVF 281


>gi|134094227|ref|YP_001099302.1| formyltetrahydrofolate deformylase [Herminiimonas arsenicoxydans]
 gi|133738130|emb|CAL61175.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Herminiimonas arsenicoxydans]
          Length = 288

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 174/283 (61%), Gaps = 7/283 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLF 60
           YIL ++C     I   +  YL+  GCNILD +QF D  +   FMR+ F         ++ 
Sbjct: 5   YILNLSCLDQRGIVQRVSAYLAGHGCNILDSAQFGDAQSKLFFMRVHFAVEEETLTDEVL 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F  +     + + + +  +  + L++VS   HCLNDLL+R+  G L ++I  ++SNH
Sbjct: 65  RSTFATLADTMQMDWQLHDAHKKPRMLLMVSSIGHCLNDLLFRYKSGLLPVDIPAIISNH 124

Query: 121 TTHKKLVENYQLPFYYLPMT----EQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           T   +L  +Y +PF++LP+     E  K   EQ+++ I++  +++L++LARYMQILS  +
Sbjct: 125 TDFYQLAASYNIPFHHLPLATGAPESAKRMQEQRILEIVKAADIDLIVLARYMQILSPEM 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAH+    LD GPIIEQDV RV
Sbjct: 185 CAALEGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHFVTGHLDEGPIIEQDVARV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA       AIG+++E  VL +AV   ++ R+ +N  KT+VF
Sbjct: 245 DHAMDPATLTAIGRDVECVVLARAVKYFVEHRILLNGHKTVVF 287


>gi|323530120|ref|YP_004232272.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
 gi|323387122|gb|ADX59212.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
          Length = 291

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 179/280 (63%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   ++   L +A 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGVDSKETLHVAA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+PI ++F + +++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKREFEPIAERFRMTWAMHDVGTRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + + LPF++LP+T   K + E +L+++   +  ELMILARYMQILS      
Sbjct: 131 HRDLEPLAQQHGLPFHHLPITADTKPQQEARLLDLFATSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAGRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|71278117|ref|YP_270288.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71143857|gb|AAZ24330.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
          Length = 292

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 179/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--- 59
           ++++T +CPS      ++  +L  QG  I +I  F+D D  + F+RI F  +T       
Sbjct: 10  THVITASCPSQPGTVDVVTRFLFEQGFYINEIHSFDDTDQDRFFIRIEFRADTATNFNRD 69

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F     +F +++ + ++   +K +I+VS+ DHCLNDLLYR+  G L + I  ++S
Sbjct: 70  DFCQQFGERASEFEMKWELASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLNIEIPAIIS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L + + +P+Y+LP+T++ K E E K+  II+ +  +L++LARYMQ+LS  +C 
Sbjct: 130 NHPDLEDLAKWHDIPYYHLPITKETKPEQEAKVFQIIQDSEADLVVLARYMQVLSSDMCK 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++G+ INIHHS LP FKGA PY QAY+ G+K++GATAHY   +LD GPII Q V  V H
Sbjct: 190 KLSGKAINIHHSLLPGFKGARPYYQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   +D  A G++IE   L +AV  HI+ R+F++ +K++VF
Sbjct: 250 SYYPQDLAAKGRDIECLTLARAVRCHIEHRIFLHGKKSVVF 290


>gi|149377386|ref|ZP_01895130.1| formyltetrahydrofolate deformylase [Marinobacter algicola DG893]
 gi|149358310|gb|EDM46788.1| formyltetrahydrofolate deformylase [Marinobacter algicola DG893]
          Length = 284

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 182/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D  T   FMR     N+    +  
Sbjct: 4   TYRLVISCPDRVGIVAKVSNFLSTYNGWITEASHHSDTQTGWFFMRHEIKANSIPFGLGQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F+PI ++F++ + I ++ +  K +++ S+  HC+ DLL+RW+   +   IV V+SN
Sbjct: 64  FRTAFEPIAREFNMNWHIADSAQPKKVILMCSKESHCVADLLHRWHSREINAEIVAVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE +++P++++P+ + N+ E+  ++  +IE    ++++LARYMQIL   LC K
Sbjct: 124 HEDLRRMVEWHEIPYHHIPVNQNNRDEAFGEVDALIEGYEADVVVLARYMQILPGSLCEK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDVVR++H+
Sbjct: 184 YPGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQDVVRISHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +IED + +GK++E  VL++ + AHI+ RV   + KT+VF
Sbjct: 244 DSIEDMVRLGKDVEKNVLSRGLRAHIEDRVITYENKTVVF 283


>gi|330819976|ref|YP_004348838.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
 gi|327371971|gb|AEA63326.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
          Length = 291

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/283 (40%), Positives = 178/283 (62%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----- 56
           S ++LT++CPS     + +   L +  C + +++ F+D  + + F+R  F  +       
Sbjct: 8   SRFLLTLSCPSAAGQVAAVVGVLDSHRCYVDELTVFDDDLSGRFFVRCVFHASDAADTPD 67

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F PI ++F +Q++I +     K +ILVS+ +HCL DLL+RW +G L ++IVG+
Sbjct: 68  IDALRAEFAPIAERFQMQWAIHDADARPKVMILVSKLEHCLADLLFRWKMGELKMDIVGI 127

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
            SNH     L   + LPF + P+T + K + E + +++ E +  EL+ILARYMQ+LS   
Sbjct: 128 ASNHADLAPLAVQHGLPFRHFPITAETKAQQEAQWLDMFESSGAELVILARYMQVLSPET 187

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV
Sbjct: 188 SAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERV 247

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+   E  + +G+++E+  L +AV A I++RVF+N  +T+VF
Sbjct: 248 DHSYRPEQLLMVGRDMESITLARAVKAFIERRVFLNGDRTVVF 290


>gi|170695640|ref|ZP_02886783.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
 gi|170139439|gb|EDT07624.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
          Length = 291

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 180/280 (64%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   N+   L I+ 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGVNSNETLNISA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+ I ++F +Q+++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKREFESIAERFHMQWAMHDVGTRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + + LPF++LP+T   K + E +L+++ E +  ELMILARYMQILS      
Sbjct: 131 HRDFEPLAQQHGLPFHHLPITADTKPQQEARLLDLFETSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAGRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPDRLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|53717107|ref|YP_105254.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|53721594|ref|YP_110579.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           K96243]
 gi|76817628|ref|YP_337270.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|121597808|ref|YP_990304.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124382324|ref|YP_001024803.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126442957|ref|YP_001061838.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126447488|ref|YP_001079144.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|126456894|ref|YP_001074787.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|134284168|ref|ZP_01770861.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|167002658|ref|ZP_02268448.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
 gi|167722693|ref|ZP_02405929.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei DM98]
 gi|167741661|ref|ZP_02414435.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 14]
 gi|167818853|ref|ZP_02450533.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 91]
 gi|167827227|ref|ZP_02458698.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 9]
 gi|167848719|ref|ZP_02474227.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           B7210]
 gi|167897312|ref|ZP_02484714.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 7894]
 gi|167913977|ref|ZP_02501068.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 112]
 gi|167921891|ref|ZP_02508982.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           BCC215]
 gi|217425463|ref|ZP_03456956.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|226195122|ref|ZP_03790713.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|237510024|ref|ZP_04522739.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
 gi|238563202|ref|ZP_00439259.2| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|242313521|ref|ZP_04812538.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|254175851|ref|ZP_04882510.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|254182315|ref|ZP_04888910.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|254187378|ref|ZP_04893891.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198666|ref|ZP_04905086.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|254203216|ref|ZP_04909578.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|254208551|ref|ZP_04914900.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|254263923|ref|ZP_04954788.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
 gi|254355810|ref|ZP_04972089.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|52212008|emb|CAH38015.1| putative formyltetrahydrofolate deformylase [Burkholderia
           pseudomallei K96243]
 gi|52423077|gb|AAU46647.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|76582101|gb|ABA51575.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|121225606|gb|ABM49137.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124290344|gb|ABM99613.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126222448|gb|ABN85953.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126230662|gb|ABN94075.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|126240342|gb|ABO03454.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|134244486|gb|EBA44591.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|147746261|gb|EDK53339.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|147751238|gb|EDK58306.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|148024781|gb|EDK82964.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|157935059|gb|EDO90729.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160696894|gb|EDP86864.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|169655405|gb|EDS88098.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|184212851|gb|EDU09894.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|217391426|gb|EEC31455.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|225932927|gb|EEH28923.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|235002229|gb|EEP51653.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
 gi|238521169|gb|EEP84623.1| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|242136760|gb|EES23163.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|243061703|gb|EES43889.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
 gi|254214925|gb|EET04310.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
          Length = 291

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F           D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVD 69

Query: 64  -----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+VS
Sbjct: 70  ALRREFEPIAERFRMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPEASA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 RLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|91778531|ref|YP_553739.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
 gi|91691191|gb|ABE34389.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
          Length = 291

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 178/280 (63%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   N+   L  A 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGVNSHETLHAAA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+PI ++F + +++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKREFEPIAERFRMTWAMHDVDTRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + + LPF++LP+T   K + E +L+++ E +  ELMILARYMQILS      
Sbjct: 131 HRDLEPLAQQHGLPFHHLPITADTKPQQEARLLDLFETSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAARAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|254419586|ref|ZP_05033310.1| formyltetrahydrofolate deformylase [Brevundimonas sp. BAL3]
 gi|196185763|gb|EDX80739.1| formyltetrahydrofolate deformylase [Brevundimonas sp. BAL3]
          Length = 280

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 174/278 (62%), Gaps = 4/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFIA 62
           ILT++CP    I + +  +L  +  NI D  QF D  ++  FMR+ F       +    A
Sbjct: 2   ILTLSCPDRHGIVAAVSAFLLERDANISDAQQFGDASSATFFMRVVFEPADGDALAAIHA 61

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F P+  +F++ +++R   E  K +IL S+ DHCL DLLYRW I  L + +  VVSNH  
Sbjct: 62  AFTPLADRFAMDWTLRG-PEPRKVMILTSKFDHCLADLLYRWRIDELPMEVTAVVSNHPR 120

Query: 123 HK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
                V+   L F++LP++  +K   E +L+ +IE    EL++LARYMQILSD L  ++ 
Sbjct: 121 EMIGHVDLGDLLFHHLPVSAADKPAQEAELLRLIESTGTELVVLARYMQILSDDLSRRLE 180

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++H  T
Sbjct: 181 GRCINIHHSFLPGFKGARPYHQAHARGVKVIGATAHYVTPDLDEGPIIEQDVERISHRDT 240

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED I  G++IE +VL +AV  H++ RV ++  KT+VF
Sbjct: 241 PEDLIRKGRDIERRVLARAVRRHLEDRVLLHGTKTVVF 278


>gi|294011332|ref|YP_003544792.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
 gi|292674662|dbj|BAI96180.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
          Length = 279

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 173/279 (62%), Gaps = 5/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCM---KLF 60
           +LT+ C     I + +  +L+ +G  I D  Q+ D    + FMR++F   +  M      
Sbjct: 1   MLTLACADRVGIVAAVSQFLAERGGFITDSQQYADRKAGRFFMRVAFEATDDGMGDTDRL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             +F  +  +F++ + +    E  + LI VS+  HCL DLL+RW  GTLA++I+GV SNH
Sbjct: 61  RGEFGDVGARFAMDWRLTAADEKPRMLIAVSKGSHCLADLLHRWQTGTLAVDIMGVASNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++ E + +P++ LP    +K   E+ L ++ E+   E +ILARYMQ+LS+ L  ++
Sbjct: 121 PDMRRITEWHGIPYHELP-PNGDKAAQEEALFSLFERTRSEYLILARYMQVLSEGLVERL 179

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV H  
Sbjct: 180 AGRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERVDHRA 239

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED I IG++IEA+VL +AV+    +RV  N  KT+VF
Sbjct: 240 TAEDMIRIGRDIEAQVLARAVSWLADRRVLQNGGKTVVF 278


>gi|71279439|ref|YP_269198.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71281589|ref|YP_270694.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71145179|gb|AAZ25652.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71147329|gb|AAZ27802.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
          Length = 292

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 180/281 (64%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--- 59
           ++I+T  CPS      ++  +L  +G  I +I  F+D   ++ F+RI F   T       
Sbjct: 10  THIITADCPSRPGTVDVVTRFLCEKGFYINEIHSFDDTAVNRFFIRIEFRAQTATDFSAE 69

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F  +F+    +F +Q+ + ++   +K +I+VS+ DHCLNDLLYR+  G L + I  ++S
Sbjct: 70  TFSQEFEQRASEFEMQWQLASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLDIEIPAIIS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L + + +P+Y+LP+T+  K E E K+  II++++ +L++LARYMQ+LS  LC 
Sbjct: 130 NHPDLEELAKWHGIPYYHLPITKDTKPEQEAKVWQIIQESDADLVVLARYMQVLSSDLCQ 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++G+ INIHHS LP FKGA PY QAY+ G+K++GATAHY   +LD GPII Q V  V H
Sbjct: 190 KLSGKAINIHHSLLPGFKGARPYFQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D  A G++IE   L++AV  HI+ R+F+  +KT+VF
Sbjct: 250 GYYPKDLAAKGRDIECLTLSRAVRCHIEHRIFMYGKKTVVF 290


>gi|167905673|ref|ZP_02492878.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei NCTC
           13177]
          Length = 291

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F           D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVD 69

Query: 64  -----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+VS
Sbjct: 70  ALRREFEPIAERFRMQWAIHDVAALPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPEASA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 RLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|188574705|ref|YP_001911634.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188519157|gb|ACD57102.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 263

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 163/254 (64%), Gaps = 2/254 (0%)

Query: 28  GCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATK 85
            CNILD  QF D ++ + F+R+ F     T +      F  +  +F + + + + +   +
Sbjct: 9   ACNILDAQQFGDDESGRFFLRVHFHKPAKTDIAALQQRFAALADEFQMDWQLHDARRRAR 68

Query: 86  TLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKI 145
            L+LVS+  HCLNDLL+R +   L + I  VVSNHT    L  +Y + F++LP++   + 
Sbjct: 69  LLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVVSNHTDFAALAASYGIAFHHLPVSAATRA 128

Query: 146 ESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAY 205
             E +L+ ++++   +L++LARYMQILS H+C  + GR INIHHSFLPSFKGA PY QA+
Sbjct: 129 AQEAQLLTLVDELQTDLVVLARYMQILSPHVCRALAGRAINIHHSFLPSFKGAQPYHQAH 188

Query: 206 EYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHI 265
             GVKIIGATAHY   +LD GPIIEQDV RV HA T  D + +G + E++VL +AV  H+
Sbjct: 189 ARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMTPRDLVRVGSDTESQVLARAVRCHV 248

Query: 266 QQRVFINKRKTIVF 279
           + R+ +N  +T+VF
Sbjct: 249 EHRIVLNGHRTVVF 262


>gi|167841971|ref|ZP_02468655.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           MSMB43]
          Length = 291

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F           D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADSLRVD 69

Query: 64  -----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI  +F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+VS
Sbjct: 70  ALRREFEPIAARFGMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDFEPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSQETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 RLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|299067073|emb|CBJ38269.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum CMR15]
          Length = 290

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           S+ILT++CPS     + +   L    C I +++ F+D    + F+R  F       L + 
Sbjct: 9   SFILTLSCPSAPGQVAAVVGLLERHHCYIDELTVFDDDLNHRFFVRCVFHPTDAQALPLD 68

Query: 62  ---ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F PI + F +Q++I + +   K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 69  VLRQEFAPIAEAFDMQWAIHDAQARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIAS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+  + K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 129 NHPDLEPLARQHDLPFRHFPIAPETKAQQEAQWLDLFESSGAELVILARYMQVLSAQTSK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 KLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 249 SYRPEHLLAVGRDVECLTLARAVKAFIERRVFLNADRTVVF 289


>gi|320449602|ref|YP_004201698.1| formyltetrahydrofolate deformylase [Thermus scotoductus SA-01]
 gi|320149771|gb|ADW21149.1| formyltetrahydrofolate deformylase [Thermus scotoductus SA-01]
          Length = 285

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 182/284 (64%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTC 56
           M    L ITCP    I + +  +L   G NI D+ Q++ D +    FMR++F     +  
Sbjct: 1   MEEARLLITCPDRPGIVAAVSGFLYAHGANITDLQQYSTDPEGGTFFMRLAFTTPHLDLS 60

Query: 57  MKLFIADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +V  +F +++ +    E  +  ILVS+P H L +LL+R+ +G L++++  
Sbjct: 61  RPALERAFQDVVASRFHMEWRLAYASERKRVAILVSKPAHALLELLWRYRVGELSMDLRM 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+ +  K E+E++++ ++E+  VEL++LARYMQILS  
Sbjct: 121 VISNHPHHQEEVERFGIPYHHVPVEKGRKEEAEERILALLEEERVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVARYPMRIINIHHSFLPAFAGADPYRQAHERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H   + +   +G+ +E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 241 VSHRHPVAEMRRLGQELERTVLARAVRWHLEDRILVHGNKTVVF 284


>gi|26988670|ref|NP_744095.1| formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|24983455|gb|AAN67559.1|AE016385_5 formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
          Length = 286

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/278 (43%), Positives = 178/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-MKLFIA 62
           Y+L++ C     I S +  +L   G NI++  QFND D+SK FMR+S       +  F +
Sbjct: 7   YVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVEIPVAGVNDFNS 66

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +V++++ ++  R   +  K +I+VS+ DHCL DLLYR  +G L + +VG++SNH  
Sbjct: 67  AFGKVVEKYNAEWWFRPRTDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNHPR 126

Query: 123 HKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               V     +PF+YLP+T   K   E ++ NI+ ++  +L++LARYMQILSD L   ++
Sbjct: 127 EALSVSLVGDIPFHYLPVTPATKAAQESQIKNIVTQSQADLIVLARYMQILSDDLSAFLS 186

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPII QDV  V+H  +
Sbjct: 187 GRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHRDS 246

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED +  G++IE +VL++AV   ++ R+ +N  +T+VF
Sbjct: 247 AEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 284


>gi|126668594|ref|ZP_01739547.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
 gi|126626924|gb|EAZ97568.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
          Length = 284

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 182/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D  +   FMR     N+    ++ 
Sbjct: 4   TYRLVISCPDGVGIVAKVSNFLSTYNGWITEASHHSDTHSGWFFMRHEIKANSIPFGLEQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F PI ++F++ + I ++ +  K +++ S+  HC+ DLL+RW    L + IV VVSN
Sbjct: 64  FRAAFAPIAREFNMNWRITDSAQPKKVVLMCSKESHCVADLLHRWQSNELNVEIVAVVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE + +P++++P+++ N+ E+   + ++ E++ V++++LARYMQ+L   LC K
Sbjct: 124 HDDLRRMVEWHDIPYHHVPVSKDNREEAFAHIEDLFEQHQVDVVVLARYMQVLPPELCAK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQ V+R+TH 
Sbjct: 184 YAGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQSVIRITHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D + +GK++E  VL + + +HI+ RV  ++ KT+VF
Sbjct: 244 DTTDDMVRLGKDVEKSVLARGLRSHIEDRVITHENKTVVF 283


>gi|17545825|ref|NP_519227.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum GMI1000]
 gi|17428119|emb|CAD14808.1| probable formyltetrahydrofolate deformylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 290

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
           S+ILT++CPS     + +   L    C I +++ F+D    + F+R  F       L + 
Sbjct: 9   SFILTLSCPSAPGQVAAVVGLLERHHCYIDELTVFDDDLNHRFFVRCVFHPTDAHALPVD 68

Query: 62  ---ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F PI + F +Q++I + +   K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 69  VLRQEFAPIAEAFDMQWAIHDAQARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIAS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+  + K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 129 NHPDLEPLARQHDLPFRHFPIAPETKAQQEAQWLDLFESSGAELVILARYMQVLSAQTSK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 KLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 249 SYRPEHLLAVGRDVECLTLARAVKAFIERRVFLNADRTVVF 289


>gi|303325207|pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325208|pdb|3OBI|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325209|pdb|3OBI|C Chain C, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325210|pdb|3OBI|D Chain D, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
          Length = 288

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 172/282 (60%), Gaps = 8/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL---- 59
           Y+LT++CP    I S +  +L   G NILD  Q+ND ++   F R+  VFN   K+    
Sbjct: 7   YVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFXRV--VFNAAAKVIPLA 64

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I  +F+  +  R+ +   K  +LVSQ DHCL D+LYRW +G L      +VS
Sbjct: 65  SLRTGFGVIAAKFTXGWHXRDRETRRKVXLLVSQSDHCLADILYRWRVGDLHXIPTAIVS 124

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++  +PFY+ P+ +  + + E  +  +I + + +L++LARY QILSD   
Sbjct: 125 NHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYXQILSDEXS 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++
Sbjct: 185 ARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERIS 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 245 HRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 286


>gi|189500718|ref|YP_001960188.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides
           BS1]
 gi|189496159|gb|ACE04707.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides
           BS1]
          Length = 309

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD- 63
           +L ++CP    + S I +++  +  NILD+ +  D+ +   F+R+S+  +  + +  AD 
Sbjct: 31  VLLLSCPDRIGLVSRISNFIFERRGNILDLDEHVDIASGMFFIRVSWSRDD-VSITTADL 89

Query: 64  ---FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+  +    + I    E  +  + VS+ DHCL DLL+R+  G  A+ I  ++SNH
Sbjct: 90  QGAFSPLALELGADWKIYVIPEKPRVAVFVSRYDHCLQDLLWRYKTGEFAMEIPLIISNH 149

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L   Y +PF+  P T +NK+E E K + ++++N V+ ++LARYMQ+LS       
Sbjct: 150 RDLEDLAAQYSIPFHVFPKTRENKLEQETKELELLKENRVDTIVLARYMQVLSQRFVDAY 209

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F G +PYKQA+E GVKIIGAT+HY   ELD GPIIEQD++R+TH  
Sbjct: 210 PDRIINIHHSFLPAFSGGSPYKQAFERGVKIIGATSHYVTGELDEGPIIEQDIIRITHKD 269

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T+ D I  G+++E  VL++A+++H+  RV +N RKTI+F
Sbjct: 270 TLGDLIRKGRDLERLVLSRAISSHVDHRVLVNGRKTIIF 308


>gi|78485696|ref|YP_391621.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
 gi|78363982|gb|ABB41947.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
          Length = 282

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 176/279 (63%), Gaps = 1/279 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLF 60
           +SY+LT++CP    I S +  +L+   C I + +   D +    FMR      N   + F
Sbjct: 3   ASYVLTVSCPDKIGIVSKVSTFLADHQCMITEANHHADEELGMFFMRNEISNLNMSEESF 62

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I QQF +Q+ + +  +  + +I+VS+ DHCL DLLYRW  G +  +I  V+SNH
Sbjct: 63  KLKFLDIAQQFDMQWKLSSGAKKKRVIIMVSKQDHCLYDLLYRWKSGEMDYDIPCVISNH 122

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K LVE + +P+ ++P+T  NK ++  +++  +E    + ++LARYMQI+   LC K 
Sbjct: 123 LDLKGLVEWHGIPYVHIPVTPDNKSQAFSEVVKWVEHYQADTIVLARYMQIIPPDLCRKY 182

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+IINIHHSFLPSF GA PY QA+E GVK+IGAT HY   ELDAGPIIEQDV RV+H++
Sbjct: 183 PGQIINIHHSFLPSFIGARPYHQAFERGVKLIGATCHYVTEELDAGPIIEQDVRRVSHSE 242

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + ++ + +GK++E   L + +  H++ RV ++  KTIVF
Sbjct: 243 SADEMVVLGKDVEKNALARGLKHHLEDRVLLSGNKTIVF 281


>gi|72162755|ref|YP_290412.1| formyltetrahydrofolate deformylase [Thermobifida fusca YX]
 gi|71916487|gb|AAZ56389.1| formyltetrahydrofolate deformylase [Thermobifida fusca YX]
          Length = 285

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 177/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLF 60
           ++LT++CP +  I + + + L+   CNI +  QF D  T + FMR+ F   +        
Sbjct: 6   FVLTLSCPDSRGIVAAVANLLAAHQCNIEESQQFGDHYTGRFFMRVQFTAESPQVDEDAL 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                 +  ++++ + +       + L++VS+  HCLNDLLYR   GTL  +I  VVSNH
Sbjct: 66  RGALAALASEYAMDWDLWRRDVRMRVLVMVSKYGHCLNDLLYRQRSGTLKADIAAVVSNH 125

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L ++Y + F++LP+T Q K E E +++ +I+   ++L++LARYMQ+LS+ LC K+
Sbjct: 126 PDLEFLAKSYGVDFHHLPVTPQTKPEQEARVLELIQSYQIDLVVLARYMQVLSEDLCQKL 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 186 AGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVARVDHTF 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + E    +G+++E+  L +AVN H + R+ +N  KT+VF
Sbjct: 246 SPEQLTEVGRDLESMALARAVNWHAEHRILLNGSKTVVF 284


>gi|83718067|ref|YP_440051.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|167616752|ref|ZP_02385383.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis Bt4]
 gi|257143239|ref|ZP_05591501.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|83651892|gb|ABC35956.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
          Length = 291

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 177/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTCMK 58
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F       +  + 
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADSLRVD 69

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 70  ALRREFEPIAERFRMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIAS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDLEPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|152996769|ref|YP_001341604.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
 gi|150837693|gb|ABR71669.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
          Length = 288

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 180/283 (63%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-----FNTC 56
           + +I T +CPS      ++  Y++  G  + +I  F+D ++ + F+RI F+     FN  
Sbjct: 6   APWIFTASCPSIIGTVDVVTRYMAQAGNYVDEIHSFDDRESGRFFIRIEFLPQHADFNE- 64

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             +F A+F     +FS+ +S+       K  I+VS+ DHCLNDLLYR+  G L +++  +
Sbjct: 65  -DVFKAEFAERAAEFSMDWSLTAPNHKPKVAIMVSKYDHCLNDLLYRFRTGQLNIDVTVI 123

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + L + + +P+Y+LP+T   K+E E ++  +IE+ + EL++LARYMQ+LS  +
Sbjct: 124 ISNHPDLEDLAKWHGIPYYHLPITADTKLEQEAQVRELIEQYDTELVVLARYMQVLSPSM 183

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHS LP FKGA PY QA+E GVK++GATAHY   +LD GPII Q +  V
Sbjct: 184 CEYLDGRAINIHHSLLPGFKGARPYHQAWEKGVKMVGATAHYVNNDLDEGPIISQGIQVV 243

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA   ED IA G++IE   L  AV  H+++RVF+N ++T+VF
Sbjct: 244 NHAHYAEDLIAKGQDIERVTLFNAVKCHVEKRVFLNGKRTVVF 286


>gi|167578611|ref|ZP_02371485.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           TXDOH]
          Length = 291

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 177/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTCMK 58
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F       +  + 
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADSLRVD 69

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F+PI ++F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 70  ALRREFEPIAERFRMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIAS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDLEPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYMQVLSPETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|85709524|ref|ZP_01040589.1| formyltetrahydrofolate deformylase [Erythrobacter sp. NAP1]
 gi|85688234|gb|EAQ28238.1| formyltetrahydrofolate deformylase [Erythrobacter sp. NAP1]
          Length = 289

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 164/280 (58%), Gaps = 7/280 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIAD 63
           ILT+ CP    IT+ +  +L  +GCNILD  QF +    + FMR+ F       +    D
Sbjct: 10  ILTLDCPDRPGITAKVTAFLFKRGCNILDAQQFGE--DERFFMRVVFEAGGHDSEDLRRD 67

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P  Q F+++++I       + LI+VS+ DHCL DL+YRW  G L +  V +VSNH   
Sbjct: 68  FAPFAQDFAMRWTIAAQDRPRRVLIMVSKADHCLADLIYRWRTGELNIEPVAIVSNHPRE 127

Query: 124 KKLVENY----QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
             L         +PF+++P+T   K E+E  L NI E    EL++LARYMQI SD     
Sbjct: 128 VALSSGRTDIGDVPFHHVPVTPDTKAEAEAALRNIAEDVQAELVVLARYMQIFSDEQSAH 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R INIHHSFLP FKGA PY QA+  GVKIIGATAH+   +LD GPII QDV R+TH 
Sbjct: 188 FAERCINIHHSFLPGFKGARPYHQAHRRGVKIIGATAHFVTADLDEGPIIHQDVERITHT 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  D +  G++IE +VL +AV      RV +N  +T+VF
Sbjct: 248 DSPSDLVRKGRDIERRVLAEAVRLFAGDRVLMNGARTVVF 287


>gi|194334473|ref|YP_002016333.1| formyltetrahydrofolate deformylase [Prosthecochloris aestuarii DSM
           271]
 gi|194312291|gb|ACF46686.1| formyltetrahydrofolate deformylase [Prosthecochloris aestuarii DSM
           271]
          Length = 292

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 111/280 (39%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL + CP    + S +  ++   G NILD+ +  D  +   F+R+S+    F+     
Sbjct: 12  SAILLLACPDRRGLVSRLAHFIFEHGGNILDLDEHVDAGSGMFFIRVSWSMDGFSIPASD 71

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+P+ ++F  ++SI   +   +  + VS+ DHCL ++L+R   G   ++I  ++SN
Sbjct: 72  LEEVFRPLGREFQARWSIHTAETRERVALFVSKYDHCLQEILWRHRTGEFQIDIPLIISN 131

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y + F+  P+T +NK++ EQ+ + ++  + ++ ++LARYMQ+LSD     
Sbjct: 132 HPDLGPLARHYGIAFHVYPITSENKLDQEQRELELLRAHRIDTVVLARYMQVLSDRFVDA 191

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M  R+INIHHSFLP+F G NPY+QA+E GVKIIGAT+HY   ELD GPIIEQD+VR++H 
Sbjct: 192 MPERVINIHHSFLPAFSGGNPYRQAFERGVKIIGATSHYVTAELDEGPIIEQDIVRISHK 251

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ D +  G+++E  VL +A++ H++ RV +N RKTIVF
Sbjct: 252 DTLPDLVRKGRDLERLVLARALSRHVEHRVLVNGRKTIVF 291


>gi|73538637|ref|YP_299004.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
 gi|72121974|gb|AAZ64160.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
          Length = 290

 Score =  249 bits (635), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 176/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCMK 58
           +++LT++CPS     + +   L    C I +++ F+D  +++ F+R  F         + 
Sbjct: 9   TFVLTLSCPSAPGQVAAVVGLLERHRCYIDELTVFDDDLSNRFFLRCVFHPTHAQAPGID 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +   +F PI + F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 69  VLRQEFTPIAEGFGMQWAIHDALARPKVLIMVSRLEHCLADLLFRWRMGELKMDIVGIAS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T + K + E + +++ E +  EL+ILARYMQ+LS     
Sbjct: 129 NHPDLEPLARQHDLPFRHFPITPETKAKQEAQWLDLFESSGAELVILARYMQVLSPETSG 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQAVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I +RVF+N  +T+VF
Sbjct: 249 SYRPEQLLAVGRDVECITLARAVKAFIDRRVFLNGDRTVVF 289


>gi|126666342|ref|ZP_01737321.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
 gi|126629143|gb|EAZ99761.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
          Length = 288

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
           + YILT T PS +   + I  +++  G  + + +QF+D++    F R  F      N   
Sbjct: 6   ARYILTATGPSAQGQVAGITAFINNLGGYVEEFNQFDDVEEENFFARACFRIKAAANPGY 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              I  F     +F +++SI +     + LI  S+ DHC+ D+LYRW  G L ++++G++
Sbjct: 66  AALIEAFTKTATRFFMEWSITDADHRPRVLIFGSRLDHCVRDILYRWRSGELNMDVMGLI 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     +   + +P+++LP+T+ ++ + E +L+ I+ +   EL+ILARYMQ+LSD LC
Sbjct: 126 SNHENLAPIAAEHGIPYFFLPVTDASRSQQEARLMEIVHETESELLILARYMQVLSDSLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPII+Q V RV 
Sbjct: 186 EQLVGRAINIHHSFLPGFKGARPYHQAYKRGVKVIGATAHYITTDLDEGPIIDQVVERVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ T     ++G+N E   L +AV  HI+QRVF+N  +T++F
Sbjct: 246 HSLTPVKLESLGRNCECVALHRAVKLHIEQRVFLNGMRTVIF 287


>gi|87119855|ref|ZP_01075751.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
 gi|86164557|gb|EAQ65826.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
          Length = 284

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 122/280 (43%), Positives = 173/280 (61%), Gaps = 5/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR----ISFVFNTCMKL 59
           ++L  +C +   I + +  YL+ QGC I ++ QF+D D+   +MR    I    NT   +
Sbjct: 5   FVLKASCDAASGIVAAVSTYLADQGCYIAEMHQFDDEDSQHFYMRAVCRIEGEDNTIASI 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F   V +F++ + I    E  K LI+VS+ DHCL+DLLYR   G L + I  +VSN
Sbjct: 65  RDG-FNERVSRFNMDWEIVGNDEPVKVLIMVSKFDHCLDDLLYRHRKGELPMEITAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F +LP+ ++NK + E  L++II +   +L++LARYMQILSD LC +
Sbjct: 124 HKDLRPMAEREGIRFVHLPVNKENKAKQEAALLDIISETETDLVVLARYMQILSDSLCKE 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ V  V H 
Sbjct: 184 LNGKAINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTSDLDEGPIIEQSVQPVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A+G++ E   L  AV  H++ RVF+   K+IVF
Sbjct: 244 YSPERLVAVGRDTETVALANAVRMHLEHRVFMYGNKSIVF 283


>gi|326794964|ref|YP_004312784.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
 gi|326545728|gb|ADZ90948.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
          Length = 288

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 177/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLF 60
           +I T  CPS      ++  Y++  G  + +I  F+D ++ + F+RI F+ N       +F
Sbjct: 8   WIFTAKCPSILGTVDVVTRYMAESGNYVSEIHSFDDYESDQFFIRIEFIPNGDAFSEDVF 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            ADFQ    +F++++++       +  ILVS+ DHCLNDLLYR+  G L + +  ++SNH
Sbjct: 68  AADFQARADEFNMEWALTPPDHKPRVAILVSKYDHCLNDLLYRYRTGQLNIEVPVIISNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K L + + +P+Y+LP++ + K + E ++  +IEK + EL++LARYMQ+LS  +C  +
Sbjct: 128 PDLKDLADWHGIPYYHLPISAETKPQQEAQVKELIEKYDAELVVLARYMQVLSPDMCQYL 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHS LP FKGA PY QA+E GVK++GATAHY   +LD GPII Q +  V HA 
Sbjct: 188 DGKAINIHHSLLPGFKGARPYHQAWEKGVKMVGATAHYVNNDLDEGPIIAQGIQTVDHAH 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ED +A G+++E   L  AV  H+++RVF+N  +T+VF
Sbjct: 248 YPEDLVAKGQDVERVTLFNAVKYHVEKRVFLNGSRTVVF 286


>gi|254501684|ref|ZP_05113835.1| formyltetrahydrofolate deformylase [Labrenzia alexandrii DFL-11]
 gi|222437755|gb|EEE44434.1| formyltetrahydrofolate deformylase [Labrenzia alexandrii DFL-11]
          Length = 285

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 182/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           Y+LT++C     I + +   L+  G NI +  QF D  T++ F+RI+ +      ++   
Sbjct: 6   YVLTLSCADKPGIVAAVTTELADFGANIAESDQFWDRATNQFFLRIAMLAPEGVTLESVQ 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               P++ +F ++  + +T +  K +I+VS+ DH +  LLY+  +G L   +V +VSNH 
Sbjct: 66  KALDPVIARFDMKAKLVDTAKRPKVIIMVSKFDHAMLHLLYQIRVGWLDAEVVAIVSNHP 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +  ++  +P+++ P+T+ NK E E K++ ++++   +L++LARYMQ+LSD+L  ++ 
Sbjct: 126 DSARTADHEGIPYHHWPVTKGNKAEQEDKVLKLVKETGADLVVLARYMQVLSDNLSKRLF 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G++INIHHSFLPSFKGA PY QA+  GVK+IGAT HY   +LD GPIIEQD  RV+HA +
Sbjct: 186 GKVINIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTPDLDEGPIIEQDAERVSHALS 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +D++A G++IE++VL +AV  H++ RV I   KTIVF
Sbjct: 246 ADDFVARGRDIESRVLARAVKYHLENRVMIVGNKTIVF 283


>gi|120553948|ref|YP_958299.1| formyltetrahydrofolate deformylase [Marinobacter aquaeolei VT8]
 gi|120323797|gb|ABM18112.1| formyltetrahydrofolate deformylase [Marinobacter aquaeolei VT8]
          Length = 284

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 181/280 (64%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D      FMR      +    +  
Sbjct: 4   TYRLVISCPDRVGIVAKVSNFLSTYNGWITEASHHSDTQAGWFFMRHEIKAESIPFGLDQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F+PI ++F++ + I ++    + +++ S+  HCL DLL+RW+   L   IV V+SN
Sbjct: 64  FRAAFEPIAREFNMNWHIADSARPKRVILMCSKESHCLADLLHRWHSKELNCEIVAVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE +++P++++P++++NK E+   +  + ++   ++++LARYMQIL   LC K
Sbjct: 124 HDDLRRMVEWHEIPYHHVPVSKENKAEAFAHIDELFQQYETDVVVLARYMQILPAELCGK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
            +G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R++H+
Sbjct: 184 YSGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQDVIRISHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +IED + +GK++E  VL + + +HI+ RV   + KT+VF
Sbjct: 244 DSIEDMVRLGKDVEKNVLARGLRSHIEDRVITYENKTVVF 283


>gi|238024039|ref|YP_002908271.1| formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
 gi|237878704|gb|ACR31036.1| Formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
          Length = 292

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 176/283 (62%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----- 56
           S ++LT++CPS     + +   L    C + +++ F+D  + + F+R +F          
Sbjct: 8   SRFLLTLSCPSAAGQVAAVVGVLDRHQCYVDELTVFDDDLSGRFFVRCAFHPAAAGSTPD 67

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F PI  +F +Q++I +     K +ILVS+ +HCL DLL+RW +G L ++IV +
Sbjct: 68  IDALRAEFAPIAARFDMQWAIHDAGARPKVMILVSKLEHCLADLLFRWKMGELKMDIVAI 127

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
            SNH   + L   + LPF + P+T + K + E + +++ E +  EL+ILARYMQ+LS   
Sbjct: 128 ASNHPDLEPLAAQHGLPFRHFPITPETKAQQEAQWLDLFESSGAELVILARYMQVLSPGT 187

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV
Sbjct: 188 SARLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERV 247

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA   E  + +G+++E+  L +AV A I++RVF+N  +T+VF
Sbjct: 248 DHAYRPEQLLTVGRDVESITLARAVKAFIERRVFLNGDRTVVF 290


>gi|187919776|ref|YP_001888807.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
 gi|187718214|gb|ACD19437.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
          Length = 291

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 178/280 (63%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   ++   L +A 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGADSQETLRVAA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+PI ++F + +++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKREFEPIAERFRMTWAMHDVGTRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + + LPF +LP+T   K + E +L+++ E +  ELMILARYMQILS      
Sbjct: 131 HRDLEPLAQQHGLPFQHLPITADTKPQQEARLLDLFETSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAARAINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|256421055|ref|YP_003121708.1| formyltetrahydrofolate deformylase [Chitinophaga pinensis DSM 2588]
 gi|256035963|gb|ACU59507.1| formyltetrahydrofolate deformylase [Chitinophaga pinensis DSM 2588]
          Length = 287

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 128/279 (45%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF-VFNT--CMKLFI 61
           L I CP    I + +  +L   G NILD SQ + D      FMR+ F + NT   M+   
Sbjct: 9   LLICCPDRPGIVAGVSQFLFNCGANILDASQHSTDPKEGLFFMRMVFHLENTLVTMEELE 68

Query: 62  ADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             FQ  +     +++ I  T    K  I+VS+ DHCL +LL+RW  G L ++I  V+SNH
Sbjct: 69  RQFQEKVATPLKMEWRIDYTSHRKKMAIMVSRYDHCLMELLWRWRSGELPVDIPLVISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +KL E++ +PFYYLP+   NK E E++ I +I+    +  +LARYMQILS       
Sbjct: 129 EDLRKLTEDFGIPFYYLPVNAGNKGEKEKEAIQLIQDAKADFTVLARYMQILSPSFVSTF 188

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+IINIHHSFLP+F GANPYK AY  GVK+IGATAHY   +LD GPII+QDV RV+H  
Sbjct: 189 PGKIINIHHSFLPAFAGANPYKNAYTRGVKLIGATAHYVTDDLDEGPIIDQDVARVSHRH 248

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + D + +G++IE +VLT+AV AH++ RV ++  KTIVF
Sbjct: 249 AVNDLVMLGRDIERQVLTRAVVAHVEDRVIVHGNKTIVF 287


>gi|167572351|ref|ZP_02365225.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           C6786]
          Length = 291

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 176/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTCMK 58
           ++LT++CPS     + +   L    C + +++ F+D  + + F+R  F     V +  + 
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSERFFVRCVFHAADAVDSLRLD 69

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F+PI  +F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 70  ALRREFEPIAARFGMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIAS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K   E + +++++ +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDLEPLAAQHGLPFRHFPITADTKARQEAQWLDMLDTSGAELVILARYMQVLSPETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|296156294|ref|ZP_06839133.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
 gi|295893800|gb|EFG73579.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
          Length = 291

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 177/280 (63%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C I +++ F+D  + + F+R  F   N+   L  A 
Sbjct: 11  VLTVACPSAAGQVAAVVGFLDRHHCYIDELTVFDDDLSERFFVRCVFHGVNSNETLHAAA 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+PI ++F + +++ +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKREFEPIAERFRMTWAMHDVDTRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + + LPF++LP+T   K + E +L+++ E +  ELMILARYMQILS      
Sbjct: 131 HRDLEPLAQQHGLPFHHLPITADTKPQQEARLLDLFETSGAELMILARYMQILSGETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +    INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H+
Sbjct: 191 LAASAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +A G+++E   L +AV A I++RVFIN  +T+V 
Sbjct: 251 YSPERLLATGRDVECITLARAVKAFIERRVFINGDRTVVL 290


>gi|152995766|ref|YP_001340601.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
 gi|150836690|gb|ABR70666.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
          Length = 286

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 108/280 (38%), Positives = 185/280 (66%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           ++ L I+CP    I + +  +L+ +  +I++ S   DL+    FMR        +  +++
Sbjct: 5   TFRLVISCPDRVGIVAAVSQFLNERQGSIIEASHHTDLEQKWFFMRHDIDAESLDIDVEI 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F  +F PI ++F++++ ++++++  K ++L ++  HCLND+++RW+ G L   IVGV++N
Sbjct: 65  FRKEFAPIAEEFNMRWYVKDSEDRPKVVLLATKESHCLNDIMHRWHTGELNCEIVGVIAN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE Y++P++ +P+ +++K+ + Q++   I+    + ++LARYMQI  ++LC K
Sbjct: 125 HEDLRSMVEWYKIPYFCIPVPKEDKMPAFQEIEACIDSTQADTIVLARYMQIFPEYLCEK 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H+
Sbjct: 185 YRHKVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRHS 244

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 245 HAAEDMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 284


>gi|167565249|ref|ZP_02358165.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           EO147]
          Length = 291

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFNTCMK 58
           ++LT++CPS     + +   L    C + +++ F+D  + + F+R  F     V +  + 
Sbjct: 10  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSERFFVRCVFHAADAVDSLRLD 69

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F+PI  +F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 70  ALRREFEPIAARFGMQWAIHDVAARPKVLIMVSKLEHCLADLLFRWKMGELKMDIVGIAS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K   E + +++ + +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDLEPLAAQHGLPFRHFPITADTKARQEAQWLDMFDTSGAELVILARYMQVLSPETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|227494745|ref|ZP_03925061.1| formyltetrahydrofolate deformylase [Actinomyces coleocanis DSM
           15436]
 gi|226831745|gb|EEH64128.1| formyltetrahydrofolate deformylase [Actinomyces coleocanis DSM
           15436]
          Length = 320

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 168/280 (60%), Gaps = 3/280 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           +   ILT++CP    I   +   +S    NI+   QF D +T   FMR+     T  +  
Sbjct: 42  LEKLILTLSCPDQPGIVYAVTRVISENSGNIIQSQQFGDPETGLFFMRVEL--ETPARKQ 99

Query: 61  IAD-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           I D        F   + +       +T+I+VS+  HCL DLLYR     L + +V VV N
Sbjct: 100 IEDGIAAFAADFDATFQLDEMGRPLRTIIMVSKEGHCLTDLLYRQRYQELGIEVVAVVGN 159

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     + + Y  PF  +P+T + K E+E +L+ ++E   VEL+ILARYMQILSD LC  
Sbjct: 160 HPDLAPVAQFYGKPFLCIPVTPETKAEAEAQLLALVESEKVELVILARYMQILSDKLCET 219

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G +INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RVTH 
Sbjct: 220 LVGNVINIHHSFLPSFKGARPYAQAHTRGVKLIGATAHYVTADLDEGPIIEQDVTRVTHR 279

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ +D +A G+++E +VL +AV  H Q RV +N  +T+VF
Sbjct: 280 ESTKDLVAQGQDVERRVLAQAVKWHTQHRVLLNGHRTVVF 319


>gi|312963483|ref|ZP_07777965.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
 gi|311282289|gb|EFQ60888.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
          Length = 285

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 170/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
            ++ILT  CPS       +  YL  QGC + +   F+D  + + F+R+ F        + 
Sbjct: 6   DTWILTADCPSVLGTVDAVTRYLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDGFDEQA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A      + F + + +       K +I+VS+ DHCLNDLLYR  IG L++++V VVSN
Sbjct: 66  FRAGLAARGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRIGQLSMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + +Q+P+Y+ P+   +K   E+++  ++E    EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLKPLADWHQIPYYHFPLDPNDKPSQERQVWQVVEDTGAELVILARYMQVLSPELCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|92113130|ref|YP_573058.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
 gi|91796220|gb|ABE58359.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
          Length = 288

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 175/283 (61%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +++ILT  CPS      ++  +L    C I +   F+D    + F+R +F        F 
Sbjct: 6   ATWILTAQCPSRLGTVDVVTRFLKECRCYITEQQSFDDRHGERFFIRTAFQPEETD--FD 63

Query: 62  AD-FQPIVQ----QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           AD FQ        +F + + +   +     +I+VS+ DHCLNDLLYR+  G L + I  V
Sbjct: 64  ADTFQAAFAARAAEFDMVFELTAPEARMPVVIMVSKADHCLNDLLYRYRTGQLPVTIRAV 123

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + LV  + LP+Y+LP+T + K E E ++  +IE    EL+ILARYMQ+LS  L
Sbjct: 124 ISNHPDLEPLVAWHDLPYYHLPITPETKAEQEAEVWRVIESTGAELVILARYMQVLSSEL 183

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C K+TG+ INIHHS LP FKGA PY QA+E GVK++GATAHY   +LD GPII Q V  V
Sbjct: 184 CEKLTGKAINIHHSLLPGFKGAKPYHQAFEKGVKLVGATAHYINDDLDEGPIITQGVEPV 243

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +HA   ED +A G++IE   L +AV+ H+++RVF++ R+T+VF
Sbjct: 244 SHADDPEDLVAKGRDIECLTLARAVSLHLERRVFLHARRTVVF 286


>gi|94501188|ref|ZP_01307710.1| formyltetrahydrofolate deformylase [Oceanobacter sp. RED65]
 gi|94426615|gb|EAT11601.1| formyltetrahydrofolate deformylase [Oceanobacter sp. RED65]
          Length = 283

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 181/282 (64%), Gaps = 7/282 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-----ISFVFNTCM 57
           SY L I+CP    I + +  ++S+ G  I++ + + D  +   FMR      S  F   +
Sbjct: 4   SYRLIISCPDRVGIVAKVGQFVSSYGGWIVEANHYADPTSGWFFMRHCIKAESLPFG--L 61

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++F + ++I  ++   K ++L S+  HCL D+L+RW+ G L  +I  V+
Sbjct: 62  DEFREKFAPIAEEFEMDWAIAASEAPKKMVLLASKESHCLVDVLHRWHSGELHCDIPCVI 121

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE + +PF+++P+ ++NK E   ++  IIE++  ++++LARYMQIL   +C
Sbjct: 122 SNHDDLRSLVEWHGIPFFHVPVDKENKQEHFDRVSAIIEEHQADVIVLARYMQILPADVC 181

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K  G+IINIHHSFLPSF GA PY QA E GVK+IGAT HY   +LDAGPII+QDVVR++
Sbjct: 182 AKYEGQIINIHHSFLPSFVGAKPYHQAAERGVKLIGATCHYVTQDLDAGPIIDQDVVRIS 241

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+ED + +GK++E  VL++ V  H++ RV  +  KTIVF
Sbjct: 242 HKDTVEDMVRLGKDVEKMVLSRGVRLHLEDRVLRHGNKTIVF 283


>gi|167646323|ref|YP_001683986.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
 gi|167348753|gb|ABZ71488.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
          Length = 279

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 174/280 (62%), Gaps = 2/280 (0%)

Query: 1   MSSY-ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           MSS+ IL    P    I + +   ++  G +I     + D +T+  F R++         
Sbjct: 1   MSSHLILRFLAPDRPGIIAHVAGLVAGHGGDIRAAEVYGDDETNGFFCRMAITSAIGPTA 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                +P+ + F L++ IR+  +  + LI VS+  HCL DL+++  IG L ++IVGVVSN
Sbjct: 61  LAEALEPMARHFGLEWEIRDLAQKVRVLIAVSKLGHCLVDLIHKTEIGQLPIDIVGVVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T ++ VE + L F+++P T+  K   E + +++IE    +L +LARYMQ+LSD    +
Sbjct: 121 HETWRRTVEWHGLAFHHVPTTD-GKAAQEARFLSVIEDTGAQLTVLARYMQVLSDDFSSR 179

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAH+   +LD GPIIEQDV RV+HA
Sbjct: 180 LEGRCINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHFVTADLDEGPIIEQDVRRVSHA 239

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ++ +AIG+  EA VL++AV  + + R+F N  KT++ 
Sbjct: 240 TTADEMVAIGRETEASVLSRAVRWYAEHRIFKNGDKTVIL 279


>gi|111018815|ref|YP_701787.1| formyltetrahydrofolate deformylase [Rhodococcus jostii RHA1]
 gi|110818345|gb|ABG93629.1| probable formyltetrahydrofolate deformylase [Rhodococcus jostii
           RHA1]
          Length = 282

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           ++ LT++C     I   +  +L  Q C+I +  QF+D  +   F+R SFV   +  ++  
Sbjct: 4   TFTLTLSCAQRPGIVHAVSSFLFEQNCDIAEHQQFDDTRSDAFFLRTSFVSAEDVDIERL 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A+F  +  +F + ++  N  +  + +++VS+  HCLNDL++RW  G L   +V VVSNH
Sbjct: 64  TAEFGSVAAKFGMTFNF-NGTDLPRVIVMVSKMGHCLNDLIFRWRAGNLGAELVAVVSNH 122

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   LPF ++P+T   K ++E +L+ ++E+ + +L++LARYMQ+LSD  C  +
Sbjct: 123 EVLRPMAEAAGLPFVHVPVTPATKPQAEARLLELVEEYDADLVVLARYMQVLSDDACRAL 182

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QA++ GVK +GATAHY   +LD GPIIEQ+V+R+ H+ 
Sbjct: 183 RGRAINIHHSFLPGFKGAKPYHQAFDRGVKQVGATAHYVTPDLDEGPIIEQEVIRIDHSF 242

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  +G++ EA  L++AV  H + RV ++  +T+VF
Sbjct: 243 DPARLATVGQDAEALALSRAVRWHCENRVLLHGHRTVVF 281


>gi|311744674|ref|ZP_07718471.1| formyltetrahydrofolate deformylase [Aeromicrobium marinum DSM
           15272]
 gi|311311983|gb|EFQ81903.1| formyltetrahydrofolate deformylase [Aeromicrobium marinum DSM
           15272]
          Length = 288

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 182/285 (63%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-----SKLFMRISFVFNTC 56
           +SY+LT++CP    +   +  +++  G NILD  QF D+ T      + F+R+ F F T 
Sbjct: 3   TSYVLTLSCPDRPGLVFAVTRWIAEAGGNILDSQQFTDVSTDVDERGEFFLRVHFDFPTP 62

Query: 57  MKL--FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             L      F  +  +  +  +I   +   +TL++VS   HCLNDLL+R   G L + + 
Sbjct: 63  QDLAGLRTAFAAVATEHRMNAAIVQAEAPVRTLVMVSTDGHCLNDLLFRQTTGGLNIVVP 122

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH   ++L   Y +PF+++P++ + K ++E  L+ ++E+ +V L++LARYMQIL D
Sbjct: 123 AVVSNHRDLEQLAGRYDVPFHHVPVSRETKAQAEAALLRLVEELDVVLVVLARYMQILGD 182

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +C ++TGRIINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPII+Q V+
Sbjct: 183 DVCRELTGRIINIHHSFLPSFKGARPYHQAHDRGVKLIGATAHYVTADLDEGPIIDQGVL 242

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H     D   +G+++E++ L++AV  H + RV +N  +T+VF
Sbjct: 243 RVDHRLRAADLARVGRDVESQTLSRAVQLHAESRVLMNGPRTVVF 287


>gi|297622867|ref|YP_003704301.1| formyltetrahydrofolate deformylase [Truepera radiovictrix DSM
           17093]
 gi|297164047|gb|ADI13758.1| formyltetrahydrofolate deformylase [Truepera radiovictrix DSM
           17093]
          Length = 286

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 174/279 (62%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCMKLFI 61
           L I+CP    I + +  +L   G NILD  Q + D    + FMR+ F     +     F 
Sbjct: 9   LLISCPDRPGIVAAVSQFLYAHGANILDAQQHSTDPKGGEFFMRMVFHLEDLDVTRAQFE 68

Query: 62  ADFQPIVQQ-FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             F  +V + F + + +    +  +  +LVS+ DHCL +LL+R   G   ++I  V+SNH
Sbjct: 69  RAFAEVVARPFGMSWRVAYADQRKRMAVLVSKTDHCLLELLWRVRSGEFDVDIPLVISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++  E + +PFY+LP+T + K E E +L+ ++E   V+L++LARYMQILS  +  + 
Sbjct: 129 DLLRETTEAFGIPFYHLPVTPETKAEQEAQLLALLE-GRVDLVVLARYMQILSPEVVSRY 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   ELD GPII QDV RV+H +
Sbjct: 188 RGRIINIHHSFLPAFVGANPYKQAYERGVKLIGATAHYVTDELDEGPIIAQDVARVSHRE 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ D + +G+ +E  VL +AV AH++ RV I   KT+VF
Sbjct: 248 SVADLVGVGRELERTVLARAVAAHLEDRVLIFGNKTVVF 286


>gi|253576555|ref|ZP_04853883.1| formyltetrahydrofolate deformylase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843969|gb|EES71989.1| formyltetrahydrofolate deformylase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 299

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 170/278 (61%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC---MKLFI 61
           + I+CP    I + +  +L   G NI+   Q+  D +    FMRI F  +     +    
Sbjct: 22  MLISCPDGPGIVAAVSRFLYEHGANIVQSDQYTMDPEGGMFFMRIEFDLDGLDGRIDALK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           +DF+ I  QF +Q++I       K  I VS+ DHCL +LL++W  G L   I  VVSNH 
Sbjct: 82  SDFEAIASQFRMQWNIYQLSRKKKLAIFVSKEDHCLVELLWQWQAGDLDAEISMVVSNHP 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P+Y++P+T + K E+EQK + I+    V+L++LARYMQILS  L     
Sbjct: 142 DMKEYVESFGIPYYHIPVTPETKHEAEQKQLEIV-SGKVDLIVLARYMQILSPALIEPYR 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            R+INIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRLINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDD 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  HI+ R+ +++ KT+VF
Sbjct: 261 VSELKRIGRTIERVVLARAVKWHIEDRILVHQNKTVVF 298


>gi|77461424|ref|YP_350931.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
 gi|77385427|gb|ABA76940.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
          Length = 285

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 170/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F        + 
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDGFDEQS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A      Q F + + +       K +I+VS+ DHCLNDLLYR  IG L++++  VVSN
Sbjct: 66  FRAGLAERGQAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRIGQLSMDVAAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + +Q+P+Y+ P+   +K   E+++  +IE+   EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLKPLADWHQIPYYHFPLDPNDKPAQERQVWQVIEEAGAELVILARYMQVLSPELCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEAVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|124268730|ref|YP_001022734.1| formyltetrahydrofolate deformylase [Methylibium petroleiphilum PM1]
 gi|124261505|gb|ABM96499.1| formyltetrahydrofolate deformylase [Methylibium petroleiphilum PM1]
          Length = 295

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 173/291 (59%), Gaps = 19/291 (6%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL----DTSKLFMRISFVFNTCMKL 59
           ++LT++C   + I   +   L   GCNILD  Q+ D+     T   FMR+ F        
Sbjct: 8   FVLTLSCRDAKGIVYAVSGLLYQAGCNILDSQQYGDVQGADSTGLFFMRVHF----SAPG 63

Query: 60  FIAD-------FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
            +AD       F  +  +F +           + L+LVS+  HCLNDLL+RW  G+L + 
Sbjct: 64  HLADEASLDKLFAHVRGEFGMTARFHALAVKPRLLLLVSKHGHCLNDLLFRWKSGSLPVE 123

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQN----KIESEQKLINIIEKNNVELMILARY 168
           I  VVSNH     L ++Y LPF++LP+   +    K E E ++  ++E++ ++L++LARY
Sbjct: 124 IPAVVSNHPDFAALCDSYGLPFHHLPLATGSSAAVKREQEARIEALVEQHRIDLVVLARY 183

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQILS   C  + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPI
Sbjct: 184 MQILSADFCRFLDGRAINIHHSFLPSFKGARPYDQAHARGVKLIGATAHYVTADLDEGPI 243

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQDV RV H+    D+ A+G+++E  VL +AV  H + RV ++  KT+VF
Sbjct: 244 IEQDVQRVDHSLGATDFTAVGRDVECVVLARAVKWHTEHRVLLDGHKTVVF 294


>gi|226360909|ref|YP_002778687.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
 gi|226239394|dbj|BAH49742.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
          Length = 282

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           ++ LT++C     I   +  +L  Q C+I +  QF+D  +   F+R SFV   +  ++  
Sbjct: 4   TFTLTLSCAQRPGIVHAVSSFLFEQNCDIAEHQQFDDTLSDAFFLRTSFVSAEDVDIERL 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             +FQ +  +F + +++ N  +  + +++VS+  HCLNDL++RW  G L   +V VVSNH
Sbjct: 64  TDEFQSVATKFGMTFTV-NGSDLPRVIVMVSKMGHCLNDLIFRWRAGNLGAELVAVVSNH 122

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   LPF ++P+T   K ++E +L+ ++++ + +L++LARYMQ+LSD  C  +
Sbjct: 123 EVLRPMAEAAGLPFVHVPVTPATKPQAEARLLELVDEFDADLVVLARYMQVLSDDACRAL 182

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QA++ GVK +GATAHY   +LD GPIIEQ+V+R+ H  
Sbjct: 183 RGRAINIHHSFLPGFKGAKPYHQAFDRGVKQVGATAHYVTPDLDEGPIIEQEVIRIDHTF 242

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  +G++ EA  L++AV  H + RV ++  +T+VF
Sbjct: 243 DPARLATVGQDAEALALSRAVRWHCENRVLLHGHRTVVF 281


>gi|307546034|ref|YP_003898513.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
 gi|307218058|emb|CBV43328.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
          Length = 288

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 167/281 (59%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
            ++I+T  CPS      ++  +L    C I +   F+D      F+R  F     +   +
Sbjct: 6   DTWIMTAQCPSRLGTVDVVTRFLKESRCYITEQQSFDDSLAEHFFIRTEFRPLDADFDPE 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A F P   +F + + +         +I+VS+ DHCLNDLLYR+  G L + I  VVS
Sbjct: 66  DFHARFAPRAAEFGMAFDLTAPDSRVPVVIMVSKADHCLNDLLYRYRTGQLPIEIRAVVS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K L + + LP+++ P+T + K E E ++  +IE+   EL+ILARYMQ+LS  LC 
Sbjct: 126 NHPDLKPLADWHGLPYHHFPVTAETKAEQEARVWGVIEETGAELVILARYMQVLSSELCE 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V+H
Sbjct: 186 RLAGRAINIHHSLLPGFKGAKPYHQAYAKGVKLVGATAHYINDDLDEGPIITQGVESVSH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               ED +  G++IE   L +AV  H+++RVF+N ++T+VF
Sbjct: 246 VDYPEDLVEKGRDIERLTLARAVAYHVERRVFLNDQRTVVF 286


>gi|114797552|ref|YP_759515.1| formyltetrahydrofolate deformylase [Hyphomonas neptunium ATCC
           15444]
 gi|114737726|gb|ABI75851.1| formyltetrahydrofolate deformylase [Hyphomonas neptunium ATCC
           15444]
          Length = 285

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 170/280 (60%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKL 59
           ++ILT++CP    + + +   +   GC I+    F D  T++ F R+ F        +  
Sbjct: 4   TFILTLSCPDRVGLVASLARLMEEHGCFIVTSRTFGDPQTNRFFARLVFSPPGNGGSLDA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A   P+  +    + IR++ E  +TL+LVS+ DHC N LLY      L + I G+VSN
Sbjct: 64  VKAAMAPLAAEIEADWQIRSSDEKLRTLLLVSKSDHCANTLLYAARRHELPIEITGIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H + K    ++ LP++++P+T  +K ++E  L +IIE+   EL++LARYMQ+LS+  C +
Sbjct: 124 HDSLKPAFAHWGLPWFHVPVTAASKPDAEALLYSIIEETRSELVVLARYMQVLSEEACRR 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR+INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII Q    + H 
Sbjct: 184 LEGRVINIHHSFLPGFKGAQPYHQAHARGVKVIGATAHYVTADLDEGPIITQATETIDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED +  G++IE   L +AV AH + R+F+N  +T+VF
Sbjct: 244 FTPEDMVETGRHIEGIALLRAVKAHAEHRIFLNSGRTVVF 283


>gi|295694969|ref|YP_003588207.1| formyltetrahydrofolate deformylase [Bacillus tusciae DSM 2912]
 gi|295410571|gb|ADG05063.1| formyltetrahydrofolate deformylase [Bacillus tusciae DSM 2912]
          Length = 305

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 170/276 (61%), Gaps = 4/276 (1%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCMKLFIAD 63
           ++CP    + + +  YL +   NI+ + Q++ D D  +LFMR+ F     +   +     
Sbjct: 29  LSCPDRPGVVAAVSQYLYSMNANIVRMDQYSTDPDGGRLFMRVEFDLPRLSDRRRELEEG 88

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F    +   +Q  IR  +E  +  I VS+ DHCL +LL++W  G L+ + V ++SNH   
Sbjct: 89  FARTARPLDMQGEIRYARERKRIAIFVSKMDHCLRELLWQWQAGDLSGDPVVIISNHPDL 148

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
           K +   + LPFY++P+T + K E+E + + I++   V+L++LARYMQILS         R
Sbjct: 149 KDIAATFSLPFYHVPVTRETKPEAEHRQLEILQNYQVDLVVLARYMQILSTEFVSAYPNR 208

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLP+F GANPY++AYE GVK+IGATAHY    LD GPIIEQDV RV H  ++E
Sbjct: 209 IINIHHSFLPAFVGANPYERAYERGVKLIGATAHYVTANLDEGPIIEQDVQRVNHRDSVE 268

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           D   IG++IE  VL +AV  H++ R+   K KT+VF
Sbjct: 269 DLKRIGRHIERVVLARAVAWHLEDRILTYKNKTVVF 304


>gi|221213734|ref|ZP_03586708.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|221166523|gb|EED98995.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
          Length = 295

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/284 (41%), Positives = 175/284 (61%), Gaps = 8/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNT 55
           +  +LT+ C S     + +   L  +GC I ++  F+D  T++ F+R  F       F+ 
Sbjct: 13  TRLVLTVRCQSAPGQVAALVGLLDARGCYIDELDVFDDTYTARFFVRCVFHPVPPGEFDR 72

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                      + ++F + ++I +  E  K LILVS+ DHCL DLL+R  +G L + IVG
Sbjct: 73  AA--LGEALAGVARRFGMDWAIHDLSEKPKVLILVSKFDHCLADLLFRTRMGELPMEIVG 130

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           + SNH   + L  +  + ++YLP+T + K   E +L+ +IE+   EL++LARYMQ+LS  
Sbjct: 131 IASNHPDLEALATSNGIAYHYLPVTPETKAWQEWQLLELIERTGAELIVLARYMQVLSSD 190

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V R
Sbjct: 191 LCMQLAGRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVER 250

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V HA T E  +A+G+++E   L +AV A +++RVFIN  +T+V 
Sbjct: 251 VNHAHTPERLLAVGRDMECLALARAVKAFVERRVFINDNRTVVL 294


>gi|330505360|ref|YP_004382229.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
 gi|328919646|gb|AEB60477.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
          Length = 287

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 172/284 (60%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS       +  +L  Q C + +   F+D  +S+ F+R+ F     F+   
Sbjct: 6   DTWILTAHCPSVLGTVDAVTRFLFEQRCYVTEHHSFDDRLSSRFFIRVEFRQPQDFDEAA 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A     +  F +Q  +       K +++VS+ DHCLNDLLYR  IG LA+++V VV
Sbjct: 66  --FRAGVAERLAPFGMQVELTPPGYRAKVVLMVSKADHCLNDLLYRQRIGQLAMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K L + + +P+++ P+   +K   E++++ ++E+   EL++LARYMQ+LS  LC
Sbjct: 124 SNHPDLKPLADWHGIPYHHFPLAPNDKPAQERRVMQVVEETGAELVVLARYMQVLSADLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ GR INIHHS LP FKGA PY QAY+ GVK++GATAHY    LD GPII Q V  V 
Sbjct: 184 RKLDGRAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYVNDHLDEGPIIAQGVEAVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           HA   ED IA G++IE   L +AV  HI +RVF+N  +T+V  A
Sbjct: 244 HAHYPEDLIAKGRDIECLTLARAVGYHIDRRVFLNANRTVVLNA 287


>gi|295401857|ref|ZP_06811821.1| formyltetrahydrofolate deformylase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111001|ref|YP_003989317.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y4.1MC1]
 gi|294976111|gb|EFG51725.1| formyltetrahydrofolate deformylase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216102|gb|ADP74706.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y4.1MC1]
          Length = 300

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 179/281 (63%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI--- 61
           L I+CP    I + +  +L  QG NI++ SQ++ D +    F+RI F    C  +     
Sbjct: 22  LLISCPDKPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRIEF---DCPNIAARKQ 78

Query: 62  ---ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F+PI + F + + +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+S
Sbjct: 79  EIESAFRPIAESFHMNWRLRLHNDVKRIAIFVSKAEHCLLELLWQWQAGELIADIALVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K  VE+  +P++Y+P+T++ K E+EQK I ++++ NV+ ++LARYMQILS     
Sbjct: 139 NHEYLKSTVESVGIPYFYIPVTKETKAEAEQKQIQLLKQYNVDTIVLARYMQILSPSFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFPGRIINIHHSFLPAFVGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   +G+ IE  VL +A+  H++ RV I++ KTIVF
Sbjct: 259 RHHPDDLKRMGRIIEKTVLARALKWHLEDRVIIHENKTIVF 299


>gi|330812230|ref|YP_004356692.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327380338|gb|AEA71688.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 285

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 170/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F        + 
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEGFDEQN 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F +      + F + + +       K +I+VS+ DHCLNDLLYR  IG L++++V VVSN
Sbjct: 66  FRSGLAERAEAFGMVFELTPPNYRPKVVIMVSKADHCLNDLLYRQRIGQLSMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + +Q+P+Y+ P+   +K   E+++  +IE    EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLKPLADWHQIPYYHFPLDPNDKPSQERQVWQVIEDTGAELVILARYMQVLSPELCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|326795678|ref|YP_004313498.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
 gi|326546442|gb|ADZ91662.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
          Length = 286

 Score =  244 bits (624), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 175/280 (62%), Gaps = 5/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR----ISFVFNTCMKL 59
           ++L  +C +   I + +  YL+  GC I ++ Q++D +T + FMR    I    NT +  
Sbjct: 7   FVLKASCYATSGIVATVSTYLAEHGCYISEMHQYDDEETQRFFMRALCKIESDDNT-IDS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A     V +F++ ++I +  E  K L++VS+ DHCL+DLLYR   G L ++I  +VSN
Sbjct: 66  IRAGLDDQVTKFNMDWNIYDMGEPVKVLLMVSKFDHCLDDLLYRHRKGELRMDITAIVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F +LP+T+ NK E E  L+ ++E+   +L++LARYMQILSD LC +
Sbjct: 126 HKDLRPMAEREGIRFIHLPVTKDNKPEQEAALMAVVEETQTDLVVLARYMQILSDSLCKQ 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ V  V H 
Sbjct: 186 LQGRAINIHHSFLPGFKGAKPYHQAHVRGVKLIGATAHYVTSDLDEGPIIEQSVQPVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +  +A+G++ E   L  AV  H++ RVF+   KT+VF
Sbjct: 246 YSTDRLVAVGRDTETVALATAVRMHLEHRVFMYGNKTVVF 285


>gi|304311140|ref|YP_003810738.1| Formyltetrahydrofolate deformylase [gamma proteobacterium HdN1]
 gi|301796873|emb|CBL45085.1| Formyltetrahydrofolate deformylase [gamma proteobacterium HdN1]
          Length = 284

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           +Y L I+CP    I + +   ++  G  + + S  +D      FMR      +    ++ 
Sbjct: 4   TYRLVISCPDQVGIVARVSQIVAEYGGWLTEASYHSDSHEGWFFMRNEIRAESLRLSLRQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F+P+ +++ +++ + ++ E  +  IL S   HCL D+L+RW+ G L  NI  V+SN
Sbjct: 64  FRDVFRPLAEEYRMKWHVSDSMEKHQVGILASHASHCLADILHRWHSGDLYCNIPCVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +K+VE Y +PFY+LP+  +NK E+ Q+++ +++++  + ++LARYMQIL    C  
Sbjct: 124 HDNLRKMVEWYDIPFYHLPIDRENKEEAHQEMMRLLQQHRADTVVLARYMQILPSWFCKA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M  ++INIHHSFLPSF GANPY+QAYE GVK+IGAT HY    LD GPIIEQDV RV H 
Sbjct: 184 MPNQVINIHHSFLPSFIGANPYQQAYERGVKLIGATCHYVTENLDQGPIIEQDVARVNHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +D + +GK+IE  VL++ + AH++ RV ++  KT++ 
Sbjct: 244 HSRDDMVRLGKDIEMNVLSRGLRAHVEDRVIVHGNKTVIL 283


>gi|119944785|ref|YP_942465.1| formyltetrahydrofolate deformylase [Psychromonas ingrahamii 37]
 gi|119863389|gb|ABM02866.1| formyltetrahydrofolate deformylase [Psychromonas ingrahamii 37]
          Length = 296

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 175/281 (62%), Gaps = 8/281 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTCMK 58
           I+T +CP        +  YL  QGC I +I+ F+D+DT + F+RI F       FN   +
Sbjct: 16  IITASCPGGLGTVDAVTAYLYQQGCYINEINSFDDIDTQRFFIRIEFRPDRQSAFNR--E 73

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            FI+ F+     F + +++    +  K +I+VS+ DHCLNDLLYR+  G L + I  ++S
Sbjct: 74  NFISGFKTKAASFDMDWTLTRKDDKAKVVIMVSKHDHCLNDLLYRYRTGDLKIEIPAIIS 133

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L + + +P+++LP+ +  K + E  +  II+  + +L++LARYMQ+LS  +C 
Sbjct: 134 NHPDLEELAKWHGIPYFHLPVNKDIKPQQEAMIWKIIQDCDADLVVLARYMQVLSSEMCQ 193

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H
Sbjct: 194 RLAGWAINIHHSLLPGFKGAKPYYQAYHKGVKLVGATAHYISDDLDEGPIITQGVETVDH 253

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    D  A G+ IE + L++AV  HI+QRVF++  K++VF
Sbjct: 254 SHYPADLAAKGQAIECQTLSRAVRWHIEQRVFLHGEKSVVF 294


>gi|89095286|ref|ZP_01168206.1| Formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
 gi|89080449|gb|EAR59701.1| Formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
          Length = 285

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/280 (43%), Positives = 173/280 (61%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           +++ILT  C S       +  YL   G  I ++  F+D  + + F+R  F  +     + 
Sbjct: 4   NTWILTAHCASELGTVDAVTGYLYHNGHYIEELHSFDDKISQRFFIRACFRTDGGFDEEK 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F+    +F +Q+ ++      K +I+VS+ DHCLNDLLY+  IG L + I  ++SN
Sbjct: 64  FRTLFELRADKFDMQWELQPQNHTPKVVIMVSKFDHCLNDLLYKNKIGQLNIEIPAIISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + YQ+P+Y+LP++   K E E KL  II++ + EL++LARYMQ+LSD LC K
Sbjct: 124 HPDLKPLADWYQIPYYHLPISADTKPEQESKLWQIIQETDAELVVLARYMQVLSDDLCKK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAYE GVK +GATAHY   +LD GPII Q +  V H 
Sbjct: 184 LEGWAINIHHSLLPGFKGAKPYHQAYEKGVKTVGATAHYINSDLDEGPIIAQGIEPVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L++AV  HI++RVF+N  +T+VF
Sbjct: 244 YYPEDLIAKGRDIERITLSRAVKYHIEKRVFLNDNRTVVF 283


>gi|206564151|ref|YP_002234914.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia J2315]
 gi|198040191|emb|CAR56174.1| putative formyltetrahydrofolate deformylase [Burkholderia
           cenocepacia J2315]
          Length = 294

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 177/287 (61%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI          +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFAPIAAGLGGHAGDMQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T + K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITAETKAQQEAQWLDFFESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVESLTLARAVKAFIERRVFLNGDRTVVFP 294


>gi|220934864|ref|YP_002513763.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996174|gb|ACL72776.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 290

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/280 (40%), Positives = 171/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KL 59
           +Y L ++CP    I + +  +LS  G  I + SQ  D  +   FMR     ++     + 
Sbjct: 10  TYRLIVSCPDRVGIVAAVSGFLSRHGGWITEASQHADQGSGWFFMRYEIRADSLPFDDQG 69

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F PI +QF +Q+ + + +   + +++VS+ DHCL DLLYRW    +  +I  V+SN
Sbjct: 70  LREAFAPIAEQFEMQWQVTDAQVPKRVVLMVSKLDHCLTDLLYRWRSKEMFFDIPCVISN 129

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +  VE + +P++++P+   NK  +  ++  ++E  + + ++LARYMQIL   +CH 
Sbjct: 130 HEDMRDYVEWHGIPYHHVPVDRDNKAPAFAEVTRLVESYDADAVVLARYMQILPPDMCHT 189

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR+INIHHSFLPSF GA PY +A+E GVK+IGAT HY   ELDAGPIIEQDV+RV H 
Sbjct: 190 YAGRVINIHHSFLPSFIGAKPYHKAFERGVKLIGATCHYVTEELDAGPIIEQDVIRVRHD 249

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D + +G+++E  VL + +  H++ RV I+  KT+VF
Sbjct: 250 DTANDLVRLGRDVEKAVLARGLRYHLEDRVLIHGNKTVVF 289


>gi|229593022|ref|YP_002875141.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229364888|emb|CAY52959.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 285

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 169/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
            ++ILT  CPS       +  YL  QGC + +   F+D  + + F+R+ F        + 
Sbjct: 6   DTWILTADCPSVLGTVDAVTRYLFEQGCYVTEHHSFDDRLSGRFFIRVEFPQPDGFDEQG 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F        + F + + +       K +I+VS+ DHCLNDLLYR  IG L++++V VVSN
Sbjct: 66  FRDGLATRGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRIGQLSMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + +Q+P+Y+ P+   +K   E+++  ++E    EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLKPLADWHQIPYYHFPLDPNDKPSQERQVWQVVEDTGAELVILARYMQVLSPELCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|239917001|ref|YP_002956559.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
 gi|281414538|ref|ZP_06246280.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
 gi|239838208|gb|ACS30005.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
          Length = 301

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 174/282 (61%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +++LT+ C + + I   +   L     +I +  Q++  DT   FMR+ FV     +    
Sbjct: 19  AHVLTLACTNRKGIVHAVTGALLGVEADITESQQYDSPDTGDFFMRVEFVTPATREDIEQ 78

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
              P+ ++F ++  + +  +  +TL++ S+  H LNDLL++   GTL + I  VVSNH  
Sbjct: 79  ALAPVREEFGMRMGLWDAAQRMRTLVMCSKDGHTLNDLLFQQRAGTLPIEIPVVVSNHLD 138

Query: 123 HKKLVENYQLPFYYLPMTEQ-----NKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
            + L   Y +PF ++P+++      +K  +E +L ++I + ++EL++LARYMQILSD LC
Sbjct: 139 LQPLASFYGVPFIHVPVSKDPSSRDSKEAAEGRLRDLIAQFDIELVVLARYMQILSDELC 198

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + G  INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII Q V  VT
Sbjct: 199 RDLAGMAINIHHSFLPSFKGARPYHQAHERGVKLIGATAHYVTADLDEGPIIAQSVQPVT 258

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HAQT  D++A G+++E   L +AV  H Q RV  + R+T+VF
Sbjct: 259 HAQTAADFVARGRDVEGSTLAQAVRWHAQHRVLADGRRTVVF 300


>gi|86158434|ref|YP_465219.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774945|gb|ABC81782.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 299

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 176/281 (62%), Gaps = 8/281 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKL-FMRISFVFNTCMKLFIAD 63
           IL + CP    I + I  +L   G NILD  Q   +D     F R+ F  +  + L + D
Sbjct: 20  ILLVQCPDRPGIVAAISSFLYRHGANILDFDQHTSVDNGGAYFTRLEFQTDR-LDLPVED 78

Query: 64  FQ-----PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            Q      + + F++ + +  + +  K  ILVS+ DH L +LL+ W+ G L  ++  V+S
Sbjct: 79  LQRAFALDVARPFAMDWRLTLSSQRKKVAILVSKHDHALLELLWNWDRGDLHADVSTVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +PF ++P T   + ++E +++ +++    +L++LARYMQI+S  L  
Sbjct: 139 NHPDLREAVESFGVPFVHVPNTRDTRAQAEARMLELLD-GKADLVVLARYMQIVSPELVA 197

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA+PY+QAYE GVKI+GATAHY   ELDAGPII+QDV RV+H
Sbjct: 198 RWPGRIINIHHSFLPAFVGADPYRQAYERGVKIVGATAHYVTAELDAGPIIDQDVGRVSH 257

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +ED   +G+++E +VL +AV  H + RV +N  KT+VF
Sbjct: 258 RDAVEDLKRLGRDLERRVLARAVRWHCEDRVIVNGNKTVVF 298


>gi|87200875|ref|YP_498132.1| formyltetrahydrofolate deformylase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136556|gb|ABD27298.1| formyltetrahydrofolate deformylase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 284

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 179/282 (63%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKLF 60
           +S ILT++C     I + +   L   G NI +  QF+D  + + FMR+ F      ++ +
Sbjct: 3   ASLILTLSCEDKPGIVARVTGNLFEAGGNIREAQQFDDPLSGRFFMRVVFDPAEGSVEHY 62

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  +   +++++++R+T    K +++VS+ DHCL DLLYR  IG L +++V ++ NH
Sbjct: 63  RAAFAAVADHYAMEWNLRDTTVKRKVILMVSKFDHCLGDLLYRTRIGELPMDVVAILGNH 122

Query: 121 TTHK---KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
                   L+ +  +P+++LP+T+  K + E ++  I+ +   EL++LARYMQILSD L 
Sbjct: 123 PKEALNISLIGD--IPYHHLPITKDTKPQQEAEVKRIVTETGAELVVLARYMQILSDDLA 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             ++GR INIHHSFLPSFKGA PY QA+  GVK+IGAT HY   +LD GPII QDV  VT
Sbjct: 181 AFLSGRCINIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTADLDEGPIIHQDVETVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + +D +  G+++E +VL +AV  H++ R  +N  KT+VF
Sbjct: 241 HADSPDDLVRKGRDVERRVLAEAVRLHLEDRALVNGNKTVVF 282


>gi|148800304|gb|ABR12869.1| PurU [Mesorhizobium sp. CJ1]
          Length = 297

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 179/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCMKLFI 61
           ++L+++C     I + +   L+  G NI + +QF D  T++ FMRI+F            
Sbjct: 20  HVLSLSCDDRPGIVAAVTTELAAMGANIAESNQFWDRQTNRFFMRIAFAAPVGAVKDDIE 79

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +  V++F ++ S+ +     K +++VS+ DH L  +LY+  +G L   +  +VSNH 
Sbjct: 80  RALKSPVERFGMKASLIDQGRRLKIIVMVSKFDHALLHILYQIKVGWLNAEVAAIVSNHE 139

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +   E   +P++  P+++ +K + E+KL+ ++ + + EL+ILARYMQ+ SD L  ++ 
Sbjct: 140 DSRCNAELAGIPYHCWPISKNDKTKQEEKLLELVRETDAELVILARYMQVFSDALSKRLY 199

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII+Q+  RVTH+ +
Sbjct: 200 GRAINIHHSFLPSFKGAKPYHQAFERGVKLIGATAHYVTPDLDEGPIIDQETERVTHSMS 259

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A+G++IE++VL +AV  H++ RV +N  KTIVF
Sbjct: 260 AEDFVAVGRDIESRVLARAVKLHLETRVMLNGHKTIVF 297


>gi|71905698|ref|YP_283285.1| formyltetrahydrofolate deformylase [Dechloromonas aromatica RCB]
 gi|71845319|gb|AAZ44815.1| formyltetrahydrofolate deformylase [Dechloromonas aromatica RCB]
          Length = 289

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 176/281 (62%), Gaps = 6/281 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           Y L+ +CP    I + +  +++  G  IL+ S  +D+ T + FMRI    ++ +   +A+
Sbjct: 9   YTLSASCPDQVGIIARVSGFIAGNGGWILESSFHSDVLTGRYFMRIEIKADS-LPFLLAE 67

Query: 64  FQP-----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           F+      + +  S+ + I ++    + ++LVS+ +HCL DLL RW    L + I  V+S
Sbjct: 68  FRERFRIEVAEPLSMTWQINDSAVKKRVVVLVSKQEHCLYDLLARWQAKELDIEIPCVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T +  VE + +PF+++P+T  NK  +  ++  I E    + M+LARYMQ+LS  LC 
Sbjct: 128 NHDTFRGFVEWHGIPFHHVPVTADNKAAAYAEIQRIFEDVRGDSMVLARYMQVLSPELCD 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            +TG+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQDV+R+ H
Sbjct: 188 ALTGKIINIHHSFLPSFAGAKPYHQAYTRGVKLIGATCHYVTSELDAGPIIEQDVIRIDH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + + ED +  GK+IE  VL + +  H++ RV ++  KT+VF
Sbjct: 248 SDSPEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTVVF 288


>gi|255019407|ref|ZP_05291515.1| Formyltetrahydrofolate deformylase [Acidithiobacillus caldus ATCC
           51756]
 gi|254971145|gb|EET28599.1| Formyltetrahydrofolate deformylase [Acidithiobacillus caldus ATCC
           51756]
          Length = 286

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 171/281 (60%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           + Y LT++CP    I + +  +L+  G  I + S   D  T + F+R     ++    ++
Sbjct: 5   AHYTLTLSCPDRVGIVARVAGFLAEHGGWITEASHHADAGTGRFFLRQQIQADSLPFDLE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I   F +Q+SI +++   + +++VSQ  HCL DLL RW  G LA++I  V+S
Sbjct: 65  GFRGKFSEIAHTFDMQWSITDSRRRKRMVLMVSQQGHCLYDLLGRWRSGELAVDIPAVIS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T +  VE + +PF+++P+T + K  +  ++  I ++   ++++LARYMQ+L    C 
Sbjct: 125 NHETFRDFVEWHGIPFHHIPVTPETKSAAFAEVSAIFDRVGGDVLVLARYMQVLDAETCA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP F GA PY QAY  GVK++GAT HY   +LD GPIIEQDV+RV H
Sbjct: 185 RYPGRIINIHHSFLPGFVGARPYHQAYARGVKLVGATCHYVTEDLDQGPIIEQDVLRVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                D I  G+++E  VL + +  H++ RV +N ++T+VF
Sbjct: 245 GDMPTDLIRSGRDVEKTVLARGLRYHLEDRVLLNGQRTVVF 285


>gi|209520362|ref|ZP_03269126.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
 gi|209499194|gb|EDZ99285.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
          Length = 291

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 174/284 (61%), Gaps = 13/284 (4%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---------VFNT 55
           +LT+ CPS     + I  +L    C + +++ F+D  + + F+R  F          F T
Sbjct: 11  VLTVACPSAAGQVAAIAGFLEQHRCYVDELNVFDDDLSERFFVRCVFHHVDRDDALQFAT 70

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +    +F PI ++F + ++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG
Sbjct: 71  LKQ----EFAPIAERFRMTWAIHDLASRPKVLIMVSKLEHCLADLLFRWRMGELKMDIVG 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           + SNH   + L   + LPF++LP+T   K + E +L+++ + +  EL+ILARYMQILS  
Sbjct: 127 IGSNHRDLEPLARQHGLPFHHLPITADTKPQQEAQLLDLFDTSGAELLILARYMQILSAE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
               + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V  
Sbjct: 187 TSRALAGRAINIHHSFLPGFKGARPYHQAHARGVKVIGATAHFVTDDLDEGPIIEQGVEP 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+ + E  +  G+++E   L +AV A +++RVFIN  +T+V 
Sbjct: 247 VDHSYSPERLLTTGRDVECITLARAVKAFVERRVFINGERTVVL 290


>gi|83647665|ref|YP_436100.1| formyltetrahydrofolate deformylase [Hahella chejuensis KCTC 2396]
 gi|83635708|gb|ABC31675.1| formyltetrahydrofolate deformylase [Hahella chejuensis KCTC 2396]
          Length = 284

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 181/284 (63%), Gaps = 11/284 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-------ISFVFNT 55
           +Y L I CP    I + +  +L+T    + + S  +D      +MR       + F  N+
Sbjct: 4   TYRLVIACPDRVGIVAKVTTFLATYNGWLTEASHHSDPTNGWFYMRNEIKASSLPFDLNS 63

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
               F   F+PI ++F + + + ++++  + +++ S+  HCL DLL+RW+   +   IVG
Sbjct: 64  ----FRIAFEPIAREFQMCWHVADSQQPKRIVLMASKESHCLADLLHRWHAKEMDGEIVG 119

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH   +++VE + +P+Y++P+   +K  +  ++  +++  + E+++LARYMQIL   
Sbjct: 120 VISNHDDLRRMVEWHDIPYYHVPVDPDDKSVAFAEVERLVDALDAEVIVLARYMQILPPE 179

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC + TGRIINIHHSFLPSF GA PY QAY+ GVK+IGAT HY   +LD GPIIEQDV+R
Sbjct: 180 LCDRYTGRIINIHHSFLPSFAGARPYHQAYKRGVKLIGATCHYVTQDLDEGPIIEQDVIR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H+ TIED + +GK++E +VL + +  H++ RV +++ KTIVF
Sbjct: 240 VNHSDTIEDMVRLGKDVEKQVLARGLRYHLEDRVIVHENKTIVF 283


>gi|2094852|emb|CAA72163.1| PurU-like protein [Rhodobacter capsulatus]
          Length = 274

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 110/225 (48%), Positives = 161/225 (71%), Gaps = 3/225 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M++Y+LT+ C S   I + I +YL+  GCN+ D +Q++DL T + FMR++FV  T   L 
Sbjct: 1   MTTYVLTVNCHSTRGIVAAIANYLADSGCNLTDSNQYDDLLTGQFFMRVTFVSQTGATLD 60

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F+P+ Q+F ++++I + ++  K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  SLKAGFEPVAQEFDMEWAIHDAEKKVKVLLMVSNFGHCLNDLLYRWRIGALPVEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+++ +T++NK E E  L++++E++  EL++LA YM I SD +C 
Sbjct: 121 NHMTYQKVVVNHDIPFHHIKVTKENKPEGEGDLLDVVEESGGELVVLAGYM-IQSDKICQ 179

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICEL 223
           KM+G+II IHHSFL  FKG NPYKQ YE GVK+IG T+HY I  L
Sbjct: 180 KMSGKIIKIHHSFLARFKGGNPYKQVYERGVKLIGVTSHYVITAL 224


>gi|171315428|ref|ZP_02904665.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
 gi|171099428|gb|EDT44163.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
          Length = 294

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 177/287 (61%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  ++  F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDDDLSNHFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI  +        Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFGPIAAELGGRDGDTQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++++E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDVLESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVESLTLARAVKAFIERRVFLNGDRTVVFP 294


>gi|289705989|ref|ZP_06502363.1| formyltetrahydrofolate deformylase [Micrococcus luteus SK58]
 gi|289557326|gb|EFD50643.1| formyltetrahydrofolate deformylase [Micrococcus luteus SK58]
          Length = 301

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 172/282 (60%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +++LT+ C + + I   +   L     +I +  Q+   DT   FMR+ FV     +    
Sbjct: 19  AHVLTLACTNRKGIVHAVTGALLGVEADITESQQYGSPDTGDFFMRVEFVTPAVREDIEQ 78

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
              P+ ++F ++  + +     +TL++ S+  H LNDLL++   GTL + I  VVSNH  
Sbjct: 79  ALAPVREEFGMRMGLWDAAHRMRTLVMCSKDGHTLNDLLFQQRAGTLPIEIPVVVSNHLD 138

Query: 123 HKKLVENYQLPFYYLPMTEQ-----NKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
            + L   Y +PF ++P+++      +K  +E +L ++I + ++EL++LARYMQILSD LC
Sbjct: 139 LQPLASFYGVPFIHVPVSKDPSSRDSKEAAEDRLRDLIAQFDIELVVLARYMQILSDELC 198

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + G  INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII Q V  VT
Sbjct: 199 RDLAGMAINIHHSFLPSFKGARPYHQAHERGVKLIGATAHYVTADLDEGPIIAQSVQPVT 258

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HAQT  D++A G+++E   L +AV  H Q RV  + R+T+VF
Sbjct: 259 HAQTAADFVARGRDVEGSTLAQAVRWHAQHRVLTDGRRTVVF 300


>gi|308178984|ref|YP_003918390.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307746447|emb|CBT77419.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 290

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 175/282 (62%), Gaps = 6/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FI 61
           Y+LT+TC     I   +   L     +I ++ Q +D  +  LFMRI F           I
Sbjct: 8   YVLTLTCAERPGIVHAVTGLLLKHHGDIRELKQHDDQRSGTLFMRIEFDVAEARDAPAEI 67

Query: 62  ADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A+ +     +  +    + +R + +  + +++VS+  HCL+DLL+R  +G L + I  VV
Sbjct: 68  AELESSLGKLADEHQATWGLRPSGKKKRVVVMVSKFGHCLHDLLFRARMGELPVEIAAVV 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH  H++ VE   +PF+++P+T Q+K E+E KL++++++  V+L++LARYMQ+LSD L 
Sbjct: 128 SNHPDHRQQVEWNGIPFFHVPVTAQSKPEAEAKLMDLVDRFEVDLVVLARYMQVLSDDLT 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+TGR INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q V  V 
Sbjct: 188 RKLTGRAINIHHSFLPSFKGAKPYHQAFERGVKTVGATAHYVNSELDEGPIITQRVQEVD 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   E  +A G++ E K L+ AV  H + RVF++  +T+V 
Sbjct: 248 HSYEPEHLVAAGRDTECKALSDAVRWHCEDRVFLSGSRTVVL 289


>gi|289526942|pdb|3LOU|A Chain A, Crystal Structure Of Formyltetrahydrofolate Deformylase
           (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At
           1.90 A Resolution
 gi|289526943|pdb|3LOU|B Chain B, Crystal Structure Of Formyltetrahydrofolate Deformylase
           (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At
           1.90 A Resolution
 gi|289526944|pdb|3LOU|C Chain C, Crystal Structure Of Formyltetrahydrofolate Deformylase
           (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At
           1.90 A Resolution
 gi|289526945|pdb|3LOU|D Chain D, Crystal Structure Of Formyltetrahydrofolate Deformylase
           (Yp_105254.1) From Burkholderia Mallei Atcc 23344 At
           1.90 A Resolution
          Length = 292

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 170/281 (60%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +   L    C + +++ F+D  +++ F+R  F           D
Sbjct: 11  FVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATDDADALRVD 70

Query: 64  -----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F  Q++I +     K LI VS+ +HCL DLL+RW  G L  +IVG+VS
Sbjct: 71  ALRREFEPIAERFRXQWAIHDVAARPKVLIXVSKLEHCLADLLFRWKXGELKXDIVGIVS 130

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   + LPF + P+T   K + E + +++ E +  EL+ILARY Q+LS     
Sbjct: 131 NHPDFAPLAAQHGLPFRHFPITADTKAQQEAQWLDVFETSGAELVILARYXQVLSPEASA 190

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 191 RLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 250

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 251 SYRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 291


>gi|189909413|gb|ACE60614.1| YkkE [Halobacillus aidingensis]
          Length = 298

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 177/278 (63%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L ++CP    I S I  +L   G NI++ +QF  D +    F+RI F      +  K   
Sbjct: 21  LLVSCPDKPGIVSSISTFLYEHGANIVESNQFTTDHEEGTFFLRIVFAAENMKSIEKTMK 80

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           ADF  + +QF + + +    E  +T + VS+  HCL +LLY W  G L  +I  V+SNH 
Sbjct: 81  ADFHSLAEQFEMTWRMTFLHELKRTAVFVSKELHCLRELLYEWESGDLVTDISLVISNHE 140

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           + +++VE++ +PFYY+P  ++ + E E+K ++++E+ N++L+ILARYMQIL+     +  
Sbjct: 141 SAREIVESFGIPFYYIPANKEIREEVEEKQLDLLEEYNIDLIILARYMQILTPKFVDRHP 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GANP+K+AY+ GVK+IGAT+HY   +LD GPIIEQDV+RV H  +
Sbjct: 201 SKIINIHHSFLPAFIGANPHKRAYKRGVKLIGATSHYVTDDLDEGPIIEQDVIRVDHRNS 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + D    G+ IE  VL +AV   ++ RV ++K KTIV 
Sbjct: 261 VNDLKKKGRLIERSVLNRAVKWALEDRVIVHKNKTIVL 298


>gi|319789801|ref|YP_004151434.1| formyltetrahydrofolate deformylase [Thermovibrio ammonificans HB-1]
 gi|317114303|gb|ADU96793.1| formyltetrahydrofolate deformylase [Thermovibrio ammonificans HB-1]
          Length = 284

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 176/277 (63%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIA 62
           L I+CP  + I + +  +++  G NIL   Q  D   S  FMRI +    F         
Sbjct: 7   LLISCPDRKGILAEVTGFIARNGGNILHADQHIDFQKSIFFMRIEWDLSGFKIPKGEIEK 66

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F+PI QQF + Y +  + E  +  I VS+ DHCL +LLYR+  G L   +V V+SNH  
Sbjct: 67  AFRPIAQQFKMNYQLHFSSEVKRVAIFVSKYDHCLYELLYRFKAGELKGELVTVISNHRD 126

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + +VE + +PF Y P + +NK E+E++ I I+E+  ++L++LARYMQILSD   ++   
Sbjct: 127 LQPVVEMFGVPFVYSPKSRENKREAEEREIEILEREGIDLIVLARYMQILSDRFVNRFRN 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F GA PY +AYE GVKIIGAT+HY   ELD GPIIEQDVVRVTH  ++
Sbjct: 187 RIINIHHSFLPAFVGAKPYHRAYERGVKIIGATSHYVTEELDQGPIIEQDVVRVTHRDSV 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL +AV  H++ +V +   KT++F
Sbjct: 247 EDMIRKGRDLEKLVLARAVKWHLENKVLVYDNKTVIF 283


>gi|78061435|ref|YP_371343.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
 gi|77969320|gb|ABB10699.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
          Length = 294

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 177/286 (61%), Gaps = 12/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIV-----QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI      +Q  +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRHEFAPIAASLGGEQGDMQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITADTKAQQEAQWLDFFESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VF
Sbjct: 248 ERVDHALRPEQLLAVGRDVESLTLARAVKAFIERRVFLNGDRTVVF 293


>gi|213967772|ref|ZP_03395919.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|301382408|ref|ZP_07230826.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061199|ref|ZP_07252740.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302132429|ref|ZP_07258419.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213927548|gb|EEB61096.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
          Length = 285

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 120/282 (42%), Positives = 171/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFKAGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWRVIEESRAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAYE GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYEKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|297565948|ref|YP_003684920.1| formyltetrahydrofolate deformylase [Meiothermus silvanus DSM 9946]
 gi|296850397|gb|ADH63412.1| formyltetrahydrofolate deformylase [Meiothermus silvanus DSM 9946]
          Length = 287

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 179/281 (63%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF------VFNTCMK 58
           L ITCP    I + +  +L   G NI D+ Q + D +    FMR+ F      V    ++
Sbjct: 9   LLITCPDRPGIVAAVSTFLFNHGANITDLQQHSTDPEGGTFFMRLEFQTPHLDVSRGVLE 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A  + + ++F++++     +E  K  +LVS+ DH L ++L+RW+ G L   +  V+S
Sbjct: 69  RAFA--EAVAERFAMEWRFAYAEEPKKMALLVSRYDHALLEVLWRWSRGELPAKVSMVIS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +  V  + LP++++P++++NK E+E  ++ ++E    +L++LARYMQILS     
Sbjct: 127 NHPDLEPAVRAFGLPYHHVPVSKENKAEAEASILELLE-GQADLVVLARYMQILSADFVS 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQDV RV+H
Sbjct: 186 RFPHRIINIHHSFLPAFVGASPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVARVSH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++ED + +G+++E +VL +AV  H++ R+ ++  KT+VF
Sbjct: 246 RHSVEDLVELGRDLERQVLARAVRWHLEDRIIVHGNKTVVF 286


>gi|167031368|ref|YP_001666599.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
 gi|166857856|gb|ABY96263.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
          Length = 285

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 169/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F          
Sbjct: 6   DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRAPDGFDEDG 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A      + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VVSN
Sbjct: 66  FRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + +++P+Y+  +  ++K   E+K++ +IE+   EL+ILARYMQ+LS  LC +
Sbjct: 126 HPDLEPLAQWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|326795809|ref|YP_004313629.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
 gi|326546573|gb|ADZ91793.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
          Length = 285

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 178/279 (63%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR---ISFVFNTCMKLF 60
           Y L I+CP    I + +  +L+ +  +I++ S   D +    FMR    +   N  ++ F
Sbjct: 5   YRLVISCPDRVGIVAAVSQFLNERQGSIVEASHHTDPEQKWFFMRHVIDAESLNISVEEF 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F PI  QF + + + ++ +  K ++L ++  HCLND+L+RW+ G L+ +IVGV++NH
Sbjct: 65  REQFAPIADQFDMTWYVNDSADRPKVMLLATKESHCLNDILHRWHTGELSCDIVGVIANH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + +VE Y++P++ + + +++K+ + Q +   I+ +  + ++LARYMQI  ++LC K 
Sbjct: 125 EELRSMVEWYKVPYHCIQVPKEDKMPAFQAIEKCIDDSEADTIVLARYMQIFPEYLCEKY 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             R+INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H+ 
Sbjct: 185 RHRVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRHSH 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 245 TAADMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 283


>gi|70733009|ref|YP_262782.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
 gi|68347308|gb|AAY94914.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 285

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 170/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     +  + 
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDGLNEQG 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F        + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VVSN
Sbjct: 66  FREGLAQRAKAFEMNFELTAPHYRPKVVIMVSKADHCLNDLLYRQRIGQLPMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + +Q+P+++ P+   +K   E+++  +IE +  EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLKPLADWHQIPYHHFPLDPNDKPSQERQVWQVIEDSGAELVILARYMQVLSPELCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 YYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNGNRTVVL 285


>gi|291612543|ref|YP_003522700.1| formyltetrahydrofolate deformylase [Sideroxydans lithotrophicus
           ES-1]
 gi|291582655|gb|ADE10313.1| formyltetrahydrofolate deformylase [Sideroxydans lithotrophicus
           ES-1]
          Length = 284

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 175/285 (61%), Gaps = 8/285 (2%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC- 56
           MSS   Y LTI+CP    I + +  +++  G  I++ S   + + S+ FMR     ++  
Sbjct: 1   MSSTHRYTLTISCPDRAGIIAAVSGFIAQHGGFIVEASYHTEQEASRFFMRQEIRADSLP 60

Query: 57  --MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                F   F P+ Q+F + + + ++ +  + +ILVS+ DHCLNDLL+RW  G L ++I 
Sbjct: 61  FDANEFRHRFAPLAQEFGMDWQLADSAQKKRLVILVSKQDHCLNDLLHRWRSGELQVDIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            V+SNH   +  VE + +PF ++ M  Q+K  + + +    E+   + M+LAR+MQIL  
Sbjct: 121 CVISNHEDLRSFVEWHGIPFVHIDM--QDKAAAFELIAARFEQYRGDCMVLARFMQILPP 178

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC +  GR+INIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD V
Sbjct: 179 ALCRRFPGRVINIHHSFLPSFVGAKPYHQAYLRGVKLIGATCHYVTEELDAGPIIEQDTV 238

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R+ H  T++D +  G++IE  VL++ +  H++ RV +   KTIVF
Sbjct: 239 RIDHGDTVDDLVRYGRDIEKTVLSRGLRYHVEDRVLVCGNKTIVF 283


>gi|239827062|ref|YP_002949686.1| formyltetrahydrofolate deformylase [Geobacillus sp. WCH70]
 gi|239807355|gb|ACS24420.1| formyltetrahydrofolate deformylase [Geobacillus sp. WCH70]
          Length = 300

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 120/281 (42%), Positives = 178/281 (63%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI--- 61
           L I+CP    I + +  +L  QG NI++ SQ++ D +    F+RI F    C  + +   
Sbjct: 22  LLISCPDKPGIVASVTSFLYEQGANIVESSQYSTDPEGGTFFLRIEF---DCPNIALRKQ 78

Query: 62  ---ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + FQPI + F + + +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+S
Sbjct: 79  EIESAFQPIAESFHMDWRLRLHNDVKRIAIFVSKAEHCLLELLWQWQAGELIADIALVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +  VE+  +P++++P+T++ K E+EQK I +++K  V+ ++LARYMQILS     
Sbjct: 139 NHEHLRSTVESVGIPYFHIPVTKETKAEAEQKQIELLKKYEVDTIVLARYMQILSPAFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   +G+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 259 RHHPDDLKRMGRIIEKTVLARALKWHLEDRVIIHGNKTIVF 299


>gi|119475832|ref|ZP_01616184.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2143]
 gi|119450459|gb|EAW31693.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2143]
          Length = 289

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 182/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR--ISFVFNTCMKL- 59
           +Y L I+CP    I + +  +++    ++++ +   D+D+   FMR  IS     C  L 
Sbjct: 9   TYRLIISCPDKVGIVARVTQFIAEYDGSLMEANNHTDMDSQWFFMRCVISAESLKCSLLE 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F P+  ++S+++ IR++    K ++L S   HCL DLLYRW+ G L  +I  V+SN
Sbjct: 69  FEEYFSPVADEYSMKWYIRDSMVKQKVVLLASHASHCLADLLYRWHSGELDCDIPCVISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE + +PF+++ + + N+  S QK+ +IIE++  + ++LARYMQI+   LC K
Sbjct: 129 HENLRSMVEWHGIPFHHVIVDKNNRDASFQKVEDIIERHEADTVVLARYMQIIPPSLCKK 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR+INIHHSFLPSF GANPY++A+E GVK+IGAT+HY   +LD GPII+QDVVRV H 
Sbjct: 189 YEGRLINIHHSFLPSFIGANPYQKAFERGVKLIGATSHYVTPDLDEGPIIDQDVVRVNHR 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++ + +GK++E  VL++A+  H+  RV ++  KT+VF
Sbjct: 249 HNKDELVRLGKDVEKSVLSRALRNHLDDRVIVSGNKTVVF 288


>gi|301598784|pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598785|pdb|3NRB|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598786|pdb|3NRB|C Chain C, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598787|pdb|3NRB|D Chain D, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
          Length = 287

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 176/280 (62%), Gaps = 6/280 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC-MKLFIA 62
           Y+L++ C     I S +  +L   G NI++  QFND D+SK F R+S       +  F +
Sbjct: 8   YVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFXRVSVEIPVAGVNDFNS 67

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +V++++ ++  R   +  K +I VS+ DHCL DLLYR  +G L   +VG++SNH  
Sbjct: 68  AFGKVVEKYNAEWWFRPRTDRKKVVIXVSKFDHCLGDLLYRHRLGELDXEVVGIISNHPR 127

Query: 123 HK---KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                 LV +  +PF+YLP+T   K   E ++ NI+ ++  +L++LARY QILSD L   
Sbjct: 128 EALSVSLVGD--IPFHYLPVTPATKAAQESQIKNIVTQSQADLIVLARYXQILSDDLSAF 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPII QDV  V+H 
Sbjct: 186 LSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHR 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  G++IE +VL++AV   ++ R+ +N  +T+VF
Sbjct: 246 DSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 285


>gi|254490556|ref|ZP_05103742.1| formyltetrahydrofolate deformylase [Methylophaga thiooxidans
           DMS010]
 gi|224464300|gb|EEF80563.1| formyltetrahydrofolate deformylase [Methylophaga thiooxydans
           DMS010]
          Length = 285

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 177/281 (62%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           MSS +  I C   + + + I  + + +  NIL   Q+ D++  + FMRI       +  +
Sbjct: 1   MSSIVFLIQCTDQKGLVAGITSFFAERQFNILHCQQYTDVEIGQYFMRIKLEDEGTLPHE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F+   Q  +L +S+R ++   +  +LV++  HC  DLL R   G L  +I  ++ 
Sbjct: 61  QLEAEFERFAQTVNLSWSVRYSETPYRVALLVTRASHCPYDLLLREYEGELKCDIPLIIG 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++   +  PFY+LP++++ K+E E  +  ++ + +++L+++ARYMQILS+    
Sbjct: 121 NHKDLEQMARQFDKPFYHLPISKETKLEQEAAIKKLLTEYDIDLVVMARYMQILSEQFVQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  G++INIHH FLP+F+GA PY QAYE GVKIIGATAHYA  +LD GPIIEQDV RV H
Sbjct: 181 EFAGKVINIHHGFLPAFQGARPYHQAYERGVKIIGATAHYATADLDEGPIIEQDVQRVMH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + ED + +GK+IE  VL +AV AHI+ R+ I+ R+TIVF
Sbjct: 241 DNSPEDLVMVGKDIERMVLARAVKAHIEHRIIISGRRTIVF 281


>gi|170702865|ref|ZP_02893711.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
 gi|170132221|gb|EDT00703.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
          Length = 307

 Score =  241 bits (616), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 117/286 (40%), Positives = 174/286 (60%), Gaps = 13/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------TCM 57
           Y+L  +CP    +   +   L+  G ++LD +Q++D  + +LFMRI FV +      T +
Sbjct: 24  YVLAASCPVQRGMIHRVSSLLADLGGHVLDSAQYSDPSSQRLFMRIVFVVDDGGATETAL 83

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +  I       +   LQ+ +   ++  + L++ S+  HCLNDLL+R   GTL + +  VV
Sbjct: 84  RAGIGLLD---RGADLQWQLFAARQRPRVLLMASKLGHCLNDLLFRHASGTLPVEVCDVV 140

Query: 118 SNHTTHKKLVENYQLPFYYLPM----TEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           SNH    +LV+ Y LPF++ P+    +   +   E+ ++ ++  +++EL++LARYMQILS
Sbjct: 141 SNHRDLARLVDGYNLPFHHFPLPAHASADERAAQERGILALVGAHDIELVVLARYMQILS 200

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
              C  + GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAH+   +LD GPIIEQDV
Sbjct: 201 AGFCEALKGRIINIHHSFLPSFKGAQPYGQAHARGVKLIGATAHFVTRDLDEGPIIEQDV 260

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R+ HA + E    IG + E  VL +AV    ++RV +N  KT+VF
Sbjct: 261 TRIDHAMSPEALATIGGDAECVVLARAVKWFAERRVLLNGNKTVVF 306


>gi|87121292|ref|ZP_01077182.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
 gi|86163449|gb|EAQ64724.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
          Length = 285

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 182/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKL- 59
           +++ L I+CP    I + + D +     +I++ S   D +    FMR      N  + L 
Sbjct: 3   NTFRLVISCPDTVGIVAAVSDIIQENNGSIMEASHHTDPEQKWFFMRHEVDAENMAISLA 62

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F+PI ++F + + I++++E  K +++ ++  HCLND+L+RW+ G L  +IVGV++
Sbjct: 63  EFKQAFEPIAKKFQMDWYIKDSEERPKVILMATRESHCLNDILHRWHTGELYCDIVGVIA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE + +PF+++ + +++K+E+ +K+   I+++  E ++LARYMQI  ++LC 
Sbjct: 123 NHEELRSMVEWFNIPFHFIQVPKEDKMEAFEKIEKCIDESQAETIVLARYMQIFPEYLCE 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H
Sbjct: 183 KYRHQVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T    + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 243 SHTAPAMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 283


>gi|115359232|ref|YP_776370.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|170697165|ref|ZP_02888260.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
 gi|115284520|gb|ABI90036.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|170138001|gb|EDT06234.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
          Length = 294

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 176/287 (61%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  ++  F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDDDLSNHFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI  +        Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFGPIAAELGGRDGDTQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++ +E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFLESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVESITLARAVKAFIERRVFLNGDRTVVFP 294


>gi|78486390|ref|YP_392315.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
 gi|78364676|gb|ABB42641.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
          Length = 285

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 174/279 (62%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR---ISFVFNTCMKLF 60
           + L I+CP    I + +  +++++G +I++ +   D      FMR   ++      +  F
Sbjct: 5   FRLIISCPDQVGIVAKVAGFIASEGGSIIEANHHTDALNQWFFMRHEILASSLKNDLDGF 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I   F + + I ++ +  K  +  S+  HCL DLLYRW+   L   +  V++NH
Sbjct: 65  KTKFAAIAADFDMDWQITDSDQPKKIALFASKESHCLADLLYRWHENDLPGEVACVIANH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++VE Y +PF+++P+T   K E+  K   ++ + +V++++LARYMQIL   +C   
Sbjct: 125 DDLRRMVEWYDIPFHHVPVTPDTKTEAFAKSQQLVAQYDVDVIVLARYMQILPPQMCLDY 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQDV+RV+H+Q
Sbjct: 185 AGRVINIHHSFLPSFVGAKPYHQAYERGVKLIGATCHYVTEELDAGPIIEQDVIRVSHSQ 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +I+D   +G+++E  VL++ +  H++ RV I+  KT+VF
Sbjct: 245 SIDDMRRLGRDVEKTVLSRGLRYHLEDRVLIHGNKTVVF 283


>gi|15606867|ref|NP_214247.1| formyltetrahydrofolate deformylase [Aquifex aeolicus VF5]
 gi|2984098|gb|AAC07636.1| formyltetrahydrofolate deformylase [Aquifex aeolicus VF5]
          Length = 283

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M + IL ++CP  + +   I  +++  G NI+   Q  D  T     R+ +    F    
Sbjct: 1   MQNAILLVSCPDRKGLVKEISSFIADNGGNIVSFDQHIDEQTKTFLARVEWSLEDFKIPR 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +    +F+ + Q+FS+ + I  +    K  I VS+ +HC  DL++R+  G L   +  V+
Sbjct: 61  EKIENEFKKVAQKFSMNFQISFSDYVKKVAIFVSKQEHCFYDLMHRFYSGELKGEVKLVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +K  E + +PFY++P T++NK+E+E++ + ++++  VEL++LARYMQILS    
Sbjct: 121 SNHEKARKTAEFFGVPFYHIPKTKENKLEAEKRELELLKEYGVELVVLARYMQILSPKFV 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GA PY++A+  GVKIIGATAHY   ELD GPIIEQDVVRV+
Sbjct: 181 KEYENKIINIHHSFLPAFPGAKPYERAFGKGVKIIGATAHYVTEELDEGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  ++ED+I  GK+IE  VL +AV  H++ ++ +   KT+VF
Sbjct: 241 HKDSLEDFIRKGKDIEKVVLARAVKWHLEDKILVYNGKTVVF 282


>gi|87121790|ref|ZP_01077677.1| Formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
 gi|86163041|gb|EAQ64319.1| Formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
          Length = 290

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 175/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           + ++L  +C +   I + +  Y+++QGC I +++Q+ D D+ + FMR      T  K   
Sbjct: 9   NEFVLKASCTAKSGIVAAVTSYIASQGCYISELNQYVDEDSEQFFMRAVCRIETGEKTVD 68

Query: 61  -IAD-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            I D F  +   F +++ +       + L++VS+ DHCL++LLYR   G L + I  +VS
Sbjct: 69  EIRDGFSAVADPFDIKWELHAKATLMRVLLMVSKFDHCLDNLLYRHRKGELPMEITAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F +LP+T++NK E E  L++I+ +   +L++LARYMQILSD LC 
Sbjct: 129 NHKDLRPMAEREGIRFVHLPVTKENKREQELALMDIVNETETDLVVLARYMQILSDSLCK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPII Q V  V H
Sbjct: 189 ELNGRAINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTPDLDEGPIIAQSVQPVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E  +++G++ E   L +A+  HI+ RVF++  KT+VF
Sbjct: 249 TYNPEMLVSVGRDTETVALARALQLHIEHRVFLDGNKTVVF 289


>gi|107025651|ref|YP_623162.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116693167|ref|YP_838700.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
 gi|170737570|ref|YP_001778830.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
 gi|105895025|gb|ABF78189.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116651167|gb|ABK11807.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
 gi|169819758|gb|ACA94340.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
          Length = 294

 Score =  241 bits (615), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 175/287 (60%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFSL-----QYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI           Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFAPIAAGLGGHDGDNQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITADTKAQQEAQWLDFFESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVESLTLARAVKAFIERRVFLNGDRTVVFP 294


>gi|26987069|ref|NP_742494.1| formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148545604|ref|YP_001265706.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|24981693|gb|AAN65958.1|AE016224_2 formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148509662|gb|ABQ76522.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|313496691|gb|ADR58057.1| PurU [Pseudomonas putida BIRD-1]
          Length = 285

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 170/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAG 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A      + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VV
Sbjct: 66  --FRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   +++P+Y+  +  ++K   E+K++ +IE+   EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|134292129|ref|YP_001115865.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
 gi|134135286|gb|ABO56400.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
          Length = 294

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 175/287 (60%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  ++  F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDDDLSNHFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI    +      Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRHEFGPIAAALAGDGGDTQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITADTKAQQEAQWLDFFESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E+  L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVESLTLARAVKAFIERRVFLNGDRTVVFP 294


>gi|302188544|ref|ZP_07265217.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae 642]
          Length = 285

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 167/280 (59%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F          
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDEHA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VVSN
Sbjct: 66  FRAGLSERGETFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   + +P+YY P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC K
Sbjct: 126 HPDLEPLAGWHGIPYYYFPLDPNDKPAQEGKVWQVIEESGAELVILARYMQVLSPDLCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+
Sbjct: 186 LDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|146309141|ref|YP_001189606.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145577342|gb|ABP86874.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 287

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 171/284 (60%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS       +  +L  Q C + +   F+D  +S+ F+R+ F     F+   
Sbjct: 6   DTWILTAHCPSVLGTVDAVTRFLFEQRCYVTEHHSFDDRLSSRFFIRVEFRQPEGFDEAA 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A     +  F++Q  +       K +++VS+ DHCLNDLLYR  IG LA+++V VV
Sbjct: 66  --FRAGVAERLAPFAMQVELTPPGYRAKVVLMVSKADHCLNDLLYRQRIGQLAMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+++ P+   +K   E+K++ +IE+   EL++LARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLARWHGIPYHHFPLDPADKPAQERKVLQVIEETGAELVVLARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G  INIHHS LP FKGA PY QAY+ GVK++GATAHY    LD GPII Q V  V 
Sbjct: 184 RRLDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYVNDHLDEGPIIAQGVEAVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           HA   ED IA G++IE   L +AV  HI +RVF+N  +T+V  A
Sbjct: 244 HAHYPEDLIAKGRDIECLTLARAVGYHIDRRVFLNANRTVVLNA 287


>gi|104784070|ref|YP_610568.1| formyltetrahydrofolate deformylase [Pseudomonas entomophila L48]
 gi|95113057|emb|CAK17785.1| formyltetrahydrofolate deformylase [Pseudomonas entomophila L48]
          Length = 285

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 168/280 (60%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT  CPS      ++  +L  Q C + +   F+D  + + F+R+ F          
Sbjct: 6   DTWILTADCPSMLGTVDVVTRHLYEQRCYVTEHHSFDDRLSGRFFIRVEFRAPDGFDENA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A      + F + + +       K +I+VS+ DHCLNDLLYR  IG LA+++V VVSN
Sbjct: 66  FRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLAMDVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   +++P+Y+  +   +K   E+K++ +IE+   EL+ILARYMQ+LS  LC +
Sbjct: 126 HPDLEPLAHWHKIPYYHFALDPNDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V HA
Sbjct: 186 LDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|312962785|ref|ZP_07777272.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
 gi|311282812|gb|EFQ61406.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
          Length = 282

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWHITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHIPVDPQDKEPAFAEVSRLVKQHEADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  G++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAGKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|226939945|ref|YP_002795018.1| PurU [Laribacter hongkongensis HLHK9]
 gi|226714871|gb|ACO74009.1| PurU [Laribacter hongkongensis HLHK9]
          Length = 286

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 172/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S  L ++CP  + + + I ++L T   NIL   Q  D   +   MR+ +    F   M+ 
Sbjct: 6   SATLLMSCPDKKGLVAAIANFLMTYNANILHADQHQDEVENLFLMRVEWDLDGFTLPMES 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A FQPI  +  + + +  +    +  I VS+ +HCL DLL+RW IG LA +I  V+SN
Sbjct: 66  FSAAFQPIADEHQMNWHVSLSSRKPRMAIFVSKYEHCLVDLLHRWRIGELACDIPLVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE   +PF+ +P+T  NK E+E +   ++E+  V+ M+LARYMQ+LS     +
Sbjct: 126 HEDCRRIVEFNGIPFHVIPVTRDNKAEAEAEQFRLLEEAGVDFMVLARYMQVLSGEFVKR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY   +LD GPIIEQ+V R++H 
Sbjct: 186 YPNRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEDLDEGPIIEQEVTRISHR 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ED +  G+++E  VL++AV  H+  RV     KT+VF
Sbjct: 246 DSVEDLVERGRDLEKVVLSRAVRWHVDNRVLSYSNKTVVF 285


>gi|229592325|ref|YP_002874444.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229364191|emb|CAY51858.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 282

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWHITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHEADVVVLARYMQILPPELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  G++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAGKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|172064022|ref|YP_001811673.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
 gi|171996539|gb|ACB67457.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
          Length = 294

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 175/287 (60%), Gaps = 12/287 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  ++  F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDDDLSNHFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI  +        Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFGPIAAELGGRDGDTQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++ +E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFLESSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RV HA   E  +A+G+++E   L +AV A I++RVF+N  +T+VFP
Sbjct: 248 ERVDHALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFP 294


>gi|300113988|ref|YP_003760563.1| formyltetrahydrofolate deformylase [Nitrosococcus watsonii C-113]
 gi|299539925|gb|ADJ28242.1| formyltetrahydrofolate deformylase [Nitrosococcus watsonii C-113]
          Length = 283

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 180/283 (63%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-----ISFVFNTC 56
           S + L I+CP    I + +  ++++ G  I + S ++D  +   FMR      S  F   
Sbjct: 3   SEFRLIISCPDRVGIVAEVSSFIASHGGWINEASHYSDPVSGWFFMRHCIKSSSLPFG-- 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +K F   F PI Q++ +++S+ ++    + +++ S+  HCL DLL+RW+   L  +I  +
Sbjct: 61  IKAFKDKFSPIAQKYKMKWSLSDSSVKKRVVLMASKESHCLVDLLHRWHSNELYCDIRCI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   K+LV+ Y  P++++P+  + K  + +++I +IE N+ +L++LARYMQIL   +
Sbjct: 121 ISNHERLKQLVDAYGAPYHFVPIAGEKKEGAFRRIIQLIEDNHTDLIVLARYMQILPGDI 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C+    RIINIHHSFLPSF GA PY QA E GVK+IGAT HY    LDAGPII+QDV+RV
Sbjct: 181 CNTYQNRIINIHHSFLPSFVGAKPYHQASERGVKLIGATCHYVTEALDAGPIIDQDVIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  T++D I +G+++E  VL + V +H+  RV ++  KTIVF
Sbjct: 241 SHHNTVDDMIRLGRDVEKLVLARGVRSHLGDRVLVHGNKTIVF 283


>gi|327479724|gb|AEA83034.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri DSM 4166]
          Length = 283

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + +  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEANHHSDHQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L  +I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSERRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P++++P+   NK E+  ++  ++ +   ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYFHVPVDPANKQEAFAEVTRLVREQRADVIVLARYMQILPAELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 DEFAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IED + +GK++E  VL++ +  H++ RV ++  KT+VF
Sbjct: 241 HRDSIEDMVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTLVF 282


>gi|325273747|ref|ZP_08139944.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
 gi|324101121|gb|EGB98770.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
          Length = 285

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 170/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAG 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A      + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VV
Sbjct: 66  --FRAGLAERGEAFGMVFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   +++P+Y+  +  ++K   E+K++ +IE+   EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|88706482|ref|ZP_01104186.1| formyltetrahydrofolate deformylase [Congregibacter litoralis KT71]
 gi|88699194|gb|EAQ96309.1| formyltetrahydrofolate deformylase [Congregibacter litoralis KT71]
          Length = 286

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 174/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TC-MKL 59
           SYILT +CP +  + +         G NI +IS + D  +   F+R  F  +  +C ++ 
Sbjct: 7   SYILTFSCPDSIGVVARYSQLFFECGINITEISNYTDPVSDTFFLRCVFDVSGMSCSLEQ 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A  +P+  +  + Y +R      K ++ VS+ DHCL  LL +   G L   IV VVSN
Sbjct: 67  FEARLRPVADELQMTYLLRCVSTLPKIVVAVSRYDHCLTALLTKQRAGALPAQIVAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L E + +PF+YLP+T ++K   E +++ I+ ++  +L++LARYMQILSD LC +
Sbjct: 127 HEDCRGLSEWHGVPFHYLPVTPESKPVQEAEMLAILRESEADLLVLARYMQILSDELCSQ 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPII Q+V  + H 
Sbjct: 187 LSGRAINIHHSFLPGFKGAKPYHQAYDRGVKVIGATAHYVTADLDEGPIIAQEVRPIDHE 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++E  + +G + EA  L++AV  H +QRV +N ++T+V 
Sbjct: 247 ISVEQMVHLGHDTEATALSQAVRLHCEQRVILNGQRTVVL 286


>gi|77165265|ref|YP_343790.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani ATCC
           19707]
 gi|254434870|ref|ZP_05048378.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani AFC27]
 gi|76883579|gb|ABA58260.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani ATCC
           19707]
 gi|207091203|gb|EDZ68474.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani AFC27]
          Length = 283

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 180/283 (63%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-----ISFVFNTC 56
           S + L I+CP    I + +  ++++ G  I + S ++D  +   FMR      S  F   
Sbjct: 3   SEFRLIISCPDRVGIVAEVSSFIASYGGWINEASHYSDPVSGWFFMRHCIRSSSLPFG-- 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +K F   F PI +++ +++S+ ++    + +++ S+  HCL DLL+RW+   L  +I  V
Sbjct: 61  IKAFKDKFSPIAEKYKMKWSLFDSSMKKRIVLMASRESHCLVDLLHRWHSKELYCDIRCV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   K+LV+ Y  P++++P + ++K  + +++I ++E N  +L++LARYMQIL   +
Sbjct: 121 ISNHEHLKRLVDAYGAPYHFVPTSRKSKENAFERIIQLVEDNQADLIVLARYMQILPGDI 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C     RIINIHHSFLPSF GA PY QA E GVK+IGAT HY    LDAGPII+QDV+R+
Sbjct: 181 CDTYQNRIINIHHSFLPSFVGAKPYHQASERGVKLIGATCHYVTEALDAGPIIDQDVMRI 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  T+ED I +G+++E  VL + V +H++ RV ++  KTIVF
Sbjct: 241 THHNTVEDMIRLGRDVEKLVLARGVRSHLEDRVLVHGNKTIVF 283


>gi|170724037|ref|YP_001751725.1| formyltetrahydrofolate deformylase [Pseudomonas putida W619]
 gi|169762040|gb|ACA75356.1| formyl transferase domain protein [Pseudomonas putida W619]
          Length = 285

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 168/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEVG 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A        F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VV
Sbjct: 66  --FRAGLAERGDAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   +++P+Y+  +   +K   E+K++ +IE+   EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAHWHKIPYYHFALDPNDKAGQERKVLGVIEETGAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|254481371|ref|ZP_05094616.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
 gi|214038534|gb|EEB79196.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
          Length = 290

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 182/282 (64%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
           SS+ L I+CP    I + I  +++ +G ++++ +Q  D++    ++R + +    + +  
Sbjct: 8   SSFTLIISCPDEVGIVAAICQFIAQRGGSLIESNQHTDVEQGWFYLR-NVIDGQSLSIDE 66

Query: 60  --FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F  +F P+  +FS+++ +R+     +  I+ S   HCL DLL+RW    L   I  V+
Sbjct: 67  NRFREEFAPLADKFSMEWYLRDNSVPQRVAIMASHSSHCLADLLHRWKSNELNCTIPCVI 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+ +++K E+ +K  NIIE++  E ++LARYMQI+   +C
Sbjct: 127 SNHENLRSMVEWHGIPFHHVPVPKEDKSEAFEKTANIIERHQAETIVLARYMQIIPPAIC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
              +GR+INIHHSFLPSF GANPY++AY+ GVK+IGAT HY   +LD GPIIEQDV+RV+
Sbjct: 187 SSYSGRLINIHHSFLPSFIGANPYQKAYDRGVKLIGATCHYVTEDLDEGPIIEQDVIRVS 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   +D + +G+++E   L++ +  H++ RV +   KT+VF
Sbjct: 247 HSCDKDDMVRLGRDVERSALSRGLRYHLEDRVIVRGNKTVVF 288


>gi|28867686|ref|NP_790305.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28850921|gb|AAO54000.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|331015000|gb|EGH95056.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 285

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 170/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F        + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFREGLTERGETFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAYE GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYEKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|171056865|ref|YP_001789214.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170774310|gb|ACB32449.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 287

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLF 60
           Y L+++CP    I + + ++L+     I + S   + ++   FMR   + ++    +  F
Sbjct: 8   YTLSLSCPDRVGIVAAVSNFLAQNNGWITEASHHAETESQTFFMRQEILADSLQLSIDEF 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             +F  +   F + + I ++    + +ILVS+ +HCL DLL RW  G L ++I  V+SNH
Sbjct: 68  RTEFAKVAAPFEMNWRISDSARKKRVVILVSKQEHCLYDLLGRWQSGELDVDIPCVISNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T + LVE + +PF+++P+T   K+E+  ++  +  +N  ++M+LARYMQIL+  LC K 
Sbjct: 128 ETFRGLVEWHGIPFHHVPVTPATKVEAYAEVERLYRENEGDVMVLARYMQILAPDLCEKF 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+IINIHHSFLPSF GA PY QA++ GVK+IGAT H+   ELD GPIIEQDV+R+ H+ 
Sbjct: 188 PGQIINIHHSFLPSFVGAKPYHQAFKRGVKLIGATCHFVTSELDEGPIIEQDVIRIDHSD 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             E+ +  GK++E  VL + +  H++ RV I+  KT+VF
Sbjct: 248 VPEELVRSGKDVEKAVLARGLRYHLEDRVLIHGNKTVVF 286


>gi|161501967|ref|YP_261867.2| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 282

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I+CP    I + + ++L++    I + S  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADSLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T E  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMDWRITDTAEKKRVVLMASRESHCLADLLHRWHSDELDCQIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHDAEVVVLARYMQILPPELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 SEYAHKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|254421439|ref|ZP_05035157.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7335]
 gi|196188928|gb|EDX83892.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7335]
          Length = 286

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 171/279 (61%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLF 60
           YILT++CP    I + +   +S     I      +D    + F R   + ++    ++  
Sbjct: 7   YILTLSCPDRVGIVAAVSTLISNNNGWINQAHHHSDQLEQRFFTRQEILADSLSFPIEEL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F+PI  QF + + IR++   T+ ++LVS+  HCL DLL RW    L + I  V+SNH
Sbjct: 67  RSRFEPIAAQFKMDWKIRDSTRKTRVVVLVSKSGHCLYDLLSRWKSQELEIEIACVISNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LVE + +P+YY+P+T Q K  +  ++++  E  + ++M+LARYMQIL   +C + 
Sbjct: 127 EVFRGLVEWHGIPYYYVPVTPQKKTAAYSQMMSYFEAVDGDVMVLARYMQILPPEMCDRY 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPII+QDV+R+ H+ 
Sbjct: 187 SGKIINIHHSFLPSFVGAKPYHQAYARGVKLIGATCHYVTEDLDCGPIIDQDVLRIDHSD 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              D +  GK+IE  VL + +  HI+ RV ++K KTIVF
Sbjct: 247 APRDLVRYGKDIEKTVLARGLRYHIEDRVMLHKNKTIVF 285


>gi|330811419|ref|YP_004355881.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379527|gb|AEA70877.1| Putative formyltetrahydrofolate deformylase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 282

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 110/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNQSGWFFMRHEIRADSLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  EAFREAFAPIAEEFSMDWRITDTAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKQPAFAEVSRLVKQHDAEVVVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHKVINIHHSFLPSFVGAKPYHQASMRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|68346410|gb|AAY94016.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 294

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I+CP    I + + ++L++    I + S  +D  +   FMR     ++    +
Sbjct: 13  MRTFRLVISCPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADSLPFGL 72

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T E  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 73  EAFREAFAPIAEEFSMDWRITDTAEKKRVVLMASRESHCLADLLHRWHSDELDCQIACVI 132

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 133 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHDAEVVVLARYMQILPPELC 192

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 193 SEYAHKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 252

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 253 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 294


>gi|295699489|ref|YP_003607382.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
 gi|295438702|gb|ADG17871.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
          Length = 291

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 175/280 (62%), Gaps = 5/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLFIA- 62
           +LT+ CPS     + +  +L    C + +++ F+D  + + F+R  F   +    L IA 
Sbjct: 11  VLTVACPSAAGQVAAVAGFLERHRCYVDELTVFDDELSERFFVRCVFHHVDRDDALQIAT 70

Query: 63  ---DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F PI ++F + ++I +     K +I+VS+ +HCL DLL+RW +G L ++IVG+ SN
Sbjct: 71  LKQEFAPIAERFRMTWAIHDLSIRPKVMIMVSKLEHCLADLLFRWRMGELKMDIVGIGSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   + LPF++LP+T   K + E +L+++ + +  EL+ILARYMQILS      
Sbjct: 131 HRDLEPLARQHGLPFHHLPITADTKPQQEAQLLDLFDSSGAELLILARYMQILSAETSRA 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V  V H+
Sbjct: 191 LAGRAINIHHSFLPGFKGAKPYHQAHARGVKVIGATAHFVTDDLDEGPIIEQGVEPVDHS 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E  +  G+++E   L +AV A +++RVFIN  +T+V 
Sbjct: 251 YSPERLLTTGRDVECITLARAVKAFVERRVFINGERTVVL 290


>gi|71735146|ref|YP_276855.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483024|ref|ZP_05637065.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|71555699|gb|AAZ34910.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320326399|gb|EFW82452.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320330612|gb|EFW86590.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330874180|gb|EGH08329.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330891312|gb|EGH23973.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330985880|gb|EGH83983.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011739|gb|EGH91795.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 285

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 170/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPQAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFRAGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|330957056|gb|EGH57316.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 285

 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFKAGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE +  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLARWHGIPYYHFPLDPNDKPAQEAKVWQVIEDSGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|15599510|ref|NP_253004.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|107100103|ref|ZP_01364021.1| hypothetical protein PaerPA_01001124 [Pseudomonas aeruginosa PACS2]
 gi|116052348|ref|YP_792659.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218893404|ref|YP_002442273.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
 gi|254239018|ref|ZP_04932341.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|254244876|ref|ZP_04938198.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|296391017|ref|ZP_06880492.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAb1]
 gi|9950538|gb|AAG07702.1|AE004848_1 formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|115587569|gb|ABJ13584.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126170949|gb|EAZ56460.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|126198254|gb|EAZ62317.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|218773632|emb|CAW29446.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
          Length = 283

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     ++    +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|325518065|gb|EGC97865.1| formyltetrahydrofolate deformylase [Burkholderia sp. TJI49]
          Length = 294

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 175/286 (61%), Gaps = 12/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI    +     +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRHEFAPIAASLAGPGGDIQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFFETSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV HA   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 248 ERVDHALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 293


>gi|307719336|ref|YP_003874868.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6192]
 gi|306533061|gb|ADN02595.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6192]
          Length = 307

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 178/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL  +CP  + I + +  ++ T G NIL   Q ND +T+  FMR+ +    F    + 
Sbjct: 27  SAILLFSCPDTKGIVAEVSHFIFTYGGNILQSHQHNDPETNTFFMRVEWDISDFALPREK 86

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI  ++ + + I  +   T+  I VS+ DHCL D+L R   G +  +IV ++SN
Sbjct: 87  ITQAFEPIAIKYRMDWRIEFSDRRTRMAIFVSKQDHCLYDVLLRHKEGEIDADIVMILSN 146

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + + E + +PFYY P+  + K E E+K I +++++ V+L++LARYMQILS    ++
Sbjct: 147 HETTRPIAEYFGVPFYYFPVNRETKEEVEEKEIALLKEHGVDLVVLARYMQILSPRFVNE 206

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY QAYE GVKIIGAT+HY   +LD GPIIEQDVVRV+H 
Sbjct: 207 FRNRIINIHHSFLPAFAGARPYHQAYERGVKIIGATSHYVTEDLDEGPIIEQDVVRVSHR 266

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ D +  GK++E  VL++A+  HI  R+ + + +T++F
Sbjct: 267 DTVRDLMQKGKDVEKLVLSRALKLHIDHRILVFRNRTVIF 306


>gi|49083322|gb|AAT51001.1| PA4314 [synthetic construct]
          Length = 284

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     ++    +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPI+EQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIVEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|313106838|ref|ZP_07793047.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
 gi|310879549|gb|EFQ38143.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
          Length = 283

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     ++    +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVSEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|194337220|ref|YP_002019014.1| formyltetrahydrofolate deformylase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309697|gb|ACF44397.1| formyltetrahydrofolate deformylase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 288

 Score =  238 bits (608), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 180/278 (64%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           IL ++C     + S I  ++  +G NILD+ +  D      F+R+S+    F+      +
Sbjct: 10  ILLLSCADRPGLVSRISHFIYERGGNILDLDEHVDPVEKTFFIRVSWSTENFSIPPSELV 69

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+ ++F+  + IR T   T+  I VS+ DHCL ++L+R +IG  A++I  ++SNH 
Sbjct: 70  EAFMPLAKEFNAIWKIRFTGRKTRIAIFVSRYDHCLQEILWRNSIGEFAIDIALIISNHP 129

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               L E++ +P++  P++  +K E E +   ++EK++++ ++LARYMQILS     +  
Sbjct: 130 DLAPLAEHHGIPYHCFPVSSASKQEIELQERELLEKHSIDTIVLARYMQILSSQFVDRYP 189

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLP+F G++PY+QAYE GVKIIGAT+HY   ELD GPIIEQD+VRV+H  T
Sbjct: 190 GQIINIHHSFLPAFVGSSPYRQAYERGVKIIGATSHYVTEELDQGPIIEQDIVRVSHKDT 249

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++D +  G+++E  VL +A+  H + R+ +N +KT+VF
Sbjct: 250 LDDLVRKGRDLERLVLAQALRLHSEHRILVNGKKTVVF 287


>gi|226314544|ref|YP_002774440.1| formyltetrahydrofolate deformylase [Brevibacillus brevis NBRC
           100599]
 gi|226097494|dbj|BAH45936.1| formyltetrahydrofolate deformylase [Brevibacillus brevis NBRC
           100599]
          Length = 298

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 173/280 (61%), Gaps = 8/280 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF----VFNTCMKLF 60
           + I+CP    I + + ++L  QG NI+   Q+  D +T + FMRI F    +   C ++ 
Sbjct: 22  MLISCPDRAGIVAAVSNFLFQQGANIVQSDQYTTDPETGRFFMRIEFDLINLDERCEEIK 81

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F P+ + F +++S+    +  K  + VS+ DHCL +LL+RW  G L  +I  VVSNH
Sbjct: 82  QA-FSPVAESFGMEWSLVEANKRKKVALFVSKEDHCLLELLWRWKSGELFADIAVVVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VE++ +P+  +P+T+ NK   + +   I     V+L++LARYMQILS       
Sbjct: 141 PDMQETVESFGIPYRCIPVTKDNK--PQAEEEQIAAAEGVDLIVLARYMQILSPRFLEDY 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GA PY+QAY  GVK+IGATAHY   ELDAGPIIEQDV RV+H +
Sbjct: 199 AMRIINIHHSFLPAFVGAKPYEQAYRRGVKLIGATAHYVTEELDAGPIIEQDVQRVSHQE 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +E    +G+ +E  VL +AV  H++ RV +   KTIVFP
Sbjct: 259 DVETLKQLGRQVERTVLARAVRWHLEDRVLVYGNKTIVFP 298


>gi|145219330|ref|YP_001130039.1| formyltetrahydrofolate deformylase [Prosthecochloris vibrioformis
           DSM 265]
 gi|145205494|gb|ABP36537.1| formyltetrahydrofolate deformylase [Chlorobium phaeovibrioides DSM
           265]
          Length = 292

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 177/278 (63%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           +L ++CP    + S +  ++  +G NI+D+ +  D    + F+RI +    F+   +   
Sbjct: 14  VLLLSCPDRRGLVSRLSLFIFERGGNIIDLDEHVDPVEGRFFIRILWSLEEFSIPEEELE 73

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F+P+ ++    +++R T   ++  + VS+ DHCL +LL+R  IG   + I  +VSNH 
Sbjct: 74  EEFRPLAEELGAAWALRFTGRKSRVAVFVSRYDHCLQELLWRHGIGEFQIEIPLIVSNHP 133

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L ++  +PF+ +P++ +N++  E++   ++E ++V+ ++LARYMQ+LS     +  
Sbjct: 134 DLQPLADHCGIPFHVIPVSSENRMAVEKQTTALLEAHDVDWVVLARYMQVLSPAFVERWR 193

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLP+F G NPY+QAYE GVKIIGAT+H+   ELD GPIIEQD VRVTH  +
Sbjct: 194 GRVINIHHSFLPAFVGGNPYRQAYERGVKIIGATSHFITEELDQGPIIEQDTVRVTHRDS 253

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + D I  G+++E  VL +AV  H + R+ +N  KT+VF
Sbjct: 254 LADLIRRGRDLERLVLARAVRLHSEHRILLNGTKTVVF 291


>gi|167584658|ref|ZP_02377046.1| formyltetrahydrofolate deformylase [Burkholderia ubonensis Bu]
          Length = 291

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 117/281 (41%), Positives = 174/281 (61%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-VFNTCMKL--F 60
           ++LT++C S     + +  +L    C +  ++ F+D  +++ F+R  F   N  +++   
Sbjct: 10  FVLTLSCASAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRCVFHPTNETLQIDAL 69

Query: 61  IADFQPIVQQFS--LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +F PI       LQ++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+VS
Sbjct: 70  RHEFAPIAADLGSDLQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS     
Sbjct: 130 NHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFFETSGAELVILARYMQVLSQETSA 189

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 190 KLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 249

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 250 ALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|326332984|ref|ZP_08199241.1| formyltetrahydrofolate deformylase [Nocardioidaceae bacterium
           Broad-1]
 gi|325949342|gb|EGD41425.1| formyltetrahydrofolate deformylase [Nocardioidaceae bacterium
           Broad-1]
          Length = 300

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 110/277 (39%), Positives = 173/277 (62%), Gaps = 3/277 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FIA 62
           +LT++C     I   +  +L  +G +IL+  Q +D      F+R +F       +    A
Sbjct: 24  VLTLSCQERPGIMHAVTSFLYDRGFDILEHQQHDDRMGELFFLRTAFASADGADVDELTA 83

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F PI  +F + ++  + ++  + L++VS+  HCLNDL++RW  GTL   I  V SNH  
Sbjct: 84  AFGPIADRFGMSFTFHDERK-PRLLVMVSKFGHCLNDLIFRWRGGTLGGEIAVVASNHED 142

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + + E   L F ++P+T + K ++EQ++++++++  ++L++LARYMQILSD LC ++ G
Sbjct: 143 LRPMAEAAGLDFVHIPITAETKPQAEQRMLDLVDEYEIDLVVLARYMQILSDGLCRQLEG 202

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA++ GVK++GATAHY   +LD GPIIEQ+V RV H  T 
Sbjct: 203 RAINIHHSFLPGFKGAKPYHQAHDRGVKLVGATAHYVTADLDEGPIIEQEVNRVDHTYTP 262

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    +G++ E   L++AV  H + RV ++   T+VF
Sbjct: 263 QALANVGQDAECLALSRAVRWHCEHRVLMHGSSTVVF 299


>gi|315186734|gb|EFU20492.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6578]
          Length = 307

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 120/280 (42%), Positives = 178/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL  +CP  + I + +  ++ T G NIL   Q ND +T+  FMR+ +    F    + 
Sbjct: 27  SAILLFSCPDTKGIVAEVSHFIFTYGGNILQSHQHNDPETNTFFMRVEWDISDFALPREK 86

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI  ++ + + I  + + T+  I VS+ DHCL D+L R   G +  +IV ++SN
Sbjct: 87  IPQAFEPIAIKYRMDWRIEFSDKRTRMAIFVSKQDHCLYDVLLRHKEGEIDADIVMILSN 146

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + + E + +PFYY P+  + K E E+K I +++++ V+L++LARYMQILS     +
Sbjct: 147 HETTRPIAEYFGVPFYYFPVNRETKEEMEEKEIALLKEHGVDLVVLARYMQILSPRFVGE 206

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY QAYE GVKIIGAT+HY   +LD GPIIEQDVVRV+H 
Sbjct: 207 FRNRIINIHHSFLPAFAGAKPYHQAYERGVKIIGATSHYVTEDLDEGPIIEQDVVRVSHR 266

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ D +  GK++E  VL++A+  HI  R+ + + +T++F
Sbjct: 267 DTVRDLMQKGKDVEKLVLSRALKLHIDHRILVFRNRTVIF 306


>gi|224826874|ref|ZP_03699973.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
 gi|224600861|gb|EEG07045.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
          Length = 287

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 171/282 (60%), Gaps = 9/282 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNTCM 57
           YIL  TC S     +     L    C I +++ F+D DT + F+R +F           +
Sbjct: 8   YILAFTCKSAPGQIARATQLLDAHHCYIDELAVFDDEDTQRFFVRCTFHSLGDGFDRAAL 67

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +  +AD   +   + +Q+++ +T    + LI+VS+ DHCLNDLLYR  +G L + +  +V
Sbjct: 68  EAGLAD---MAGHYDMQWTLHDTHTRPRVLIMVSKLDHCLNDLLYRCKMGDLDMEVTAIV 124

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     +   + L +++LP+T   K + E  L+ ++ K   EL+ILARYMQ+LS  + 
Sbjct: 125 SNHADLAPIAAAHGLTYHHLPVTHDTKPQQEAALLELVRKTQSELVILARYMQVLSPEMS 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ V RV 
Sbjct: 185 KKLSGRAINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYITDDLDEGPIIEQVVERVD 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA   E  +A G+++E   L +AV  H+++RVF+N  +T+V 
Sbjct: 245 HAYRPEQLLAAGRDMECLALARAVRFHLERRVFLNGNRTVVL 286


>gi|34497381|ref|NP_901596.1| formyltetrahydrofolate deformylase [Chromobacterium violaceum ATCC
           12472]
 gi|34103237|gb|AAQ59600.1| formyltetrahydrofolate deformylase [Chromobacterium violaceum ATCC
           12472]
          Length = 289

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 170/280 (60%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           S  L I+ P  + + + I ++L T   NI+   Q  D   +   MR+ +    F   M  
Sbjct: 9   SATLLISAPDKKGLVAAIANFLMTYNANIMHADQHQDTSENLFLMRVQWDLDGFTLPMDS 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A FQPI  +  + + +  +    +  I VSQ +HCL DL++RW IG L  +I  V+SN
Sbjct: 69  FAAAFQPIADEHGMNWKVSLSARKPRMAIFVSQYEHCLVDLMHRWRIGELDCDIPLVISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T ++LVE   +PF+ + +T+ NK E+E +   ++E+  V+ ++LARYMQILS     +
Sbjct: 129 HETCRRLVEFNGIPFHVIKVTKDNKAEAEAEQFRLLEEAGVDFIVLARYMQILSGEFVER 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY   +LD GPIIEQ+V R++H 
Sbjct: 189 YPDRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEDLDEGPIIEQEVTRISHR 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ED +  G+++E  VL++AV  H+  RV     KT+VF
Sbjct: 249 DTVEDLVEKGRDLEKVVLSRAVRWHLDNRVLSYSNKTVVF 288


>gi|289624813|ref|ZP_06457767.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650610|ref|ZP_06481953.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330871156|gb|EGH05865.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 285

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPQAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F        + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFRVGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|152988898|ref|YP_001350218.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
 gi|150964056|gb|ABR86081.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
          Length = 283

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/282 (39%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     ++    +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMVWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|288916732|ref|ZP_06411106.1| formyltetrahydrofolate deformylase [Frankia sp. EUN1f]
 gi|288351806|gb|EFC86009.1| formyltetrahydrofolate deformylase [Frankia sp. EUN1f]
          Length = 290

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 166/279 (59%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI--- 61
           +L ++CP    I   + + L  + C I+   QF    T   ++R+ F      +L +   
Sbjct: 11  VLLLSCPDTPGIVHAVAELLLQEKCTIVASHQFGSAATRTFYLRVEFAHIDGSRLDLDEL 70

Query: 62  -ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A   P+  +F + + + +T   T+T+I+ S+  HCLNDLL+R +IG L L++V VVSNH
Sbjct: 71  RARIAPLGARFGMTWRLADTAHRTRTVIMASRFAHCLNDLLFRTSIGELNLDVVAVVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                +  ++  PF +LP+T   + E+E  L++++    V+L++LARYMQILS  LC  +
Sbjct: 131 PDLGGIARHFDAPFRHLPVTPATRNEAEADLLDLVHAEQVDLVVLARYMQILSPRLCEHL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHS LPSFKGA PY QAY  GVK IGATAHY   +LD GPIIEQ+++RV H  
Sbjct: 191 AGRAINIHHSMLPSFKGAKPYHQAYARGVKFIGATAHYVTEDLDEGPIIEQELIRVDHTL 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +   A G+  E + L +AV  H + R+ ++  KT++ 
Sbjct: 251 DPDQLAARGREAETRALARAVRWHTENRIILSDGKTVIL 289


>gi|298489216|ref|ZP_07007235.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156298|gb|EFH97399.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 285

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++IL   CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILIADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPQAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFRAGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + +P+Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIPYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|330965470|gb|EGH65730.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 285

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 170/282 (60%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFKAGLSERGEAFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + + +Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGITYYHFPLNPADKPAQEAKVWQVIEESGAELVILARYMQVLSPELC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY+ GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYDKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|288553823|ref|YP_003425758.1| formyltetrahydrofolate deformylase [Bacillus pseudofirmus OF4]
 gi|288544983|gb|ADC48866.1| formyltetrahydrofolate deformylase [Bacillus pseudofirmus OF4]
          Length = 287

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 172/278 (61%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI--- 61
           L I+C     I S +  +L     NI+   QF+ D +    FMRI F        F+   
Sbjct: 10  LLISCQDKPGIVSAVSTFLHQYDANIVQSDQFSTDPEGGMFFMRIEFDLGNSSPDFLRFK 69

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F  +  +   ++ +       +  ILVS+ DHCL +LL+RW  G L ++I  ++SNH 
Sbjct: 70  KEFHTLADKLDFEWKMELAARKKRMAILVSKEDHCLLELLWRWRSGELQVDIPLIISNHP 129

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T+K++VE+Y +PFY++P+T   K E+EQ++IN++++++V+ ++LARYMQILS        
Sbjct: 130 TNKQVVESYGIPFYHVPVTRDTKEEAEQEVINLLKQHDVDFIVLARYMQILSPTFVESFP 189

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GANPY +A+E GVK+IGATAHY   +LD GPIIEQDV+RV H  +
Sbjct: 190 YRIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHYVTDDLDEGPIIEQDVLRVNHRYS 249

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++    G+N+E   L +AV  H   +V +   KT+VF
Sbjct: 250 TQELRVAGRNVERIALARAVEWHTNDQVIVYGNKTVVF 287


>gi|254000302|ref|YP_003052365.1| formyltetrahydrofolate deformylase [Methylovorus sp. SIP3-4]
 gi|253986981|gb|ACT51838.1| formyltetrahydrofolate deformylase [Methylovorus sp. SIP3-4]
          Length = 285

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/277 (41%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLFIA 62
           L +TCP  + I + I D+L     NIL   Q  D +     MR+ +  +        F  
Sbjct: 8   LLVTCPDQKGIVAGIADFLYRHNANILHADQHQDAENGLFLMRVEWDLSDSAINADNFSE 67

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F PI ++FS+ + ++  ++ T+  I+VSQ DHCL DLL+R   G LA  I  +VSNH  
Sbjct: 68  HFTPIAERFSMTWQLKLGQKRTRMAIMVSQYDHCLVDLLHRHQSGELACEIPLIVSNHRH 127

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            ++L E + +PF+Y+ +   NK E+E K   + ++  V+L++LARYMQILS     +   
Sbjct: 128 TERLAEYHGIPFHYVEVNRDNKAEAEAKQFALFDQYGVDLIVLARYMQILSPAFVQRYPQ 187

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H   +
Sbjct: 188 RIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDIARISHRDQV 247

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL++AV  HI+ R+ +   KT++F
Sbjct: 248 EDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIF 284


>gi|221209391|ref|ZP_03582372.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|221170079|gb|EEE02545.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
          Length = 291

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/283 (41%), Positives = 173/283 (61%), Gaps = 9/283 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++C S     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCASAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS--LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F PI       LQ++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+
Sbjct: 68  ALRQEFAPIAAGLGSELQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGI 127

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + L   + LPF + P+T   K + E + ++  E +  EL++LARYMQ+LS   
Sbjct: 128 VSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFFETSGAELVVLARYMQVLSQET 187

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV
Sbjct: 188 SAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERV 247

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 248 DHALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 290


>gi|197122272|ref|YP_002134223.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. K]
 gi|220917055|ref|YP_002492359.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196172121|gb|ACG73094.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. K]
 gi|219954909|gb|ACL65293.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 286

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 175/281 (62%), Gaps = 8/281 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKL-FMRISFVFNTCMKLFIAD 63
           IL + CP    I + I  +L   G NILD  Q   +D     F R+ F  +  + L + D
Sbjct: 7   ILLVQCPDRPGIVAAISSFLYRHGANILDFDQHTSVDNGGAYFTRLEFQTDR-LDLPVED 65

Query: 64  FQ-----PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            +      + + F +++ +  + +  K  ILVS+ DH L +LL+ W+ G L  ++  V+S
Sbjct: 66  LERAFALDVARPFGMEWRLTLSSQRKKVAILVSKHDHALLELLWNWDRGDLHADVSTVIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +PF ++P +   + ++E +++ ++E    +L++LARYMQI+S  L  
Sbjct: 126 NHPDLRESVESFGVPFVHVPNSRDTRAQAEARMLELLE-GKADLVVLARYMQIVSPELVA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA+PY+QAY+ GVKI+GATAHY   ELDAGPII+QDV RV+H
Sbjct: 185 RWPNRIINIHHSFLPAFVGADPYRQAYDRGVKIVGATAHYVTAELDAGPIIDQDVGRVSH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++D   +G+++E +VL +AV  H + RV +N  KT+VF
Sbjct: 245 RDAVDDLKRLGRDLERRVLARAVRWHCEDRVIVNGNKTVVF 285


>gi|251795285|ref|YP_003010016.1| formyltetrahydrofolate deformylase [Paenibacillus sp. JDR-2]
 gi|247542911|gb|ACS99929.1| formyltetrahydrofolate deformylase [Paenibacillus sp. JDR-2]
          Length = 278

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 167/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMK---LFI 61
           + I+CP    I + +  +L   G NI+   Q+  D +    F+R  F  N   K   + +
Sbjct: 1   MLISCPDRPGIVAAVSHFLYEHGANIVQSDQYTMDPEGGMFFIRFEFDLNDMDKELPVLV 60

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF  +  +F +++         +  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 61  EDFARVADRFDMKWHTFRASRKKRLAIFVSKEDHCLMELLWQWKAGDLDADIAMVVSNHP 120

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K +VE++ +P++++P+T   K E+E+K + I+  +  +L++LARYMQI+S     +  
Sbjct: 121 DMKDMVESFGIPYHHIPVTADTKAEAERKQMEIV-ADKADLIVLARYMQIISPKFIEQFP 179

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 180 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDN 239

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +E+   IG+ IE  VL +AV  H + R+ +++ KT+VF
Sbjct: 240 VEELKRIGRTIERVVLARAVKWHTEDRIIVHQNKTVVF 277


>gi|312881989|ref|ZP_07741743.1| formyltetrahydrofolate deformylase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370284|gb|EFP97782.1| formyltetrahydrofolate deformylase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 290

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 170/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           ++SY+LT +CPS      ++  +L   G  I +++ F+D    + F+R  F      +  
Sbjct: 5   VASYVLTASCPSRSGTVDVVTRFLRESGGYINELNSFDDELNQRFFIRTVFRLEADSEFD 64

Query: 59  --LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             +F   F    + F +++ +       K +I+VS+ DHCLNDLLYR+  G L++ I  V
Sbjct: 65  RDVFCQQFSERSKAFEMEWELTPLDYKPKVVIMVSKYDHCLNDLLYRYRTGNLSVEICAV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNHT  + L E + +PFY+ P+T   K + E ++ +I+++   EL++LARYMQ+LS  +
Sbjct: 125 ISNHTDLQSLTEWHDIPFYHCPITPSTKAQQESQVQSILDQYQCELLVLARYMQVLSHEM 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C    G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q +  V
Sbjct: 185 CEVWAGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYVSDDLDEGPIITQGMETV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H    ED    GK+IEA+ L +AV  H ++R+F+   KTIVF
Sbjct: 245 NHTYYPEDLTRKGKDIEAQTLARAVQYHAEKRIFLFNDKTIVF 287


>gi|313202259|ref|YP_004040917.1| formyltetrahydrofolate deformylase [Methylovorus sp. MP688]
 gi|312441575|gb|ADQ85681.1| formyltetrahydrofolate deformylase [Methylovorus sp. MP688]
          Length = 311

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 116/277 (41%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLFIA 62
           L +TCP  + I + I D+L     NIL   Q  D +     MR+ +  +        F  
Sbjct: 34  LLVTCPDQKGIVAGIADFLYRHNANILHADQHQDAENGLFLMRVEWDLSDSAINADNFSE 93

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F PI ++FS+ + ++  ++ T+  I+VSQ DHCL DLL+R   G LA  I  +VSNH  
Sbjct: 94  HFTPIAERFSMTWQLKLGQKRTRMAIMVSQYDHCLVDLLHRHQSGELACEIPLIVSNHRH 153

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            ++L E + +PF+Y+ +   NK E+E K   + ++  V+L++LARYMQILS     +   
Sbjct: 154 TERLAEYHGIPFHYVEVNRDNKAEAEAKQFALFDQYGVDLIVLARYMQILSPAFVQRYPQ 213

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H   +
Sbjct: 214 RIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDIARISHRDQV 273

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL++AV  HI+ R+ +   KT++F
Sbjct: 274 EDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIF 310


>gi|189346175|ref|YP_001942704.1| formyltetrahydrofolate deformylase [Chlorobium limicola DSM 245]
 gi|189340322|gb|ACD89725.1| formyltetrahydrofolate deformylase [Chlorobium limicola DSM 245]
          Length = 287

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 173/278 (62%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           IL ++CP    + S I  ++  +G NILD+ +  D      F+R+S+    F+       
Sbjct: 9   ILLLSCPDRAGLVSRISHFIYERGGNILDLDEHVDTVEKMFFIRVSWSTDHFSIPPTELD 68

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+ ++F   + IR      +  + VS+ DHCL +LL+R +IG   ++I  +VSNH 
Sbjct: 69  EAFSPLAKEFGASWKIRLGDRKMRVALFVSRYDHCLQELLWRHSIGEFRIDIPLIVSNHP 128

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L   Y +PF+  P+T  +K E EQ+ + ++  ++++ ++LARYMQ+LS        
Sbjct: 129 DLEPLALRYGIPFHVFPVTAASKQEIEQQELGLLRDHDIDTVVLARYMQVLSPQFVESYP 188

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G++PY+QAYE GVKIIGAT+HY   +LD GPIIEQD+VR++H  T
Sbjct: 189 SRIINIHHSFLPAFVGSSPYRQAYERGVKIIGATSHYVTEDLDQGPIIEQDIVRMSHKDT 248

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++D I  G+++E  VL +A+  H + R+ +N +KT+VF
Sbjct: 249 LDDLIRKGRDLERLVLARALRLHSEHRILVNGKKTVVF 286


>gi|161520114|ref|YP_001583541.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189353707|ref|YP_001949334.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221200354|ref|ZP_03573396.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
 gi|221206033|ref|ZP_03579047.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|160344164|gb|ABX17249.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189337729|dbj|BAG46798.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221174045|gb|EEE06478.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|221179695|gb|EEE12100.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
          Length = 294

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/286 (41%), Positives = 173/286 (60%), Gaps = 12/286 (4%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++CPS     + +  +L    C +  ++ F+D  ++  F+R   VF+   +    D
Sbjct: 10  FVLTLSCPSAAGQVAAVVGFLERHRCYVDALNVFDDDLSNHFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS-----LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
                F PI    +      Q++I +     K LI+VS+ +HCL DLL+RW +G L ++I
Sbjct: 68  ALRQEFGPIAASLAGGAGDTQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDI 127

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VG+VSNH   + L   + LPF + P+T   K + E + ++  E +  EL+ILARYMQ+LS
Sbjct: 128 VGIVSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFFETSGAELVILARYMQVLS 187

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V
Sbjct: 188 QETSAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVV 247

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV HA   E  +A+G+++E   L +AV A I++RVF+N  +T+VF
Sbjct: 248 ERVDHALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVF 293


>gi|77460657|ref|YP_350164.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
 gi|77384660|gb|ABA76173.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
          Length = 282

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I+CP    I + + ++L+     I + S  +D      FMR     ++    +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLAAHNGWITEASHHSDNQVGWFFMRHEIRADSLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           ++    F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EVLREKFAPIAEEFSMDWRITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEISCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   +C
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKQPAFDEVSRLVKQHDAEVVVLARYMQILPPDMC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHKVINIHHSFLPSFVGAKPYHQASMRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|78186355|ref|YP_374398.1| formyltetrahydrofolate deformylase [Chlorobium luteolum DSM 273]
 gi|78166257|gb|ABB23355.1| formyltetrahydrofolate deformylase [Chlorobium luteolum DSM 273]
          Length = 293

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 171/278 (61%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFI 61
           IL ++C     + S I  ++  +G NI+D+ +  D      F+R+S+  +     +    
Sbjct: 15  ILLLSCRDRRGLVSRISHFIYERGGNIIDLDEHVDAGEGMFFIRVSWSTDRLTIPVSALE 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+P+  +F   ++IR T   T+  I VS+ DHCL +LL+R+++G  +  I  V+SNH 
Sbjct: 75  DAFRPLGTEFEASWNIRFTGRPTRFAIFVSRYDHCLQELLWRYSMGEFSAEIPLVISNHP 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L  +Y +PF+   +T   + + E +   +++ N+++ ++LARYMQ+LS     +  
Sbjct: 135 DLEPLAAHYGIPFHQFRVTADTRADVEAEQQALLDANDIDAIVLARYMQVLSPSFARRWH 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP+F G NPY+QAYE GVKIIGAT HY   ELD GPIIEQD++RVTH  T
Sbjct: 195 GRAINIHHSFLPAFVGGNPYRQAYERGVKIIGATCHYVTEELDQGPIIEQDIMRVTHRDT 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++  I  G+++E  VL +AV  H + R+ +N RKTIVF
Sbjct: 255 LQGLIRRGRDLERMVLARAVRLHAEHRILLNGRKTIVF 292


>gi|146281549|ref|YP_001171702.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri A1501]
 gi|145569754|gb|ABP78860.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri A1501]
          Length = 277

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 109/275 (39%), Positives = 174/275 (63%), Gaps = 3/275 (1%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFIADF 64
           I CP    I + + ++L+T    I + +  +D  +   FMR     ++    +  F   F
Sbjct: 2   IACPDGVGIVAKVSNFLATYNGWITEANHHSDHQSGWFFMRHEIRADSLPFDLDGFRQAF 61

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
            PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L  +I  V+SNH   +
Sbjct: 62  APIAREFSMEWRITDSERRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVISNHDDLR 121

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +VE + +P++++P+   NK E+  ++  ++ +   ++++LARYMQIL   LC +   R+
Sbjct: 122 SMVEWHGIPYFHVPVDPANKQEAFAEVTRLVREQRADVIVLARYMQILPAELCDEFAQRV 181

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+H  +IED
Sbjct: 182 INIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIED 241

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +GK++E  VL++ +  H++ RV ++  KT+VF
Sbjct: 242 MVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTLVF 276


>gi|146308332|ref|YP_001188797.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576533|gb|ABP86065.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 283

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+++ + ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  EGFKQAFAPIAREFSMEWRVTDSAQKKRVVLMASRESHCLADLLHRWHSNELDCDIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P++++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYFHVPVNPQDKAPAFAEVERLVKEHGADVIVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT+HY   ELDAGPIIEQDVVR+T
Sbjct: 181 SEYAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATSHYVTEELDAGPIIEQDVVRIT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   IE+ + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDDIEEMVRLGKDVEKMVLARGLRYHLEDRVLVHDNKTVVF 282


>gi|254254489|ref|ZP_04947806.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
 gi|124899134|gb|EAY70977.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
          Length = 291

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 173/284 (60%), Gaps = 9/284 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT++C S     + +  +L    C +  ++ F+D  +++ F+R   VF+   +    D
Sbjct: 10  FVLTLSCTSAAGQVAAVVGFLDRHRCYVDALNVFDDDLSNRFFVRC--VFHPTDETLQID 67

Query: 64  -----FQPIVQQFS--LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F PI        Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+
Sbjct: 68  ALRQEFAPIAAGVGSDAQWAIHDVNARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGI 127

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + L   + LPF + P+T   K + E + ++  + +  EL+ILARYMQ+LS   
Sbjct: 128 VSNHPDFEPLAAQHGLPFRHFPITPDTKAQQEAQWLDFFDTSGAELVILARYMQVLSQET 187

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV
Sbjct: 188 SAKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERV 247

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            HA   E  +A+G+++E   L +AV A I++RVF+N  +T+VFP
Sbjct: 248 DHALRPEQLLAVGRDVECITLARAVKAFIERRVFLNGDRTVVFP 291


>gi|325285270|ref|YP_004261060.1| formyltetrahydrofolate deformylase [Cellulophaga lytica DSM 7489]
 gi|324320724|gb|ADY28189.1| formyltetrahydrofolate deformylase [Cellulophaga lytica DSM 7489]
          Length = 281

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 112/274 (40%), Positives = 175/274 (63%), Gaps = 2/274 (0%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--FIADFQ 65
           I CP    I S + +++ T+G NI+ I Q+ D +++  FMR+   F+  + L  F + F+
Sbjct: 7   INCPDQAGIISTVTNFIHTKGGNIVYIDQYVDKESATFFMRLESEFSNALTLNEFKSGFK 66

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +   + +++ +       K  I VS+ DHCL DLL R++ G LA++I  ++SNH   K 
Sbjct: 67  TLAPTYQMKWEVYKEVTVPKMAIFVSKYDHCLYDLLSRYSSGELAVDIPLIISNHDKAKN 126

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           +   + +PFY++P+T+  K E+E+K + ++ + NV+ ++LARYMQI+S  +  +   +II
Sbjct: 127 IANQFNIPFYHIPVTKATKKEAEEKQLALLSEYNVDFIVLARYMQIVSQTVIDQYPNKII 186

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   +LD GPII+QDV  V+H  +I D 
Sbjct: 187 NIHHSFLPAFAGAKPYHAAYKRGVKIIGATSHYVTADLDEGPIIDQDVTTVSHTHSITDL 246

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IA G+++E  VL + V  HI+++  +   KTIVF
Sbjct: 247 IAKGRDLEKIVLARGVKLHIERKTMVFNNKTIVF 280


>gi|330944719|gb|EGH46647.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 285

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QGFRAGLSERGETFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + + +Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGIAYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|66047941|ref|YP_237782.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63258648|gb|AAY39744.1| Formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330970925|gb|EGH70991.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 285

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QAFRAGLSERGETFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + + +Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGITYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|71900541|ref|ZP_00682670.1| Formyl transferase, N-terminal [Xylella fastidiosa Ann-1]
 gi|71729717|gb|EAO31819.1| Formyl transferase, N-terminal [Xylella fastidiosa Ann-1]
          Length = 241

 Score =  236 bits (601), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 111/242 (45%), Positives = 160/242 (66%), Gaps = 6/242 (2%)

Query: 42  TSKLFMRISFVFNTCMKLFIADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCL 97
           + + F+R+ F       L  A+ Q     + + +++Q+ + + +  ++ L++VS+  HCL
Sbjct: 1   SHQFFLRVHFDLADSSSL--AELQNQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCL 58

Query: 98  NDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK 157
           NDLL+R +   L   IV VVSNH     L  +Y +PF +LP+  +N+ E E +++ I+E+
Sbjct: 59  NDLLFRIHSRQLQAKIVTVVSNHNEFAPLTASYGVPFQHLPVNGENRTEQEARILQIVER 118

Query: 158 NNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAH 217
             ++L+ILARYMQILS  LC  + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAH
Sbjct: 119 EQIDLVILARYMQILSPALCEALLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAH 178

Query: 218 YAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTI 277
           Y   +LD GPIIEQDV RV H+ T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+
Sbjct: 179 YVTHDLDEGPIIEQDVARVDHSMTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTV 238

Query: 278 VF 279
           VF
Sbjct: 239 VF 240


>gi|186470705|ref|YP_001862023.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
 gi|184197014|gb|ACC74977.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
          Length = 296

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 168/279 (60%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLF 60
           + LT++CP    I S +  +L+     I++ +   D    + FMR   V  +    +  F
Sbjct: 17  FTLTLSCPDRIGIVSAVSTFLAEHRGWIIEATHHADEVEKRFFMRHEIVAESLPFGIGGF 76

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I ++F++ + I +     + +ILVS+ +HCL DLL RW  G L + I  V+SNH
Sbjct: 77  RERFAHIAKEFAMDWKISDNSVKKRVVILVSKLEHCLYDLLARWKAGELDIEIPCVISNH 136

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T +  VE + +PF+ +P+T  NK ++  ++  + E  + + M+LARYMQ+LS  LC   
Sbjct: 137 ETWRSFVEWHGIPFHCVPVTPDNKAQAYDEVQRLFEDAHADTMVLARYMQVLSPKLCADY 196

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSF GA PY QAY  GVK+ GAT HY   ELD GPIIEQDV+RV+H+ 
Sbjct: 197 PGRIINIHHSFLPSFVGAKPYHQAYSRGVKLTGATCHYVTEELDQGPIIEQDVIRVSHSD 256

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +D + +G++IE  VL + +  HI+ RV I+  KTIV 
Sbjct: 257 RPDDLVRLGRDIEKTVLARGLRYHIEDRVLIHGNKTIVL 295


>gi|73662260|ref|YP_301041.1| formyltetrahydrofolate hydrolase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494775|dbj|BAE18096.1| putative formyltetrahydrofolate hydrolase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 283

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 119/284 (41%), Positives = 180/284 (63%), Gaps = 10/284 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-----NDLDTSKLFMRISFVFNTC 56
           ++YIL   C  +  +TS+I   ++  G NIL +  F     N  +  KLF+R+ F   T 
Sbjct: 3   NTYILLARCTDSVGLTSLITTIIADHGSNILHLDHFTEYESNQSENGKLFLRLEFEQVTE 62

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +K      +  + Q+ +++ + +  + TK  + VS+ DH  N++L R   G L   IV V
Sbjct: 63  LK---EALESTLNQYDIKFELFDNNDKTKIALFVSKEDHAFNEVLLRVQRGELPAEIVCV 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH T++   E+  +PFYY+P  ++ K E EQ+++NI   + ++L++LA+YMQIL+DH 
Sbjct: 120 VSNHETNRHFAESLSIPFYYVPNNKE-KQEVEQEILNICSHHEIDLIVLAKYMQILTDHF 178

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 +IINIHHSFLPSF GANPYKQA+E GVK++GAT+HY   +LD GPIIEQDV R+
Sbjct: 179 VSHYPNQIINIHHSFLPSFIGANPYKQAWERGVKLVGATSHYVTSDLDEGPIIEQDVTRI 238

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINK-RKTIVF 279
            H  +++D   IG+++E+ VL +AV  H+Q ++ +N   KTIVF
Sbjct: 239 NHRYSVQDLRKIGRHVESTVLAQAVEYHVQHKIIVNDGNKTIVF 282


>gi|226945872|ref|YP_002800945.1| formyltetrahydrofolate deformylase [Azotobacter vinelandii DJ]
 gi|226720799|gb|ACO79970.1| formyltetrahydrofolate deformylase [Azotobacter vinelandii DJ]
          Length = 283

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L+T    I + S  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+++ + ++ E  + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  EEFRRAFAPIAREFSMKWRVSDSSELKRVVLMASRESHCLADLLHRWHSGELPCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+ ++P+  Q+K  +  ++  +I ++  + ++LARYMQIL   LC
Sbjct: 121 SNHDELRSMVEWHGIPYCHVPVDPQDKEPAFAEVSRLIREHAADTVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVR++
Sbjct: 181 REFAMQVINIHHSFLPSFVGARPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRIS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  ++ED + +GK++E  VL++ +  H++ RV ++  +T+VF
Sbjct: 241 HRDSVEDMVRLGKDVEKMVLSRGLRYHLEDRVLVHDNRTVVF 282


>gi|74317995|ref|YP_315735.1| formyltetrahydrofolate deformylase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057490|gb|AAZ97930.1| formyltetrahydrofolate deformylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 284

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 167/278 (60%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFI 61
           +L I+CP    + + I D+L     NIL   Q  D +     MR+ +    FN  ++ F 
Sbjct: 6   VLLISCPDQRGLVAAIADFLLAHRANILHADQHQDAELKLFLMRVEWDLAGFNLDLRDFA 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             FQPI ++F + + +  +    +  + VS+ DHCL DLLYR+  G L   +  ++SNH 
Sbjct: 66  TAFQPIAERFGMTWRLAESSRKPRMAVFVSKFDHCLADLLYRYQSGELHCELPIILSNHE 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L + Y++P+ ++ +T+++K E+EQ  + I+    ++ ++LARYMQ+LS        
Sbjct: 126 DTRWLADAYRVPYQHMAVTKESKHETEQIQLAILRDQKIDFIVLARYMQVLSGDFIRHFP 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GA PY +A+E GVK+IGATAHY    LD GPIIEQDV R++H   
Sbjct: 186 NRIINIHHSFLPAFHGAKPYHRAFERGVKLIGATAHYVTETLDDGPIIEQDVARISHRDH 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           I+D I  G ++E  VL++AV  H+  RV +   KT+VF
Sbjct: 246 IDDLIHKGADLEKVVLSRAVKWHLDNRVLVYANKTVVF 283


>gi|332977531|gb|EGK14302.1| formyltetrahydrofolate deformylase [Psychrobacter sp. 1501(2011)]
          Length = 294

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 118/279 (42%), Positives = 180/279 (64%), Gaps = 7/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL-DTSKLFMRISFVFNTCMKL---FI 61
           L I C     I   + +++   G NI+ + Q++   +  + FMR+ F      ++   F 
Sbjct: 17  LLIKCKDQAGIVQAVSEFIHRYGANIITLDQYSTAHEGGQYFMRLEFALAGLSEIIENFE 76

Query: 62  ADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F   + +++ +++ + +    TK  ILVS+ DH L DLL+R   G L  +I  VVSNH
Sbjct: 77  ASFSHTVAKRYEMEWRLHDNAIKTKVGILVSKFDHALLDLLWRHQRGLLDCDITCVVSNH 136

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VEN+ +PF+++ +T++NK E+E+++  I+E N  +L++LARYMQILS    ++ 
Sbjct: 137 NDLRQAVENFGIPFHHVKVTKENKAEAEEQIHQIMEGN--DLLVLARYMQILSSDFVNRW 194

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA+PY+QA++ GVK+IGATAHY   +LD GPIIEQDV RVTH Q
Sbjct: 195 PMKIINIHHSFLPAFVGADPYRQAFDKGVKLIGATAHYVTADLDQGPIIEQDVHRVTHRQ 254

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +  AIG+++E  VL +AVN H+Q RV +   KT+VF
Sbjct: 255 GVTELRAIGRDVERNVLARAVNWHVQNRVIVAGNKTVVF 293


>gi|91776784|ref|YP_546540.1| formyltetrahydrofolate deformylase [Methylobacillus flagellatus KT]
 gi|91710771|gb|ABE50699.1| formyltetrahydrofolate deformylase [Methylobacillus flagellatus KT]
          Length = 296

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 168/277 (60%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFIA 62
           L +TCP  + I + I D+L     NIL   Q  D + +   MR+ F        +  F  
Sbjct: 19  LLVTCPDRKGIVASIADFLYRHDANILHADQHQDAENNLFLMRVEFDLEGAKVTLDNFPG 78

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  I  QFS+ + ++ ++   +  I+VSQ DHCL DLL+R   G L  +I  ++SNH  
Sbjct: 79  HFSSIADQFSMNWELKGSQRRARMAIMVSQYDHCLVDLLHRHQSGELDCDIPLIISNHRD 138

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L   Y +PF+++ ++  NK E+E +   + +++ V+L++LARYMQILS     +   
Sbjct: 139 TEHLARFYGIPFFHIEVSRDNKAEAEARQFALFDEHQVDLIVLARYMQILSPDFVKRYPH 198

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H   +
Sbjct: 199 RIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDITRISHRDQV 258

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL++AV  HI+ R+ +   KT++F
Sbjct: 259 EDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIF 295


>gi|194014860|ref|ZP_03053477.1| formyltetrahydrofolate deformylase [Bacillus pumilus ATCC 7061]
 gi|194013886|gb|EDW23451.1| formyltetrahydrofolate deformylase [Bacillus pumilus ATCC 7061]
          Length = 300

 Score =  235 bits (600), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 171/278 (61%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           L ++CP    I S +  +L   G NI++ SQ+  D ++ + F+RI F +   +  M    
Sbjct: 22  LLVSCPDQPGIVSAVSSFLFEHGANIIESSQYTTDHESGRFFLRIEFDWKDISANMDQLK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI   F + +S+    E  K  I VS+  HCL++LL+ W  G L   I  V+SNH 
Sbjct: 82  QQFEPIAASFQMTWSMSRASELKKLAIFVSKELHCLHELLWEWQSGNLMAEIAVVISNHE 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T K  VE   +PF+++   +  + E+E++ + ++E+ +++ ++LARYMQIL+     +  
Sbjct: 142 TAKDTVEALGIPFHFVKANKDIRKEAEKQQLTLLEEYDIDAIVLARYMQILTPGFIEQHP 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H   
Sbjct: 202 NKIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRDD 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E    IG+ IE  VL +AV  H++ R+ +++ KTIVF
Sbjct: 262 AEALKNIGRTIERSVLARAVKWHLEDRIIVHENKTIVF 299


>gi|330898806|gb|EGH30225.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 285

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
            ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     F+   
Sbjct: 6   DTWILTADCPSMLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPEAFDE-- 63

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A      + F + + +       K +I+VS+ DHCLNDLLYR  I  L++++V VV
Sbjct: 64  QGFRAGLSERGETFGMIFELTAPNYRPKVVIMVSKADHCLNDLLYRQRINQLSMDVVAVV 123

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + + +Y+ P+   +K   E K+  +IE++  EL+ILARYMQ+LS  LC
Sbjct: 124 SNHPDLEPLAGWHGITYYHFPLDPNDKPAQEAKVWQVIEESGAELVILARYMQVLSPDLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V 
Sbjct: 184 RKLDGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 244 HSHYPEDLIAKGRDIEGLTLARAVGYHIERRVFLNANRTVVL 285


>gi|157691987|ref|YP_001486449.1| formyltetrahydrofolate deformylase [Bacillus pumilus SAFR-032]
 gi|157680745|gb|ABV61889.1| formyltetrahydrofolate deformylase [Bacillus pumilus SAFR-032]
          Length = 300

 Score =  235 bits (599), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 171/278 (61%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           L ++CP    I S +  +L   G NI++ SQ+  D ++ + F+RI F +   +  M    
Sbjct: 22  LLVSCPDQPGIVSAVSSFLFEHGANIIESSQYTTDHESGRFFLRIEFDWKDISANMDQLK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI   F + +S+    E  K  I VS+  HCL++LL+ W  G L   I  V+SNH 
Sbjct: 82  QQFEPIASSFQMTWSMSRASELKKLAIFVSKELHCLHELLWEWQSGNLMAEIAVVISNHE 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T K  VE   +PF+++   +  + E+E++ + ++E+ +++ ++LARYMQIL+     +  
Sbjct: 142 TAKDTVEALGIPFHFVKANKDIRKEAEKEQLALLEEYDIDAIVLARYMQILTPGFIEQHP 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H   
Sbjct: 202 NKIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRDD 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E    IG+ IE  VL +AV  H++ R+ +++ KTIVF
Sbjct: 262 AEALKNIGRTIERSVLARAVKWHLEDRIIVHENKTIVF 299


>gi|148273716|ref|YP_001223277.1| putative formyltetrahydrofolate deformylase [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147831646|emb|CAN02614.1| putative formyltetrahydrofolate deformylase [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 290

 Score =  235 bits (599), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 110/276 (39%), Positives = 172/276 (62%), Gaps = 1/276 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADF 64
           +L  +C     I   I   +   G +I +  QF+  DT + FMR+               
Sbjct: 14  VLVFSCDDRPGIVHAIAGAIVEAGGDITESQQFSSADTGRFFMRLQIQSAADDDRLADAL 73

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
             +V+++   + +       +TL+L S  +HC+NDLL+R   G L + I  V+SNH    
Sbjct: 74  AAVVERYDATWHLDEVGRPLRTLVLGSTAEHCVNDLLFRQRAGQLPVEIPLVLSNHGRLA 133

Query: 125 KLVENYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
            L   Y +PF ++P+++  +K   E+++I  +E++++EL++LARYMQILS  LC +++GR
Sbjct: 134 DLAGFYGVPFEHVPVSDDASKRAFEERVIRAVEEHDIELVVLARYMQILSPELCARLSGR 193

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLP FKGANPYKQA+  GVK+IGATAH+   +LD GPI+EQ+VVRV H+++  
Sbjct: 194 IINIHHSFLPGFKGANPYKQAHARGVKLIGATAHFVTSDLDEGPIVEQNVVRVDHSRSAR 253

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +AIG++ E++ LT+AV    + RV ++  +TI+F
Sbjct: 254 ELMAIGQDEESRTLTQAVRWFAEHRVLLDGARTIIF 289


>gi|302877349|ref|YP_003845913.1| formyltetrahydrofolate deformylase [Gallionella capsiferriformans
           ES-2]
 gi|302580138|gb|ADL54149.1| formyltetrahydrofolate deformylase [Gallionella capsiferriformans
           ES-2]
          Length = 282

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 115/281 (40%), Positives = 173/281 (61%), Gaps = 9/281 (3%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-----ISFVFNTCMK 58
           Y LTI+CP    I + +  +++  G  I++ S   + ++ + FMR      S  F+    
Sbjct: 5   YTLTISCPDRAGIIAAVAGFIAQHGGFIVEASYHTEQESERFFMRQEIRADSLPFDAAE- 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  + Q+F++ + + ++ +  + +ILVS+ DHCL+DLL+RW  G L ++I  V+S
Sbjct: 64  -FGLRFAALAQEFNMHWQLADSAQNKRLVILVSRQDHCLDDLLHRWRSGELLVDIPCVIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +  VE + +PF  + M  Q+K  + + +  + ++   + M+LAR+MQIL   LC 
Sbjct: 123 NHEDLRSFVEWHGIPFIKVDM--QDKTAAFEHIAALFDEYQGDTMVLARFMQILPPFLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD VR+ H
Sbjct: 181 RYPGRIINIHHSFLPSFVGAKPYHQAYLRGVKLIGATCHYVTDELDAGPIIEQDTVRIDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T++D +  G++IE  VL++ +  H++ RV +   KTIVF
Sbjct: 241 GDTVDDLVRYGRDIEKTVLSRGLRYHVEDRVLVCGNKTIVF 281


>gi|325970928|ref|YP_004247119.1| formyltetrahydrofolate deformylase [Spirochaeta sp. Buddy]
 gi|324026166|gb|ADY12925.1| formyltetrahydrofolate deformylase [Spirochaeta sp. Buddy]
          Length = 290

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 171/278 (61%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLFI 61
           I  I C   + I S    +   +  NI+   Q  D    + FMRI    +   T  K   
Sbjct: 9   IFLIQCEDRKGILSATSTWFFQRSYNIVHCQQHTDNIEGRYFMRIELDMHDLKTTRKELE 68

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF     Q++L +    +    +  I+VS+  HCL DL+ R N G L  +I  ++SNH 
Sbjct: 69  EDFGAFANQYNLTWECHYSDYNARVAIMVSKTSHCLYDLIARKNEGDLKCDISLIISNHP 128

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + +   +++PFYYLP+T ++K E E K++ ++++ +++L++LARYMQILS    H+  
Sbjct: 129 DLEVIANQFRIPFYYLPVTNESKAEQEAKVMTLLKRFDIDLVVLARYMQILSPAFTHQWQ 188

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHH FLP+F+GANPY+QAYE GVK+IGATAHYA  ELD GPII+QDVVRV H  +
Sbjct: 189 GKIINIHHGFLPAFQGANPYRQAYERGVKMIGATAHYASEELDQGPIIDQDVVRVNHELS 248

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 +GK++E +VL KAV AH++ R+ + K +T+VF
Sbjct: 249 PNGLRDVGKDVERRVLAKAVQAHLESRIIMFKNRTVVF 286


>gi|298508708|pdb|3N0V|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution
 gi|298508709|pdb|3N0V|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution
 gi|298508710|pdb|3N0V|C Chain C, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution
 gi|298508711|pdb|3N0V|D Chain D, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (P From Pseudomonas Putida Kt2440 At 2.25 A Resolution
          Length = 286

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 165/282 (58%), Gaps = 6/282 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
            ++ILT  CPS      ++  YL  Q C + +   F+D  + + F+R+ F     F+   
Sbjct: 7   DTWILTADCPSXLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAG 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F A      + F   + +       K +I VS+ DHCLNDLLYR  IG L  ++V VV
Sbjct: 67  --FRAGLAERSEAFGXAFELTAPNHRPKVVIXVSKADHCLNDLLYRQRIGQLGXDVVAVV 124

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   +++P+Y+  +  ++K   E+K++ +IE+   EL+ILARY Q+LS  LC
Sbjct: 125 SNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYXQVLSPELC 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G  INIHHS LP FKGA PY QAY  GVK +GATAHY   +LD GPII Q V  V 
Sbjct: 185 RRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKXVGATAHYINNDLDEGPIIAQGVEVVD 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 245 HSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 286


>gi|119356527|ref|YP_911171.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides DSM
           266]
 gi|119353876|gb|ABL64747.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides DSM
           266]
          Length = 288

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 173/278 (62%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFI 61
           IL ++CP    + S I  ++  +G NIL++++  D      F+RI++   +    +    
Sbjct: 10  ILLLSCPDRPGLVSRITGFICDRGGNILNLNEHVDTGDKTFFIRIAWSIESSPLSLDELE 69

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+  +    + IR + + T+  I VS+ DHCL ++L+R ++G  A++I  +VSNH 
Sbjct: 70  RAFMPLALELGAAWKIRESGKKTRMAIFVSKYDHCLQEILWRHSMGEFAIDIALIVSNHP 129

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K L ++Y + ++      ++K + E+  + ++E+  ++ ++LARYMQILS H   +  
Sbjct: 130 DLKPLADHYGIDYHLFETDRKSKADVERDELALLEQYGIDTVVLARYMQILSPHFVERYP 189

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G NPY+QAYE GVKIIGAT+HY   +LD GPIIEQD++R+TH   
Sbjct: 190 SRIINIHHSFLPAFVGGNPYRQAYERGVKIIGATSHYVTEDLDEGPIIEQDIIRITHKDR 249

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + D I  G+++E  VL +A+  H + R+ +N +KT+VF
Sbjct: 250 LADLIRKGRDLERMVLARAIRFHAEHRILVNGKKTVVF 287


>gi|258593320|emb|CBE69659.1| Putative formyltetrahydrofolate deformylase (Formyl-H(4)F
           hydrolase) (purU) [NC10 bacterium 'Dutch sediment']
          Length = 286

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCMKLFI 61
           L I+CP    I + +   L  QG NI+   Q   D +    F+RI F     ++      
Sbjct: 9   LLISCPDRPGIVAAVSQCLFEQGANIVHSDQHTTDPEGGVFFVRIEFDLPELDSRGTELE 68

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+PI ++F + + + N        I VS+ DHCL +LL+RW    +A  I  VVSNH 
Sbjct: 69  RVFEPIARRFRMDWRLTNAARVKPIAIFVSKEDHCLLELLWRWRAEDMAAEIAMVVSNHA 128

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + LVE Y +PFY++ +T++ + ++E   + ++E   V+L+++ARYM++LS     +  
Sbjct: 129 NLRGLVEAYGIPFYHIAVTQERQEQAEASQLQLVE-GKVDLIVMARYMRVLSSAFIRRFP 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GA+PY QA+  GVK+IGATAHYA   LDAGPIIEQDV RV H  T
Sbjct: 188 NRIINIHHSFLPAFVGADPYAQAHSRGVKLIGATAHYATDALDAGPIIEQDVERVDHRHT 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED   IG+++E  VL +AV  H++ +V ++  KT+VF
Sbjct: 248 VEDLKRIGRHVERVVLARAVTWHLEDKVLVHGNKTVVF 285


>gi|258404656|ref|YP_003197398.1| formyltetrahydrofolate deformylase [Desulfohalobium retbaense DSM
           5692]
 gi|257796883|gb|ACV67820.1| formyltetrahydrofolate deformylase [Desulfohalobium retbaense DSM
           5692]
          Length = 289

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 116/281 (41%), Positives = 176/281 (62%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF------VFNTCMK 58
           L ITCP    I + +  +L   G NI  + Q   D +    FMR+ F      +    ++
Sbjct: 11  LLITCPDRPGIVAAVTGFLYAHGANINTLDQHTTDPEGGTFFMRLEFQTPHLDLSRPALE 70

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+   + ++F++ + I    +  KT +LVS+ +H L DLL+RW  G L  +I  V+S
Sbjct: 71  HAFAEV--VAERFAMDWRIAYAADRKKTAVLVSRHEHGLMDLLWRWVRGELYTDISMVIS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +PF+++P+   +K E+EQ+++ +++    +L+ILARYMQILS     
Sbjct: 129 NHPDWREAVESFGVPFHHIPVDSASKEEAEQQMLELLD-GQADLVILARYMQILSPDFVA 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GA+PY+QA E GVK+IGATAHY   ELDAGPIIEQDV+RV+H
Sbjct: 188 AFPQRIINIHHSFLPAFAGADPYRQAAERGVKLIGATAHYVTAELDAGPIIEQDVIRVSH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D  A+G++IE +VL++AV  H++ ++     +T+VF
Sbjct: 248 RHTTADLKALGRDIERQVLSRAVKWHLEDKIIPFANQTVVF 288


>gi|148652226|ref|YP_001279319.1| formyltetrahydrofolate deformylase [Psychrobacter sp. PRwf-1]
 gi|148571310|gb|ABQ93369.1| formyltetrahydrofolate deformylase [Psychrobacter sp. PRwf-1]
          Length = 294

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 119/279 (42%), Positives = 179/279 (64%), Gaps = 7/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL-DTSKLFMRISFVFNTCMKL---FI 61
           L I C     I   + +++   G NI+ + Q++   +  + FMR+ F      ++   F 
Sbjct: 17  LLIKCKDQAGIVQAVSEFIHRYGANIITLDQYSTAHEGGQYFMRLEFALAGLSEIIENFE 76

Query: 62  ADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F   + +++ +Q+ + +    TK  ILVS+ DH L DLL+R   G L  +I  VVSNH
Sbjct: 77  ASFSHTVAKRYEMQWRLHDNAIKTKVGILVSKFDHALLDLLWRHQRGLLDCDITCVVSNH 136

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VEN+ +PF+++ +T+ NK E+E+++  I+  N  +L++LARYMQILS+    + 
Sbjct: 137 NDLRQAVENFGIPFHHVQVTKDNKAEAEEQIHQIMAGN--DLLVLARYMQILSEDFVSRW 194

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA+PY+QA++ GVK+IGATAHY   +LD GPIIEQDV RVTH Q
Sbjct: 195 PMQIINIHHSFLPAFVGADPYRQAFDKGVKLIGATAHYVTADLDQGPIIEQDVHRVTHRQ 254

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +  AIG+++E  VL +AVN H+Q RV ++  KTIVF
Sbjct: 255 GVTELRAIGRDVERNVLARAVNWHVQNRVIVSGNKTIVF 293


>gi|168699784|ref|ZP_02732061.1| formyltetrahydrofolate deformylase [Gemmata obscuriglobus UQM 2246]
          Length = 284

 Score =  234 bits (597), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 105/278 (37%), Positives = 171/278 (61%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFI 61
           +L ITCP  + I + + ++L     NIL   Q  D +    FMR+ +    F   +  F 
Sbjct: 6   VLLITCPDRKGIVAAVAEFLYKHDANILHADQHQDAEGKLFFMRVEWDLSGFALDLAEFS 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+  +F +++ + +++   +  + VS+ DHCL DLLYR   G L   I  +V+NH 
Sbjct: 66  RRFSPLADRFEMRWRLEDSRNPLRVALFVSKYDHCLMDLLYRHKTGELLCEIPVIVANHP 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +K  + Y +PF+ +P+   +K  +E+K ++++    ++L+++ARYMQILS     +  
Sbjct: 126 DAQKWGDFYGVPFHVIPVPAGDKEAAERKQLDLLAAEKIDLVVMARYMQILSREFVARYP 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            R+IN+HHSFLP+F GA PY +A+E GVK+IGAT+HYA  +LD GPIIEQDVVR++H   
Sbjct: 186 QRVINVHHSFLPAFMGARPYHRAFERGVKLIGATSHYATEDLDEGPIIEQDVVRISHRDG 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED +  G+++E  VL++AV  H+  R+ +   K+++F
Sbjct: 246 LEDLLEKGRDLEKVVLSRAVRWHLDHRILVYNHKSVIF 283


>gi|56420271|ref|YP_147589.1| formyltetrahydrofolate deformylase [Geobacillus kaustophilus
           HTA426]
 gi|56380113|dbj|BAD76021.1| formyltetrahydrofolate hydrolase [Geobacillus kaustophilus HTA426]
          Length = 300

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 176/281 (62%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           + I+CP    I + +  +L  QG NI++ SQ++ D +    F+R+ F    C  +     
Sbjct: 22  ILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEF---DCPNIAERKE 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+S
Sbjct: 79  EIEAAFAPIAAEFEMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS     
Sbjct: 139 NHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           + +GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFSGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 259 RHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|93006811|ref|YP_581248.1| formyltetrahydrofolate deformylase [Psychrobacter cryohalolentis
           K5]
 gi|92394489|gb|ABE75764.1| formyltetrahydrofolate deformylase [Psychrobacter cryohalolentis
           K5]
          Length = 307

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 180/283 (63%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL-DTSKLFMRISFVFNTCMKL- 59
           ++  L I C     I   + +++   G NI+ + Q++   +  + FMR+ F      ++ 
Sbjct: 26  ATATLLIKCRDQAGIVQAVSEFIHRYGGNIITLDQYSTAHEGGQYFMRLEFALAGLSEII 85

Query: 60  --FIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F A F   + ++ S+++ + +    TK  ILVS+ DH L DLL+R   G L  +I  V
Sbjct: 86  DNFEASFAHTVAKRHSMEWRLHDNAIKTKVGILVSKFDHALLDLLWRHQRGLLDCDITCV 145

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   ++ VEN+ + F+++P+T+ NK+++E+K+  ++  N  +L++LARYMQILS   
Sbjct: 146 VSNHIVLRQSVENFGIAFHHVPVTKDNKVDAEEKIHTLMAGN--DLLVLARYMQILSSDF 203

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   +IINIHHSFLP+F GA+PY+QAY+ GVK+IGATAHY   ELD GPIIEQDV RV
Sbjct: 204 VKRWPMQIINIHHSFLPAFVGADPYRQAYDKGVKLIGATAHYVTAELDQGPIIEQDVHRV 263

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH Q + +  AIG++IE  VL +AVN H+Q RV +   KT+VF
Sbjct: 264 THRQGVTELRAIGRDIERNVLARAVNWHVQNRVIVAGNKTVVF 306


>gi|304405031|ref|ZP_07386691.1| formyltetrahydrofolate deformylase [Paenibacillus curdlanolyticus
           YK9]
 gi|304345910|gb|EFM11744.1| formyltetrahydrofolate deformylase [Paenibacillus curdlanolyticus
           YK9]
          Length = 299

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 168/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC---MKLFI 61
           + I+CP    I + +  +L   G NI+   Q+  D +    F+R  F  N     + +  
Sbjct: 22  MLISCPDRPGIVAAVSHFLYEHGANIVQSDQYTMDPEGGMFFIRFEFDLNDLERELPILQ 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF  +  +F +++         +  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 82  EDFVRVADRFDMKWHTFRASRKKRIAIFVSKEDHCLLELLWQWQAGDLDADIAMVVSNHN 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LVE + +P++++P+T + K E+E+K + ++  + ++L++LARYMQI+      +  
Sbjct: 142 DMRELVEGFGIPYHHIPVTPETKPEAEKKQMELV-ADKIDLIVLARYMQIIPQKFIEQFP 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY+QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRIINIHHSFLPAFVGGKPYQQAYSRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDN 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++D   IG+ IE  VL + V  HI+ R+ +++ KT+VF
Sbjct: 261 VDDLKRIGRTIERVVLARGVKWHIEDRMLVHQNKTVVF 298


>gi|170720193|ref|YP_001747881.1| formyltetrahydrofolate deformylase [Pseudomonas putida W619]
 gi|169758196|gb|ACA71512.1| formyltetrahydrofolate deformylase [Pseudomonas putida W619]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR      +    +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFSPIAEEFSMAWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 QDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|224826673|ref|ZP_03699774.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
 gi|224601274|gb|EEG07456.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
          Length = 287

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           +S  L I+CP  + + + I ++L T   NI+   Q  D+  +   MRI +    F   M+
Sbjct: 6   NSATLLISCPDKKGLVAAIANFLMTYNANIMHADQHQDVSENLFLMRIEWSLDGFTLPME 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A FQPI  +  + + +  +    +  I VS+ +HCL DLL+RW IG L  +I  ++S
Sbjct: 66  SFAAAFQPIADKHGMTWRVSLSSRKPRMAIFVSKYEHCLVDLLHRWRIGELNCDIPLIIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E   +P++ +P+T+ NK E+E +   ++E+  V++++LARYMQ+LS     
Sbjct: 126 NHEDCRRMAEFNGIPYHVVPVTQTNKEEAEAEQWRLLEEAGVDVIVLARYMQVLSQRFVE 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY    LD GPIIEQ+V R++H
Sbjct: 186 RFPNRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEVLDDGPIIEQEVTRISH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +ED +  G+++E  VL++AV  H+  RV     KT+VF
Sbjct: 246 RDDVEDLVQKGRDLEKVVLSRAVRWHLDDRVLSYSNKTVVF 286


>gi|260777456|ref|ZP_05886350.1| formyltetrahydrofolate deformylase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607122|gb|EEX33396.1| formyltetrahydrofolate deformylase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 310

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL- 59
           M +YILT +CPS      ++  +L    C I +++ F+D    + F+R  F      +L 
Sbjct: 25  MKTYILTASCPSRAGTVDVVTRFLLEFECYIKELNSFDDTLNERFFIRAVFSVQNGQELN 84

Query: 60  ---FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
              F A F     +F + + +  +    K +I+VS+ DHCLNDLLYR+  G L ++I  V
Sbjct: 85  RASFEAAFSARASEFDMDWELTPSDYRPKVVIMVSKYDHCLNDLLYRYRTGNLKVDIKAV 144

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + LVE + +P+++ P++ + K + E  + +++++ + EL++LARYMQ+LS  +
Sbjct: 145 ISNHPDLQSLVEWHDIPYHHFPISAETKPQQEALVQSVLDETDCELLVLARYMQVLSHDM 204

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C + +GR INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q +  V
Sbjct: 205 CSRWSGRAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYVSDDLDEGPIITQGLETV 264

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H    ED    G ++E+  L +A+  H+++RVF+   KTIVF
Sbjct: 265 DHTYYPEDLARKGLDVESLTLGRAIQYHVEKRVFMYNDKTIVF 307


>gi|196228878|ref|ZP_03127744.1| formyltetrahydrofolate deformylase [Chthoniobacter flavus Ellin428]
 gi|196227159|gb|EDY21663.1| formyltetrahydrofolate deformylase [Chthoniobacter flavus Ellin428]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 172/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
           S +L ++CP    + ++I ++++  G N++++ Q+ D      F R+     T    +  
Sbjct: 2   STLLRLSCPDRVGLLALISNFIAQHGGNLIEVHQYTDAAAGWFFTRMEIDTRTLKVDLPK 61

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F P+  +   +++IR  +   K +++VS+  HCL DLL+RW+ G L + I  V+SN
Sbjct: 62  LREEFTPVATELGAEWTIRTAEAKRKVIVMVSKFGHCLADLLWRWHSGELDIEIAAVISN 121

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE   L F ++P+   +K  +  K+  I      +L++LARYMQIL   +C +
Sbjct: 122 HEDFRPMVEREGLEFCHVPVDPHDKPAAFAKIAEIFRFVQPDLIVLARYMQILPAEVCAE 181

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
            +GR++NIHHSFLPSF GANPY++A++ GVK+IGAT HY   ELDAGPI++Q+V+RV H 
Sbjct: 182 FSGRVLNIHHSFLPSFVGANPYQRAWQRGVKLIGATCHYVTSELDAGPIVDQEVIRVEHF 241

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED + +G++ E   L ++V  H+  RV ++ ++ IVF
Sbjct: 242 HTPEDLMRLGRDCERLALARSVRWHLDDRVLLHGQRAIVF 281


>gi|310640823|ref|YP_003945581.1| formyltetrahydrofolate deformylase (formyl-h(4)f hydrolase) (puru)
           [Paenibacillus polymyxa SC2]
 gi|309245773|gb|ADO55340.1| Putative formyltetrahydrofolate deformylase (Formyl-H(4)F
           hydrolase) (PurU) [Paenibacillus polymyxa SC2]
          Length = 299

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 165/278 (59%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + ++CP    I + +  +L   G NI+   Q+  D      FMRI F     +       
Sbjct: 22  MLVSCPDGPGIVATVSRFLYEHGANIVQSDQYTMDPSGGMFFMRIEFDLPNLSAAQSQLE 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF  + +QF ++++I       K  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 82  QDFVAVAEQFRMEWTISAVSRKKKLAIFVSKEDHCLVELLWQWQAGDLDADIALVVSNHP 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P++++P+T   K E+E++ + +I    ++++ILARYMQI+S        
Sbjct: 142 DMKEYVESFGIPYHHIPVTADTKPEAERRQLEVI-GEEIDVIILARYMQIISPKFIEHYR 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHGDD 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  H + R+ +++ KT+VF
Sbjct: 261 VNELKRIGRTIERVVLARAVKWHTEDRILVHENKTVVF 298


>gi|167035440|ref|YP_001670671.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
 gi|166861928|gb|ABZ00336.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR      +    +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMAWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 RDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|330504552|ref|YP_004381421.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
 gi|328918838|gb|AEB59669.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
          Length = 283

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I+CP    I + + ++L+T    I + S  +D  +   FMR     ++    +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  DGFKQAFSPIAREFSMEWRITDSAQKKRVVLMASRESHCLADLLHRWHSNELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+   +K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPADKAPAFAEVERLVKEHRADVIVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 AEFAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   IE+ + +GK++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HRDDIEEMVRLGKDVEKMVLARGLRYHLEDRVLVHDNKTVVF 282


>gi|221133640|ref|ZP_03559945.1| formyltetrahydrofolate deformylase [Glaciecola sp. HTCC2999]
          Length = 284

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 168/280 (60%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
           S+ L+I CP    + + +  +L+  G  IL+ +   DL T + FMR     ++    M  
Sbjct: 4   SFRLSIQCPDQVGLVAQVSQFLAQYGATILEANHHTDLSTKRFFMRHEIQADSVDLDMAT 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F PI  +F++ ++I +     K  +L S   HCL D+L+RW+ G L  +I  +++N
Sbjct: 64  FEAAFTPIANKFNMDWTISDPARLPKVALLASHETHCLADILHRWHTGELNCDIPCIIAN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     +   Y++PFY++    Q+K  +  ++ + +EK +++ ++LAR+MQIL + +C K
Sbjct: 124 HEKIADIAAWYKVPFYFVDFKGQDKANAFAQIEDTLEKYDIDTVVLARFMQILPEAMCTK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G  INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V+R++H+
Sbjct: 184 WHGHAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTSDLDEGPIIEQQVMRISHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D +  G++ E   L   +  HI+ RV I+K KTIVF
Sbjct: 244 DAAADMVRKGRDCEKTALANGLRYHIEDRVMIDKNKTIVF 283


>gi|26988101|ref|NP_743526.1| formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148549561|ref|YP_001269663.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|24982828|gb|AAN66990.1|AE016327_5 formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148513619|gb|ABQ80479.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|313500407|gb|ADR61773.1| PurU_2 [Pseudomonas putida BIRD-1]
          Length = 283

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR      +    +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 RDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|308068043|ref|YP_003869648.1| formyltetrahydrofolate deformylase (formyl-FH(4) hydrolase)
           [Paenibacillus polymyxa E681]
 gi|305857322|gb|ADM69110.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Paenibacillus polymyxa E681]
          Length = 299

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 166/278 (59%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + ++CP    I + +  +L   G NI+   Q+  D      FMRI F     +       
Sbjct: 22  MLVSCPDGPGIVATVSRFLYEHGANIVQSDQYTMDPSGGMFFMRIEFDLPNLSATQPQLE 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF  + +QF ++++I       K  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 82  QDFAAVAEQFRMEWTISAVSRKKKLAIFVSKEDHCLVELLWQWQAGDLDADISLVVSNHP 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P++++P+T   K E+E++ + +I   +++++ILARYMQI+S        
Sbjct: 142 DMKEYVESFGIPYHHIPVTADTKPEAERRQLEVI-GEDIDVIILARYMQIISPKFIEHYR 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHGDD 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  H + R+ +++ KT+VF
Sbjct: 261 VNELKRIGRTIERVVLARAVKWHAEDRILVHENKTVVF 298


>gi|261408999|ref|YP_003245240.1| formyltetrahydrofolate deformylase [Paenibacillus sp. Y412MC10]
 gi|261285462|gb|ACX67433.1| formyltetrahydrofolate deformylase [Paenibacillus sp. Y412MC10]
          Length = 312

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +    
Sbjct: 35  MLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKLPQLE 94

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+ +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 95  ESFREVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIALVVSNHL 154

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P++++P+T   K ++EQ+ + +I  ++++++ILARYMQI+S        
Sbjct: 155 DMKEYVESFGIPYHHIPVTADTKPQAEQRQLEVI-GDDIDVIILARYMQIISPTFIDHYR 213

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 214 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDD 273

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 274 VNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVF 311


>gi|261419936|ref|YP_003253618.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC61]
 gi|319766750|ref|YP_004132251.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC52]
 gi|261376393|gb|ACX79136.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC61]
 gi|317111616|gb|ADU94108.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC52]
          Length = 300

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 175/281 (62%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           + I+CP    I + +  +L  QG NI++ SQ++ D +    F+R+ F    C  +     
Sbjct: 22  ILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEF---DCPNIAERKE 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+S
Sbjct: 79  EIEAAFAPIAAEFQMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS     
Sbjct: 139 NHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 259 RHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|329928949|ref|ZP_08282759.1| formyltetrahydrofolate deformylase [Paenibacillus sp. HGF5]
 gi|328937201|gb|EGG33628.1| formyltetrahydrofolate deformylase [Paenibacillus sp. HGF5]
          Length = 299

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 170/278 (61%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +    
Sbjct: 22  MLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKLPQLE 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F+ +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 82  ESFREVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIGLVVSNHL 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P++++P+T   K ++EQ+ +++I  ++++++ILARYMQI+S        
Sbjct: 142 DMKEYVESFGIPYHHIPVTADTKPQAEQRQLDVI-GDDIDVIILARYMQIISPTFIDHYR 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDD 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 261 VNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVF 298


>gi|49083335|gb|AAT51005.1| PA5420 [synthetic construct]
          Length = 286

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 165/280 (58%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT   PS      ++  YL  Q C + +   F+D    + F+R+ F          
Sbjct: 6   DTWILTADSPSLLGTVDVVTRYLFEQRCYVTEHHSFDDRLAQRFFIRVEFRAGDGFDEAS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A     V  F ++  +      ++  I+VS+ DHCLNDLLYR  IG L +++V V+SN
Sbjct: 66  FRAGLAERVAPFGMRTELTAPGYRSQVAIMVSKADHCLNDLLYRQRIGQLPMDVVAVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   + +P+++ P+   +K   E ++  ++E++  EL+ILARYMQ+LS  LC +
Sbjct: 126 HPDLEPLARWHGIPYHHFPLDPNDKPAQEARVWQVLEESGAELVILARYMQVLSPELCRR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAY+ GVK++GATAHY   +LD GPII Q V  V HA
Sbjct: 186 LDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYINNDLDEGPIIAQGVETVDHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|152984646|ref|YP_001351519.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
 gi|150959804|gb|ABR81829.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
          Length = 285

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 165/280 (58%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT   PS      ++  YL  Q C + +   F+D    + F+R+ F          
Sbjct: 6   DTWILTADSPSLLGTVDVVTRYLFEQRCYVTEHHSFDDRLAQRFFIRVEFRAGEGFDEAS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A     V  F ++  +      ++  I+VS+ DHCLNDLLYR  IG L +++V V+SN
Sbjct: 66  FRAGLAERVAPFGMRTELTAPGYRSQVAIMVSKADHCLNDLLYRQRIGQLPMDVVAVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   + +P+++ P+   +K   E ++  ++E++  EL+ILARYMQ+LS  LC +
Sbjct: 126 HPDLEPLARWHGIPYHHFPLDPNDKPAQEARVWQVLEESGAELVILARYMQVLSPELCRR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAY+ GVK++GATAHY   +LD GPII Q V  V HA
Sbjct: 186 LDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYINNDLDEGPIIAQGVETVDHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|15600613|ref|NP_254107.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|107104522|ref|ZP_01368440.1| hypothetical protein PaerPA_01005600 [Pseudomonas aeruginosa PACS2]
 gi|116053568|ref|YP_793895.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218894523|ref|YP_002443393.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
 gi|254237895|ref|ZP_04931218.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|254242972|ref|ZP_04936294.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|296392281|ref|ZP_06881756.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAb1]
 gi|313111647|ref|ZP_07797444.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
 gi|9951747|gb|AAG08805.1|AE004954_7 formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|115588789|gb|ABJ14804.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169826|gb|EAZ55337.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|126196350|gb|EAZ60413.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|218774752|emb|CAW30569.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
 gi|310883946|gb|EFQ42540.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
          Length = 285

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 165/280 (58%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--L 59
            ++ILT   PS      ++  YL  Q C + +   F+D    + F+R+ F          
Sbjct: 6   DTWILTADSPSLLGTVDVVTRYLFEQRCYVTEHHSFDDRLAQRFFIRVEFRAGDGFDEAS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A     V  F ++  +      ++  I+VS+ DHCLNDLLYR  IG L +++V V+SN
Sbjct: 66  FRAGLAERVAPFGMRTELTAPGYRSQVAIMVSKADHCLNDLLYRQRIGQLPMDVVAVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   + +P+++ P+   +K   E ++  ++E++  EL+ILARYMQ+LS  LC +
Sbjct: 126 HPDLEPLARWHGIPYHHFPLDPNDKPAQEARVWQVLEESGAELVILARYMQVLSPELCRR 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAY+ GVK++GATAHY   +LD GPII Q V  V HA
Sbjct: 186 LDGWAINIHHSLLPGFKGAKPYHQAYQKGVKLVGATAHYINNDLDEGPIIAQGVETVDHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L +AV  HI++RVF+N  +T+V 
Sbjct: 246 HYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL 285


>gi|56477395|ref|YP_158984.1| formyltetrahydrofolate deformylase [Aromatoleum aromaticum EbN1]
 gi|56313438|emb|CAI08083.1| Formyltetrahydrofolate deformylase [Aromatoleum aromaticum EbN1]
          Length = 291

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 173/284 (60%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-----SKLFMRISFVFNTC-- 56
           + L+ +CP    I + +  +++     IL+ S   +         + FMRI    ++   
Sbjct: 7   FTLSASCPDRVGIVARVSSFIAEHRGWILETSLHAEPPAEGEALGRYFMRIEIRTSSLPF 66

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +  F   F+P+  +  ++++I ++    + ++LVS+ +HCL DLL RW    L + I  
Sbjct: 67  HLAEFRERFRPLADELEMEWTITDSAVKKRVVVLVSKQEHCLYDLLARWQSKELDIEIPC 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH T + LVE + +PF+++P+   NK ++  ++  I E+   E M+LARYMQ+LS  
Sbjct: 127 VISNHDTFRGLVEWHGIPFHHVPVNADNKAQAYAEVARIFEEVRGETMVLARYMQVLSPQ 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GRIINIHHSFLPSF GA PY QA+  GVK+IGAT HY   +LD GPII+QDV+R
Sbjct: 187 LCAAYAGRIINIHHSFLPSFVGAKPYHQAWAKGVKLIGATCHYVTADLDQGPIIDQDVIR 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + H+ ++ED +  GK+IE  VL + +  H++ RV +++ KTIVF
Sbjct: 247 IDHSDSVEDMVRYGKDIEKMVLARGLRYHLEGRVLVHRNKTIVF 290


>gi|315649116|ref|ZP_07902209.1| formyltetrahydrofolate deformylase [Paenibacillus vortex V453]
 gi|315275551|gb|EFU38906.1| formyltetrahydrofolate deformylase [Paenibacillus vortex V453]
          Length = 299

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +    
Sbjct: 22  MLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKLPQLE 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VVSNH 
Sbjct: 82  ESFLEVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIALVVSNHL 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             K+ VE++ +P++++P+T   K E+E++ +++I  ++++++ILARYMQI+S        
Sbjct: 142 DMKEYVESFGIPYHHIPVTADTKPEAEKRQLDVI-GDDIDVIILARYMQIISPTFIEHYR 200

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 201 NRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDD 260

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 261 VNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVF 298


>gi|23100148|ref|NP_693614.1| formyltetrahydrofolate deformylase [Oceanobacillus iheyensis
           HTE831]
 gi|22778380|dbj|BAC14649.1| formyltetrahydrofolate deformylase [Oceanobacillus iheyensis
           HTE831]
          Length = 300

 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 119/278 (42%), Positives = 174/278 (62%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC---MKLFI 61
           L I CP  + I + +  +L  QG NI+  +Q+  D +  + FMR+ F        +    
Sbjct: 22  LLIKCPDKQGIVAAVSTFLHEQGANIVASNQYTVDPEGGQFFMRLEFEIKGLSEQVGQLK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             FQ + +   +++ I    E     I VS+  HCL +LL+ W  G L  NI  V+SNH 
Sbjct: 82  EKFQIVAEHMDMEWRIAMMSELKNVAIFVSKEPHCLLELLWEWQSGDLLANIKVVISNHE 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T +++VE   +PFY++P+T++ K E+E+K   I++K ++EL+ILARYMQILS H   K  
Sbjct: 142 TAREMVEAVGIPFYHIPVTKEQKKEAEEKQNQILKKYDIELIILARYMQILSPHFVEKYE 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GA PY++AY+ GVK+IGAT+HY   +LD GPIIEQD+ RV H Q 
Sbjct: 202 SKIINIHHSFLPAFIGAKPYERAYDRGVKMIGATSHYVTNDLDEGPIIEQDIDRVNHEQD 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D   IG++IE +VL +AV  H++ R+ ++  KTI+F
Sbjct: 262 AADLKKIGQSIERRVLARAVKWHLEDRILVHGNKTIIF 299


>gi|28871451|ref|NP_794070.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71738013|ref|YP_276154.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213970278|ref|ZP_03398408.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|257486441|ref|ZP_05640482.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289628500|ref|ZP_06461454.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648242|ref|ZP_06479585.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|301382936|ref|ZP_07231354.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063789|ref|ZP_07255330.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302133523|ref|ZP_07259513.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854702|gb|AAO57765.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71558566|gb|AAZ37777.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213924950|gb|EEB58515.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|320327219|gb|EFW83233.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330868770|gb|EGH03479.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330877833|gb|EGH11982.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330880767|gb|EGH14916.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330950130|gb|EGH50390.1| formyltetrahydrofolate deformylase [Pseudomonas syringae Cit 7]
 gi|330957881|gb|EGH58141.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330966614|gb|EGH66874.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330987781|gb|EGH85884.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009928|gb|EGH89984.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 283

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|66047245|ref|YP_237086.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257952|gb|AAY39048.1| Formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330973533|gb|EGH73599.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 283

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|320325493|gb|EFW81555.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 283

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPTFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|297530102|ref|YP_003671377.1| formyltetrahydrofolate deformylase [Geobacillus sp. C56-T3]
 gi|297253354|gb|ADI26800.1| formyltetrahydrofolate deformylase [Geobacillus sp. C56-T3]
          Length = 300

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 174/281 (61%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           + I+CP    I + +  +L  QG NI++ SQ++ D +    F+R+ F    C  +     
Sbjct: 22  ILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEF---DCPNIAEQKE 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V S
Sbjct: 79  EIEAAFAPIAAEFQMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVTS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS     
Sbjct: 139 NHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 259 RHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|289677838|ref|ZP_06498728.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae FF5]
 gi|330898432|gb|EGH29851.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330937749|gb|EGH41633.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 283

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHNIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|323507762|emb|CBQ67633.1| related to Formyltetrahydrofolate deformylase [Sporisorium
           reilianum]
          Length = 386

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 177/301 (58%), Gaps = 24/301 (7%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI------------- 49
           S ILT++ P    I   I  +L+ +  NI+D +QF D  T   FMR+             
Sbjct: 85  SIILTLSGPDGPGIVHRISGFLARRNMNIMDSAQFGDPTTGTFFMRVHASEPEPENGSHP 144

Query: 50  ---SFVFNTCMKLFIADFQP-----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLL 101
              +  +      F+A  +        ++  +   I   +E  +TLI+VS+  HCLNDLL
Sbjct: 145 DPKASDYAQQRAAFLAKVKAEFDDEFAKEAEVSVKIFGAEEKPRTLIMVSKIGHCLNDLL 204

Query: 102 YRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTE---QNKIESEQKLINIIEKN 158
           +R +  TL + +  ++SNH  ++ L +   +PFY+LP+     + K   E +++ + ++ 
Sbjct: 205 FRLSNNTLPITVPLIISNHADYEPLAKANGIPFYHLPINAAEGKTKQWQEAEMVKLAQQY 264

Query: 159 NVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHY 218
           ++++++LARYMQILS  LC   +GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAH+
Sbjct: 265 DIDMIVLARYMQILSPQLCSLFSGRIINIHHSFLPSFKGAKPYHQAFERGVKLIGATAHF 324

Query: 219 AICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              +LD GPIIEQ V RV HA T  D +  G ++EA+VL +AV    ++RV +N  KT+V
Sbjct: 325 VTADLDEGPIIEQAVERVDHAMTPADLVQAGSDVEARVLARAVKWTAERRVLLNGAKTVV 384

Query: 279 F 279
           F
Sbjct: 385 F 385


>gi|257068706|ref|YP_003154961.1| formyltetrahydrofolate deformylase [Brachybacterium faecium DSM
           4810]
 gi|256559524|gb|ACU85371.1| formyltetrahydrofolate deformylase [Brachybacterium faecium DSM
           4810]
          Length = 298

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 170/277 (61%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT+ C     I   +   +   G NI +  QF    T + +MR+    +   +     
Sbjct: 21  FVLTVVCEDAPGIVHAVTGAIVEVGGNITESRQFESGATHRFYMRLQVRTSASAEEVEQA 80

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             P +++F L++SI       +TLIL S   HC+NDLL++   G L + +  +++NH T 
Sbjct: 81  LAPAIERFGLEHSIDEVGRPLRTLILGSTAKHCVNDLLFQTESGHLPIEVPLILANHPTL 140

Query: 124 KKLVENYQLPFYYLPM-TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
           +KL   Y++PF +LP   E  K   E ++   ++++++EL++LARYMQILS  LC ++ G
Sbjct: 141 EKLAGFYEVPFEHLPTKGEGAKAAFEDRVREAVQEHDIELVVLARYMQILSPELCAELAG 200

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGANPY+QA+  GVK IGATAH+   +LD GPIIEQ+V+RV H +T 
Sbjct: 201 RCINIHHSFLPGFKGANPYRQAHARGVKQIGATAHFVTSDLDEGPIIEQEVLRVDHTRTP 260

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ +AIG++ E + L +AV    Q RV ++  +TIVF
Sbjct: 261 KELMAIGQDAEMRTLRQAVAWFAQSRVLLDGTRTIVF 297


>gi|331018016|gb|EGH98072.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 283

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  ++E+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSVENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|330888489|gb|EGH21150.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 283

 Score =  231 bits (590), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHGIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|163782775|ref|ZP_02177771.1| formyltetrahydrofolate deformylase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881896|gb|EDP75404.1| formyltetrahydrofolate deformylase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 283

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 121/283 (42%), Positives = 177/283 (62%), Gaps = 5/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M S IL I+CP  + I   I  +++  G NIL   Q  D      F R+ +   T  +  
Sbjct: 1   MDSAILLISCPDRKGIVKEIASFIADNGGNILHFDQHIDSQKGIFFARVEWDI-TDFRFR 59

Query: 61  IAD----FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             D    F+PI ++FS+ YS+    E  +  + VS+ +HC  DL+ R+  G L  ++  V
Sbjct: 60  GGDIEEAFKPIAERFSMNYSLHFGGELQRVAVFVSRQEHCFYDLMQRFRSGELKGDVKLV 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   K + + + +P+YY+P T++NK E+E+K + ++E+  ++ +ILARYMQILS   
Sbjct: 120 VSNHPDLKPIADFFGVPYYYIPKTKENKREAEEKELALLEEYGIDTIILARYMQILSREF 179

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   RIINIHHSFLP+F GA PY +AYE GVKIIGAT+HY    LD GPIIEQD++RV
Sbjct: 180 VDRFRNRIINIHHSFLPAFPGAKPYHRAYERGVKIIGATSHYVTEILDEGPIIEQDIIRV 239

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  ++ED+I  GK+IE  VL +AV  H++++V +   KT+VF
Sbjct: 240 SHRDSLEDFIRKGKDIERIVLARAVKWHLERKVLVYDNKTVVF 282


>gi|170781031|ref|YP_001709363.1| putative formyltetrahydrofolate deformylase [Clavibacter
           michiganensis subsp. sepedonicus]
 gi|169155599|emb|CAQ00716.1| putative formyltetrahydrofolate deformylase [Clavibacter
           michiganensis subsp. sepedonicus]
          Length = 265

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 170/254 (66%), Gaps = 3/254 (1%)

Query: 28  GCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD-FQPIVQQFSLQYSIRNTKEATKT 86
           G +I +  QF+  DT + FMR+  + +      +AD    +V+++   + +       +T
Sbjct: 12  GGDITESQQFSSADTGRFFMRLQ-IQSAADDDRLADVLAAVVERYDATWHLDEVGRPLRT 70

Query: 87  LILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMT-EQNKI 145
           L+L S  +HC+NDLL+R   G L + I  V+SNH     L   Y +PF ++P+T E +K 
Sbjct: 71  LVLGSTAEHCVNDLLFRQRAGQLPVEIPLVLSNHGKLADLAGFYGVPFEHVPVTDEASKQ 130

Query: 146 ESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAY 205
             E+++I  +E++++EL++LARYMQILS  LC +++GRIINIHHSFLP FKGANPYKQA+
Sbjct: 131 AFEERVIRAVEEHDIELVVLARYMQILSPGLCARLSGRIINIHHSFLPGFKGANPYKQAH 190

Query: 206 EYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHI 265
             GVK+IGATAH+   +LD GPI+EQ+VVRV H+++  + +AIG++ E++ LT+AV    
Sbjct: 191 ARGVKLIGATAHFVTSDLDEGPIVEQNVVRVDHSRSARELMAIGQDEESRTLTQAVRWFA 250

Query: 266 QQRVFINKRKTIVF 279
           + RV ++  +TI+F
Sbjct: 251 EHRVLLDGARTIIF 264


>gi|283852727|ref|ZP_06369992.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. FW1012B]
 gi|283571905|gb|EFC19900.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. FW1012B]
          Length = 285

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 169/279 (60%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L ITCP    I S +  +L T G NI+D+ Q + D +    F+R+ F     +       
Sbjct: 7   LCITCPDRPGIVSAVTTFLYTHGANIIDLDQHSTDPEGGTFFLRLEFYTPYMDVSRSALE 66

Query: 62  ADFQPIVQ-QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F  +V  +FS+ + +  + E  +  + VS+ DHCL +LL+R+    L  +I  VVSNH
Sbjct: 67  AAFGEVVGGRFSMDWRLSYSDEPKRAALFVSRHDHCLMELLWRFARKELPCDIAMVVSNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +  VE + +PF+ +P+ +    E+E K+  ++  +N +L++LARYM+ILS       
Sbjct: 127 EDLRASVEGFGVPFHAVPVGDGGMAEAEAKMAELL-GDNTDLIVLARYMRILSGDFLRPY 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             R+INIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELDAGPIIEQD  RVTH  
Sbjct: 186 EHRVINIHHSFLPAFVGADPYRQAHEKGVKLIGATAHYVTAELDAGPIIEQDTARVTHRF 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ D  A G ++E  VL +AV  H++ RV +   KT+VF
Sbjct: 246 SVADLKATGSDLERNVLARAVKWHLEDRVIVFGNKTVVF 284


>gi|332704185|ref|ZP_08424273.1| formyltetrahydrofolate deformylase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554334|gb|EGJ51378.1| formyltetrahydrofolate deformylase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 286

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 173/279 (62%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L ITCP    I + +  +L +   NI  + Q + D +    FMR+ F     +       
Sbjct: 9   LLITCPDKPGIVAAVTGFLYSHNVNINTLDQHSSDPEGGNFFMRLEFQTPHLDISKPALE 68

Query: 62  ADFQPIVQ-QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             F  +V  +F + + I    E  K  ILVS+ DHCL +LL+RW+ G L  +I  V+SNH
Sbjct: 69  KAFGEVVAPRFDMHWRIHYAWERKKMAILVSRWDHCLLELLWRWSRGELHCDISMVISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VE++ +PF+++P+ ++N+ E++Q ++ +++    + ++LARYMQIL        
Sbjct: 129 PDLREAVESFGVPFHHIPIIKENRHEADQAMLKLLD-GQADFVVLARYMQILPKEFVAPY 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           + RIINIHHSFLP+F GA+PY+QAYE GVKIIGATAHY   ELDAGPIIEQDV RV+H  
Sbjct: 188 SRRIINIHHSFLPAFIGADPYRQAYERGVKIIGATAHYVTEELDAGPIIEQDVARVSHRY 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            IE    +G+++E +VL +AV  H+  R+ ++  KT+VF
Sbjct: 248 NIEALKDLGRDLERQVLARAVRCHVDDRIIVDGNKTVVF 286


>gi|221309171|ref|ZP_03591018.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313497|ref|ZP_03595302.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318419|ref|ZP_03599713.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322693|ref|ZP_03603987.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767307|ref|NP_389194.2| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321315062|ref|YP_004207349.1| formyltetrahydrofolate deformylase [Bacillus subtilis BSn5]
 gi|239938685|sp|O34990|PURU_BACSU RecName: Full=Formyltetrahydrofolate deformylase; AltName:
           Full=Formyl-FH(4) hydrolase
 gi|225184934|emb|CAB13168.2| formyltetrahydrofolate hydrolase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021336|gb|ADV96322.1| formyltetrahydrofolate deformylase [Bacillus subtilis BSn5]
          Length = 300

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 170/281 (60%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F    C  +     
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEF---DCAGIREKKS 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+S
Sbjct: 79  SLQAAFASVAEKFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+     
Sbjct: 139 NHEEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 AHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E    IG+ IE  VL +AV  H++ RV +++ KTIVF
Sbjct: 259 RDNAEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVF 299


>gi|237798644|ref|ZP_04587105.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021497|gb|EGI01554.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 283

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDSLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F+PI ++F++ + I ++ +    +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFKPIAEEFAMDWRITDSAQKKHVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|302188461|ref|ZP_07265134.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae 642]
          Length = 283

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI + FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEAFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|311694249|gb|ADP97122.1| formyltetrahydrofolate deformylase [marine bacterium HP15]
          Length = 237

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 98/220 (44%), Positives = 157/220 (71%)

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F+PI ++F++ + I ++ +  K +++ S+  HC+ DLL+RW+   +   IV V+SN
Sbjct: 17  FRAAFEPIAREFNMNWHIADSAQPKKVILMCSKESHCVADLLHRWHSKEINAEIVAVISN 76

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE +++P++++P++++NK E+   +  + +K   ++++LARYMQIL   LC K
Sbjct: 77  HDDLRRMVEWHEIPYHHVPVSKENKEEAFAHIDELFQKYEADVVVLARYMQILPGELCEK 136

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
            +G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R+TH+
Sbjct: 137 YSGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQDVIRITHS 196

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +IED + +GK++E  VL + + +HI+ RV   + KT+VF
Sbjct: 197 DSIEDMVRLGKDVEKNVLARGLRSHIEDRVITYENKTVVF 236


>gi|226951955|ref|ZP_03822419.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ATCC 27244]
 gi|294649217|ref|ZP_06726655.1| formyltetrahydrofolate deformylase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837293|gb|EEH69676.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ATCC 27244]
 gi|292824884|gb|EFF83649.1| formyltetrahydrofolate deformylase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 288

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/282 (41%), Positives = 175/282 (62%), Gaps = 13/282 (4%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN-------TCM 57
           L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +         M
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRKEALM 70

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A+   + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+LA  I  V+
Sbjct: 71  QTFAAN---VAERYGMQWKLNFVGELKKVGILVSKVDHALLELLWRHARGSLACEITQVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VEN+ +PF+ +P+ + NK E+  ++ ++++ N+  L+ILARYMQILS+   
Sbjct: 128 SNHPDLREAVENFGIPFHVVPVNKDNKAEAYAQINDMMQGND--LLILARYMQILSEDFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 186 SQWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVS 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +E    +G+++E  VL +AV  H++ RV ++  KT+VF
Sbjct: 246 HDYNVEQLRELGEDVERNVLARAVKWHLEDRVIVDGNKTVVF 287


>gi|94985588|ref|YP_604952.1| formyltetrahydrofolate deformylase [Deinococcus geothermalis DSM
           11300]
 gi|94555869|gb|ABF45783.1| formyltetrahydrofolate deformylase [Deinococcus geothermalis DSM
           11300]
          Length = 296

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 174/284 (61%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTC 56
           +++ +LTITCP    I + +  +L + G NIL   Q + D      FMR+ F     +  
Sbjct: 13  LNTAVLTITCPDRGGIVAAVSQFLFSHGANILHSDQHSTDPAGGTFFMRMEFHLDGLDLA 72

Query: 57  MKLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            + F   F Q I   F + + +  T +  +  ILVS+ DHC  DLL+R   G L + I  
Sbjct: 73  REPFERAFAQVIAAPFGMDWRLSYTAQPKRMAILVSRYDHCFLDLLWRRRRGELNVEIPL 132

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH    +  + + +PF+ +P+T +NK E+E + + ++++   +  +LARYMQILS  
Sbjct: 133 VISNHPDLARDADMFGIPFHVVPVTRENKAEAEAEQVRLLQEAGADFAVLARYMQILSGD 192

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +    +INIHHSFLP+F GANPY+ A++ GVK+IGAT+HY   ELDAGPII QDV+ 
Sbjct: 193 FLREFGRPVINIHHSFLPAFVGANPYRAAFQRGVKLIGATSHYVTEELDAGPIIAQDVIP 252

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           VTH +T +  + +G+++E +VL +AV AH++ RV ++  KT+VF
Sbjct: 253 VTHRETPDTLMRLGRDVERQVLARAVKAHVEDRVLVHGNKTVVF 296


>gi|319654307|ref|ZP_08008395.1| formyltetrahydrofolate deformylase [Bacillus sp. 2_A_57_CT2]
 gi|317394007|gb|EFV74757.1| formyltetrahydrofolate deformylase [Bacillus sp. 2_A_57_CT2]
          Length = 288

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L I+CP    I S + ++L     NI+   Q   D      FMRI F    F+       
Sbjct: 12  LLISCPERPGIISTVSNFLLEHKANIVHFDQHTTDPLAGIFFMRIEFDMNHFDESFSKLK 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D   + +++S+++ +    E  +  I VS+ DHCL +LL+RW    L ++I  V+SNH 
Sbjct: 72  GDLPEMAREYSMEWKLSGKGERKRMAIFVSKMDHCLLELLWRWKSKELEVDIPLVISNHP 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++VE + +P++++P+T   K E+EQK + ++E   V+ ++LARYMQILS     K  
Sbjct: 132 DMREVVEGFGIPYHHIPITPDTKAEAEQKSVELLE-GKVDFIVLARYMQILSPSFISKYP 190

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GANPY +A+  GVK+IGATAHY   +LD GPIIEQDV RV H  T
Sbjct: 191 NRIINIHHSFLPAFVGANPYARAFNRGVKLIGATAHYVTNDLDEGPIIEQDVQRVNHRHT 250

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +D    G+++E +VL +AV  H++ +V ++  KTIVF
Sbjct: 251 AQDLKIAGRHVERQVLAQAVAWHVEDKVIVHGNKTIVF 288


>gi|2632031|emb|CAA05590.1| YkkE [Bacillus subtilis]
          Length = 300

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 170/281 (60%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F    C  +     
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEF---DCAGIREKKS 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+S
Sbjct: 79  SLQAAFASVAEKFDMTWSLTLASELKRVAIFVSKNLHCLHELIWEWQTGNLMAEIAVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+     
Sbjct: 139 NHEEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 AHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIKRVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E    IG+ IE  VL +AV  H++ RV +++ KTIVF
Sbjct: 259 RDNAETLKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVF 299


>gi|104780363|ref|YP_606861.1| formyltetrahydrofolate deformylase [Pseudomonas entomophila L48]
 gi|95109350|emb|CAK14050.1| putative formyltetrahydrofolate deformylase PurU-2 [Pseudomonas
           entomophila L48]
          Length = 283

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 173/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR      +    +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWRITDSAQKKRVVLMASRESHCLADLLHRWHTNELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  ++++   + ++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFHHVPVDPKDKQPAFAEVSRLVQEYAADAVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 QEYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|15615827|ref|NP_244131.1| formyltetrahydrofolate deformylase [Bacillus halodurans C-125]
 gi|10175888|dbj|BAB06984.1| formyltetrahydrofolate deformylase [Bacillus halodurans C-125]
          Length = 289

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 173/278 (62%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFIA-- 62
           L I+C     I + I  +L+  G NI+   Q++ D +  + FMR+ F  N     F A  
Sbjct: 11  LLISCHDQPGIVAAISTFLNHHGANIVQSDQYSTDPEGGRFFMRVEFDQNNDSITFEALK 70

Query: 63  -DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F  +  ++ + + +       +  I VS+ DHCL +LL++W+   L  +I  V+SNH 
Sbjct: 71  TAFTDVAAEYKMNWRMEQASRKKRMAIFVSKEDHCLLELLWKWHSNELICDIPLVISNHD 130

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + +VE Y +P+Y++P++++ K E+EQK I ++ + N+++++LARYMQI+S H      
Sbjct: 131 ELRDVVEGYGIPYYHIPVSKERKAEAEQKQIELLHQYNIDVIVLARYMQIISSHFVDTFK 190

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GANPY +A+E GVK+IGATAH+   +LD GPIIEQDV+RV H  +
Sbjct: 191 DKIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHFVTDDLDEGPIIEQDVLRVNHRYS 250

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +      G+N+E  VL +AVN +++ ++ +   KT+VF
Sbjct: 251 VPQLRVAGRNVERVVLARAVNWYLEDKIIVYSNKTVVF 288


>gi|253997643|ref|YP_003049707.1| formyltetrahydrofolate deformylase [Methylotenera mobilis JLW8]
 gi|253984322|gb|ACT49180.1| formyltetrahydrofolate deformylase [Methylotenera mobilis JLW8]
          Length = 284

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFIA 62
           L ITCP  + I + I D+L     NIL   Q  D + +   MR+ + FN        F  
Sbjct: 7   LLITCPDTKGIVAAIADFLLQHNANILHADQHQDAENNLFLMRVEWDFNGFNLDEASFDQ 66

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +  +FS+Q+ ++ ++  T+  I+VSQ DHCL DLL+R   G LA  I  V+SNH  
Sbjct: 67  AFSVVANKFSMQWQLKLSQHKTRVAIMVSQYDHCLADLLHRHKSGELACEIPLVISNHRD 126

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + LV+ Y + F+++ +T+ NK ++E     +    +++L++LARYMQILS     +   
Sbjct: 127 TESLVKFYGIDFHHIQVTKDNKAQAEAAQFKLFADYDIDLIVLARYMQILSPDFVARYPQ 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQ + R++H   +
Sbjct: 187 RIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQGIDRISHRDQV 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL+KAV+ HI+ R+ +   KT++F
Sbjct: 247 EDLIQKGRDLERVVLSKAVSWHIENRILLYANKTVIF 283


>gi|323700667|ref|ZP_08112579.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. ND132]
 gi|323460599|gb|EGB16464.1| formyltetrahydrofolate deformylase [Desulfovibrio desulfuricans
           ND132]
          Length = 293

 Score =  229 bits (584), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 116/286 (40%), Positives = 176/286 (61%), Gaps = 9/286 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF-----NT 55
           S+  L ITCP    I + +  YL  +  NI+   Q + D +  + FMR  F       + 
Sbjct: 7   STVRLLITCPDQPGIVAAVSGYLHRKNANIIHSDQHSTDPEGGRFFMRNEFFLPGLDMDG 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +L     + +   F + +S+       + +IL S+ DH L +LL+RW  G L   +  
Sbjct: 67  LEELRREFAEEVTNGFVMDWSLNPVWVPKRMVILCSKVDHALMELLWRWKRGDLDAEVAM 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTE--QNKIESEQKLINIIEKNNVELMILARYMQILS 173
           V+SNH T ++ VEN+ +PF+++P+    ++K+++E  +I ++    V+L++LARYMQIL+
Sbjct: 127 VISNHPTLQREVENFDVPFHHVPVGPSLRDKVKAEDTMIELM-NGQVDLIVLARYMQILT 185

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                +   RIINIHHSFLP+F GA+PY++AYE GVK+IGATAHY   +LD GPIIEQDV
Sbjct: 186 SDFVKRYPSRIINIHHSFLPAFVGADPYRRAYERGVKLIGATAHYVTEKLDEGPIIEQDV 245

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +RVTH+ T++D   +G +IE  VL +AV  H++ RV ++  KTIVF
Sbjct: 246 IRVTHSHTVDDLKRLGGDIERHVLARAVKWHLEDRVIVDGNKTIVF 291


>gi|89092538|ref|ZP_01165491.1| formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
 gi|89083050|gb|EAR62269.1| formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
          Length = 265

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 169/264 (64%), Gaps = 3/264 (1%)

Query: 19  IIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKLFIADFQPIVQQFSLQY 75
           ++ +++S+ G +I D +Q  D  T   FMR+     T    ++   A F PI Q F++ +
Sbjct: 1   MVSNFISSHGGSISDANQHTDSSTGWFFMRVEINAATLPFSLEELKAAFSPIAQSFNMDW 60

Query: 76  SIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVENYQLPFY 135
           +I ++    K +++ S+  HCL DLLYR++ G L   I  V+SNH   + +VE + +P++
Sbjct: 61  NISDSAVPKKVILMASRESHCLADLLYRYHEGELDCEIPCVISNHDDLRSMVEWHNIPYH 120

Query: 136 YLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSF 195
           ++P+ +++K     ++  +I +N  + ++LARYMQIL   +C +   RIINIHHSFLPSF
Sbjct: 121 HVPVNKEDKQPHFDEVARLIRENKADTVVLARYMQILPSDVCQEYAHRIINIHHSFLPSF 180

Query: 196 KGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAK 255
            GA PY QA+E GVK+IGAT HY   ELDAGPII+QDV+RV+H    E+ + +G+++E  
Sbjct: 181 AGAKPYHQAHERGVKLIGATCHYVTEELDAGPIIDQDVIRVSHRDAPEEMVRLGRDVEKN 240

Query: 256 VLTKAVNAHIQQRVFINKRKTIVF 279
           VL++ +  H++ ++ +   KT+VF
Sbjct: 241 VLSRGLRWHLEDKILVQGNKTVVF 264


>gi|242280412|ref|YP_002992541.1| formyltetrahydrofolate deformylase [Desulfovibrio salexigens DSM
           2638]
 gi|242123306|gb|ACS81002.1| formyltetrahydrofolate deformylase [Desulfovibrio salexigens DSM
           2638]
          Length = 289

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 179/283 (63%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFN---TCM 57
           S+  LT++C     I S +  +L ++  NI+   Q + D    + F+R+ F  N     +
Sbjct: 7   STAYLTVSCKDRPGIVSAVSGFLFSKNANIIHSDQHSSDPVGGRFFLRMKFHMNGIEDGL 66

Query: 58  KLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + F  +F + +  +F ++++I       KT ILVS+ DH L DLL+R     L   I  V
Sbjct: 67  EEFRQEFAEKVADKFDMEWNINPAWIKKKTAILVSKFDHALMDLLWRAKRDELHTEITMV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   +K VE++ +PF+++P+ + NK  SE K++ ++E  N +L+ILARYMQIL+  L
Sbjct: 127 ISNHDDLRKAVESFDVPFHHVPVEKGNKEASENKILELME-GNADLVILARYMQILTPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA+PY++A E GVK+IGATAHY   ELD GPIIEQDV+RV
Sbjct: 186 IDAYPNRIINIHHSFLPAFVGADPYRRAGERGVKLIGATAHYVTEELDQGPIIEQDVIRV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H    E+   +G++IE +VL++AV  H+ +RV ++  KT+VF
Sbjct: 246 SHRHDYEELKVLGRDIERQVLSRAVKWHLTERVLVDGNKTVVF 288


>gi|212639266|ref|YP_002315786.1| formyltetrahydrofolate deformylase [Anoxybacillus flavithermus WK1]
 gi|212560746|gb|ACJ33801.1| Formyltetrahydrofolate hydrolase [Anoxybacillus flavithermus WK1]
          Length = 325

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 178/278 (64%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L I+CP    I + +  +L  +G NI++ SQ++ D +    F+RI F     +   K   
Sbjct: 47  LLISCPDQPGIVAAVTTFLYEKGANIVESSQYSTDPEGGTFFLRIEFDAPNISEREKAIE 106

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F  I QQF +++ +       K  I VS+ +HCL +LL+ W  G L  +   V+SNH 
Sbjct: 107 KEFATIAQQFEMKWRLSLHTHVKKVAIFVSKEEHCLLELLWEWQAGELLADFALVISNHE 166

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++ VE++ +P+Y++P+T++ K E+E+K I ++++++V++++LARYMQILS H      
Sbjct: 167 QMRETVESFGIPYYHIPVTKETKEEAEEKQIQLLKEHDVDVIVLARYMQILSPHFVATFP 226

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GA PY+QAY  GVK+IGAT+HY   +LD GPIIEQDV RV H   
Sbjct: 227 AQIINIHHSFLPAFVGARPYEQAYRRGVKLIGATSHYVTDDLDEGPIIEQDVERVDHKHH 286

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED   IG+ IE  VL +A+  H++ RV I++ KTIVF
Sbjct: 287 VEDLKRIGRMIEKTVLVRALKWHLEDRVIIHENKTIVF 324


>gi|311744951|ref|ZP_07718736.1| formyltetrahydrofolate deformylase [Algoriphagus sp. PR1]
 gi|126577458|gb|EAZ81678.1| formyltetrahydrofolate deformylase [Algoriphagus sp. PR1]
          Length = 284

 Score =  228 bits (582), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 120/287 (41%), Positives = 176/287 (61%), Gaps = 12/287 (4%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+  IL I CP  + I + +  +L +   NIL+I Q  D   S  FMR ++  ++    F
Sbjct: 1   MNKAILLIQCPDQKGIVAEVSRFLYSYQGNILEIDQHVDKGLSLFFMRAAWELDS----F 56

Query: 61  IADFQPIVQQFS--------LQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
             + + I QQF         + + +       K  I VS+  HCL D+L R + G L ++
Sbjct: 57  SLEKEKIAQQFEKEVGAKFKMDFKLHFNFPKPKMAIFVSKLSHCLFDILARHHSGQLEVD 116

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           I  V+SNH   + +VE + +PF+++P+T++NK  SE K + +++++ V+ ++LARYMQIL
Sbjct: 117 IPLVISNHKDLQSVVEAFNIPFHHIPVTKENKSASEAKQLELMQEHQVDFVVLARYMQIL 176

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S    +    RIINIHHSFLP+F GA PY  AYE GVKIIGATAHY   ELDAGPIIEQ+
Sbjct: 177 SGDFINHFPNRIINIHHSFLPAFVGAKPYHAAYERGVKIIGATAHYVTEELDAGPIIEQE 236

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H  TI D + IG+++E  VL+KA+  H+ ++V   + KT++F
Sbjct: 237 VARVRHHNTIPDLVQIGQDVEKVVLSKAIQYHLDRKVLAFRNKTVIF 283


>gi|217969019|ref|YP_002354253.1| formyltetrahydrofolate deformylase [Thauera sp. MZ1T]
 gi|217506346|gb|ACK53357.1| formyltetrahydrofolate deformylase [Thauera sp. MZ1T]
          Length = 291

 Score =  228 bits (581), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 168/284 (59%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDIS-----QFNDLDTSKLFMRISFVFNTC-- 56
           + L+ +CP    I + +  +++     IL+ S          +  + FMRI    ++   
Sbjct: 7   FTLSASCPDRVGIVAKVSGFIAEHRGWILETSLHAEPPLEAGEVGRYFMRIEIKADSLPF 66

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +  F   F+P+ ++  + + I ++    + ++LVS+ +HCL DLL RW    L + I  
Sbjct: 67  HLAEFREKFRPLAEELEMDWKITDSAVKKRVVVLVSKQEHCLYDLLARWQSKELDIEIPC 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH T +  VE + +PF+++P+   NK  +  ++  I E+   + M+LARYMQILS  
Sbjct: 127 VISNHDTFRGFVEWHGIPFHHVPVGTDNKSAAYAEVRRIFEEVRGDTMVLARYMQILSPD 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GRI+NIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R
Sbjct: 187 LCAAYPGRILNIHHSFLPSFVGAKPYHQAYAKGVKLIGATCHYVTADLDQGPIIEQDVIR 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + H+  +ED +  GK+IE  VL + +  H++ RV ++  KTIVF
Sbjct: 247 IDHSDAVEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTIVF 290


>gi|114321248|ref|YP_742931.1| formyltetrahydrofolate deformylase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227642|gb|ABI57441.1| formyltetrahydrofolate deformylase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 289

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 166/279 (59%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMKLF 60
           IL I CP    I + I  +LS  G NI+D+ Q  D++    FMR  +           + 
Sbjct: 10  ILLIHCPDRRGIVAAISRFLSEHGGNIVDLDQHVDVEQGVFFMRAEWELKGFALPADGIA 69

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A  + + + F + + +  + E  +  + VS+  HCL DLL RW  G LA++I  ++SNH
Sbjct: 70  EAFRRQLAEPFEMTWRLHFSDERPRMALFVSRLAHCLYDLLARWQTGELAVDIPLIISNH 129

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E + + +Y+LP+T   K + E++  +++ +  V+  +LARYMQILS    H  
Sbjct: 130 PDLRPVAERFGIDYYHLPVTPDTKAKVERQQNDLLAEYRVDFAVLARYMQILSADFIHAW 189

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   +LDAGPIIEQDV RVTH  
Sbjct: 190 PERIINIHHSFLPAFAGARPYHAAHERGVKIIGATSHYVTEDLDAGPIIEQDVTRVTHRD 249

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + D +  G+++E  VL +AV  H+Q++  + + +T+VF
Sbjct: 250 AVSDLVRKGRDLEQLVLARAVWLHVQRKTLVYQNRTVVF 288


>gi|262374145|ref|ZP_06067422.1| formyltetrahydrofolate deformylase [Acinetobacter junii SH205]
 gi|262311156|gb|EEY92243.1| formyltetrahydrofolate deformylase [Acinetobacter junii SH205]
          Length = 288

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 174/282 (61%), Gaps = 13/282 (4%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN-------TCM 57
           L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +         M
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRKEALM 70

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A+   + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+L   I  V+
Sbjct: 71  QTFAAN---VAERYEMQWKLTFVNELKKVGILVSKVDHALLELLWRHARGSLPCEITQVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +  VEN+ +PF+ +P+ + NK+E+  ++ ++++ N+  L+ILARYMQILS+   
Sbjct: 128 SNHPDLRDAVENFGIPFHVVPVNKDNKVEAYAQINDMMQGND--LLILARYMQILSEDFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 186 AQWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVS 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 246 HDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|115379250|ref|ZP_01466365.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|115363749|gb|EAU62869.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
          Length = 304

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 168/281 (59%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF------VFNTCMK 58
           L ITCP    I S +  +L   G N+ ++ Q++ D    + FMR+ F      V    +K
Sbjct: 26  LLITCPDRPGIVSAVTTFLYHHGANVTELDQYSTDPSGGRFFMRLEFQTPHLDVSRATLK 85

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               D   + Q+F + + +    +  +  +LVS+ DH L DLL+RW  G L +++  V+S
Sbjct: 86  QSFGDV--VGQRFEMDWRLSFAADKPRMGVLVSKHDHALMDLLWRWQRGELRVDLPLVIS 143

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE + + F ++P+      ESE +++ ++E   V+ ++LARYM+ILS     
Sbjct: 144 NHPDLREAVERFGVRFEHVPVEAATHAESEARMLALLE-GQVDFVVLARYMRILSAGFVS 202

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GA+PYKQAYE GVK+IGATAHY   ELD GPIIEQD  RV+H
Sbjct: 203 HYPQRIINIHHSFLPAFVGADPYKQAYERGVKLIGATAHYVTSELDQGPIIEQDTARVSH 262

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              + +   +G+++E +VL +AV  H + R+ ++  KTIVF
Sbjct: 263 RHAVPELRHLGRDLERQVLARAVRWHAEDRIIVDGNKTIVF 303


>gi|291483836|dbj|BAI84911.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 300

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 169/281 (60%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           L ++CP    I S +  +L     NI++ +Q+  D +  + F+RI F    C  +     
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHDANIIESNQYTTDPEGGRFFLRIEF---DCAGIREKKA 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+S
Sbjct: 79  SLQAAFASVAEKFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+     
Sbjct: 139 NHEEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 AHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E    IG+ IE  VL +AV  H++ RV +++ KTIVF
Sbjct: 259 RDNAEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVF 299


>gi|310819480|ref|YP_003951838.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|309392552|gb|ADO70011.1| Formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
          Length = 303

 Score =  228 bits (580), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 112/281 (39%), Positives = 168/281 (59%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF------VFNTCMK 58
           L ITCP    I S +  +L   G N+ ++ Q++ D    + FMR+ F      V    +K
Sbjct: 25  LLITCPDRPGIVSAVTTFLYHHGANVTELDQYSTDPSGGRFFMRLEFQTPHLDVSRATLK 84

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               D   + Q+F + + +    +  +  +LVS+ DH L DLL+RW  G L +++  V+S
Sbjct: 85  QSFGDV--VGQRFEMDWRLSFAADKPRMGVLVSKHDHALMDLLWRWQRGELRVDLPLVIS 142

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE + + F ++P+      ESE +++ ++E   V+ ++LARYM+ILS     
Sbjct: 143 NHPDLREAVERFGVRFEHVPVEAATHAESEARMLALLE-GQVDFVVLARYMRILSAGFVS 201

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GA+PYKQAYE GVK+IGATAHY   ELD GPIIEQD  RV+H
Sbjct: 202 HYPQRIINIHHSFLPAFVGADPYKQAYERGVKLIGATAHYVTSELDQGPIIEQDTARVSH 261

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              + +   +G+++E +VL +AV  H + R+ ++  KTIVF
Sbjct: 262 RHAVPELRHLGRDLERQVLARAVRWHAEDRIIVDGNKTIVF 302


>gi|238490922|ref|XP_002376698.1| formyltetrahydrofolate deformylase, putative [Aspergillus flavus
           NRRL3357]
 gi|220697111|gb|EED53452.1| formyltetrahydrofolate deformylase, putative [Aspergillus flavus
           NRRL3357]
          Length = 239

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 147/216 (68%)

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F+P  +  S+ + +    +  + LI+VS+  HCLNDLL+R + G LA+ I  +VSNH   
Sbjct: 23  FEPTAKSLSMDFQLVPATQKPRVLIMVSKIGHCLNDLLFRTSTGQLAIEIPLIVSNHPDF 82

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L   Y +PF +LP+ +  K + E +++ +I ++N++L++LARYMQ+LS  LC  M+GR
Sbjct: 83  ATLAATYNIPFVHLPVNKDTKPQQEARILELISEHNIDLVVLARYMQVLSPTLCEAMSGR 142

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVRV H  + +
Sbjct: 143 IINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVRVNHGMSPK 202

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 203 ELTHAGSNVESNVLAAAVKYFSERRVLLNGHKTVVF 238


>gi|154685725|ref|YP_001420886.1| formyltetrahydrofolate deformylase [Bacillus amyloliquefaciens
           FZB42]
 gi|154351576|gb|ABS73655.1| YkkE [Bacillus amyloliquefaciens FZB42]
          Length = 300

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 167/281 (59%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F    C  +     
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEF---DCKGIREKKE 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I Q F + +S+    E  +  I VS+  HCL++L++ W  G +   I  V+S
Sbjct: 79  DLQQAFASIAQTFGMTWSLSLASELKRVAIFVSKELHCLHELIWEWQSGNMMAEIAVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K++VE   +PF+Y+   +  + E E++ + ++E+  +++++LARYMQIL+     
Sbjct: 139 NHEEAKEVVEPLNIPFHYMKANKDIRAEVERRQLELLERYKIDVIVLARYMQILTSDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 AHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTDDLDEGPIIEQDIERVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               ED   IG+ IE  VL +AV  H++ RV ++  KTIVF
Sbjct: 259 RDHAEDLKNIGRTIERSVLARAVKWHLEDRVIVHGNKTIVF 299


>gi|88800711|ref|ZP_01116270.1| formyltetrahydrofolate deformylase [Reinekea sp. MED297]
 gi|88776575|gb|EAR07791.1| formyltetrahydrofolate deformylase [Reinekea sp. MED297]
          Length = 276

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 170/277 (61%), Gaps = 7/277 (2%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD---- 63
           ++CP    I + +  +L+    +IL+ +   DL+    FMR     ++    F AD    
Sbjct: 1   MSCPDQVGIVARVSGFLAQYNGSILEANHHADLEQGWFFMRNEIKASSLP--FGADKLAE 58

Query: 64  -FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F PI +  ++ + + +T    + +++ S+  HCL D+L RW+ G LA +I  V+SNH  
Sbjct: 59  TFAPIAKDLNMSFQVTDTGAPKRIVLMCSKDSHCLADILNRWHSGDLACDIPCVISNHED 118

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + LVE + +PF+++P+   NK     ++  +++  + E ++LARYMQIL + LC +   
Sbjct: 119 LRSLVEWHGIPFHHVPVDPNNKQVHFDEVERLVDAADAETVVLARYMQILPESLCQRYRH 178

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLPSF GA PY QA++ GVK+IGAT HY   +LDAGPII+QDVVR+TH   +
Sbjct: 179 RIINIHHSFLPSFIGARPYHQAHDRGVKLIGATCHYVTADLDAGPIIDQDVVRITHRDVV 238

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED + +GK+ E  VL + +  H++ RV ++  KT+VF
Sbjct: 239 EDMVRLGKDCEKTVLARGLRWHLEDRVLVHGNKTVVF 275


>gi|332994739|gb|AEF04794.1| formyltetrahydrofolate deformylase [Alteromonas sp. SN2]
          Length = 284

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 171/284 (60%), Gaps = 11/284 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMR-------ISFVFNT 55
           ++ L I CP    + + +  +L++ G  I++ +   DL T + FMR       I   +++
Sbjct: 4   TFRLVIDCPDQIGLVASVSQFLASHGATIVEANHHTDLQTGRFFMRHEIGADSIGLDYDS 63

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
               F+A+F P+  +F + + + ++ +  +  +L S   HC+ DLL+RW+ G L  +I  
Sbjct: 64  ----FLAEFAPLANEFQMNWKLSDSSKKQRVALLGSVESHCMVDLLHRWHTGELDCDIPC 119

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++ NH   K+  + Y++PF+++      K  +  ++  ++E+  ++L +LAR+MQIL D 
Sbjct: 120 IIGNHPQMKQFADWYKVPFHWVDFKALGKEAAFAQISTLLEEYKIDLTVLARFMQILPDT 179

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R
Sbjct: 180 LCQQLQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++H+ +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 240 ISHSDSAVDMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|298488612|ref|ZP_07006642.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156953|gb|EFH98043.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 283

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F  I ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTLIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|75910432|ref|YP_324728.1| formyltetrahydrofolate deformylase [Anabaena variabilis ATCC 29413]
 gi|75704157|gb|ABA23833.1| formyltetrahydrofolate deformylase [Anabaena variabilis ATCC 29413]
          Length = 284

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 169/277 (61%), Gaps = 4/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIA 62
           L I+CP    + + I +++   G NI+   Q  D        RI +    FN   ++  A
Sbjct: 8   LLISCPDQRGLVAKIANFIYANGGNIIHADQHTDFAAGLFLTRIEWQLEGFNLPREIIGA 67

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  I Q    ++ +  +    +  I VS+ DHCL DL++R     +A++I  ++SNH  
Sbjct: 68  AFNAIAQPLGAKWELHFSDTIPRIAIWVSRQDHCLYDLIWRQRAKEIAVDIPLIISNHPH 127

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K + E + + FY++P+ + NK E E + + +++K  ++L++LA+YMQI+S     K   
Sbjct: 128 LKVVAEQFGIDFYHIPINKDNKTEQEDQQLELLQKYKIDLVVLAKYMQIVSADFITKFP- 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLP+F GANPY +A+E GVK+IGATAHYA  ELDAGPIIEQDVVRV+H   +
Sbjct: 187 QIINIHHSFLPAFVGANPYHRAFERGVKVIGATAHYATPELDAGPIIEQDVVRVSHRDEV 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 247 EDLIRKGKDLERVVLARAVRLHLQNRVLVYGNRTVVF 283


>gi|308173286|ref|YP_003919991.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|307606150|emb|CBI42521.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|328553793|gb|AEB24285.1| formyltetrahydrofolate deformylase [Bacillus amyloliquefaciens
           TA208]
 gi|328911355|gb|AEB62951.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens LL3]
          Length = 300

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 168/281 (59%), Gaps = 10/281 (3%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKL----- 59
           L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F    C  +     
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEF---DCKGIREKKE 78

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I Q F + +S+    E  +  I VS+  HCL++L++ W  G +   I  V+S
Sbjct: 79  DLKQAFALIAQTFGMTWSLSLASELKRVAIFVSKELHCLHELIWEWQSGNMMAEIAVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K++VE   +PF+Y+   +  + E E++ + ++E+  +++++LARYMQIL+     
Sbjct: 139 NHEEAKEVVEPLNIPFHYMKANKDIRAEVERRQLELLEQYEIDVIVLARYMQILTSDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 AHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTDDLDEGPIIEQDIERVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               ED   IG+ IE  VL +AV  H++ RV +++ KTIVF
Sbjct: 259 RDHAEDLKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVF 299


>gi|297539789|ref|YP_003675558.1| formyltetrahydrofolate deformylase [Methylotenera sp. 301]
 gi|297259136|gb|ADI30981.1| formyltetrahydrofolate deformylase [Methylotenera sp. 301]
          Length = 294

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 172/277 (62%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIA 62
           L ITCP ++ I + I D+L     NIL   Q  D + +   MR+ +    FN     F  
Sbjct: 17  LLITCPDSKGIVAAIADFLYQHNANILHADQHQDAENNLFLMRVEWDLAGFNLLPADFEQ 76

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  I ++FS+++ ++ +++  +  I+VSQ DHCL DLL+R   G L  +I  ++SNH  
Sbjct: 77  HFAEIAKRFSMEWQLKLSQKPLRVAIMVSQYDHCLADLLHRHKNGELVCDIPLIISNHKD 136

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L + Y + F+Y+ + + NK E+E +   + ++ +++L++LARYMQILS     +   
Sbjct: 137 TEALAKFYGVDFHYIEVKKDNKPEAEARQFALFDQYDIDLIVLARYMQILSPDFVARYPK 196

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLP+F GA PY +A+E GVK+IGAT HY    LD GPIIEQD+ R++H   +
Sbjct: 197 QIINIHHSFLPAFIGARPYHRAFERGVKLIGATGHYVTEVLDEGPIIEQDIDRISHRDQV 256

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL+KAV  HI+ R+ +   KT++F
Sbjct: 257 EDLIQKGRDLERIVLSKAVRWHIENRILLYANKTVIF 293


>gi|171912269|ref|ZP_02927739.1| formyltetrahydrofolate deformylase [Verrucomicrobium spinosum DSM
           4136]
          Length = 286

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 165/277 (59%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFIA 62
           L I CP    +   +  ++     NILD+ Q  D   +  FMR+ +    F    +   A
Sbjct: 9   LLIHCPDQPGLVHAVTGFIFAHQGNILDLEQHIDPPENLFFMRVEWAVENFTLAKEEISA 68

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F P+ +++ + +++  + E  +  + VS+  HCL DLL R   G L + I  +VSNH  
Sbjct: 69  AFTPLGEKYRMGWTLHFSSERKRVALFVSRESHCLYDLLSRHEAGELPVEIPVIVSNHEL 128

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            +   E + +PF++ PMT   K   E+  I+++ ++ V+ ++LARYMQILS+ L  +   
Sbjct: 129 LRPAAERFGIPFHHFPMTPGTKAAQEKAQIDLLREHRVDTVVLARYMQILSEDLIREFPN 188

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +I+NIHHSFLP+F GA PY QAYE GVKIIGAT+HY    LD GPII QDV+RVTH  ++
Sbjct: 189 QILNIHHSFLPAFVGAKPYHQAYERGVKIIGATSHYVTAALDQGPIIHQDVMRVTHEDSV 248

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            D + +GK++E  VL KA+  H++ +V +   KT+VF
Sbjct: 249 ADLVRLGKDLEKTVLAKALWWHVRDKVLVYHNKTVVF 285


>gi|163787731|ref|ZP_02182178.1| formyltetrahydrofolate deformylase [Flavobacteriales bacterium
           ALC-1]
 gi|159877619|gb|EDP71676.1| formyltetrahydrofolate deformylase [Flavobacteriales bacterium
           ALC-1]
          Length = 284

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 180/284 (63%), Gaps = 6/284 (2%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+   L I C     I + + ++++    NI+ I Q  D + +  FMR+   F       
Sbjct: 1   MNKITLQIHCQDQPNIIASVTNFMANNDGNIVYIDQHVDREQNIFFMRLECEF-MSNSFS 59

Query: 61  IADFQ-----PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
           I +F+      + ++F L++ + + ++  K  + VS+ DHCL D+L R+N G L L I  
Sbjct: 60  IENFKNLFNTTLAEKFKLKWRMYSAEKKPKMALFVSKYDHCLYDILGRYNSGELFLEIPF 119

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   K + +N+++PFY++P+T+  K E+EQ+ + +++ NN++ ++LARYMQI+S  
Sbjct: 120 ILSNHKDLKLIADNFKIPFYHVPVTKDTKDEAEQRQLELLKANNIDFIVLARYMQIVSST 179

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           L  K   +IINIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   ELDAGPIIEQDV  
Sbjct: 180 LIDKYPNKIINIHHSFLPAFVGAKPYHSAYKRGVKIIGATSHYITEELDAGPIIEQDVAH 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H+ +I+D IA G+++E  VL+ A+  H  ++V +   KT++F
Sbjct: 240 VSHSYSIKDLIAKGRDLEKIVLSNAIRLHANRKVMVYNNKTVIF 283


>gi|119900031|ref|YP_935244.1| formyltetrahydrofolate deformylase [Azoarcus sp. BH72]
 gi|119672444|emb|CAL96358.1| Official Name Formyltetrahydrofolate deformylase [Azoarcus sp.
           BH72]
          Length = 291

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 168/284 (59%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-----SKLFMRISFVFNTC-- 56
           Y L+ +CP    I + +  +++     IL+ S   +         + FMRI    ++   
Sbjct: 7   YTLSASCPDRVGIVARVSGFIAEHRGWILETSLHAEPPREGEAIGRYFMRIEIRADSLPF 66

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +  F   F+ I  +  + + I ++    + ++LVS+ +HCL DLL RW    L + I  
Sbjct: 67  HLAEFRERFRVIADELEMDWQINDSAVKRRVVLLVSKQEHCLYDLLARWQSKELDIEIPC 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH T +  VE + +PF+++P+T  NK  +  ++  I E+   + M+LARYMQILS  
Sbjct: 127 VISNHDTFRGFVEWHGIPFHHVPVTSDNKAAAYAEVRRIFEEVRGDTMVLARYMQILSPE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    G+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R
Sbjct: 187 LCAAYPGKIINIHHSFLPSFVGAKPYHQAYAKGVKLIGATCHYVTADLDQGPIIEQDVIR 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + H+ ++ED +  GK+IE  VL + +  H++ RV ++  KTIVF
Sbjct: 247 IDHSDSVEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTIVF 290


>gi|284990624|ref|YP_003409178.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
 gi|284063869|gb|ADB74807.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
          Length = 297

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 169/285 (59%), Gaps = 20/285 (7%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           L + CP    I +++   ++  G NI+D SQ +  D       +   F   ++ F+AD  
Sbjct: 21  LVVRCPDRPGIVAVVSGLMADVGANIID-SQQHSSDP------VGGTFTLRLEFFLADLT 73

Query: 66  PIVQQFS---------LQYSIRNTKEA--TKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
              QQ            Q++ R T+ A   +  + VS+ DH L +LLYR   G L   I 
Sbjct: 74  ARRQQLEGALALLAQQWQFTWRLTEAAHRPRLAVFVSRTDHVLQELLYRVRAGDLRAEIA 133

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH   + +     +PF+++P+T + K E+E + + +I   +V+L++LARYMQI+S 
Sbjct: 134 AVVSNHPDLEPVARGAGVPFHHVPVTPETKAEAEARALELI--GDVDLVVLARYMQIVSA 191

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
             C +   R+INIHHSFLP+F GANPY+ A++ GVK+IGATAHY   ELDAGPIIEQ+V 
Sbjct: 192 DFCSRFPERLINIHHSFLPAFVGANPYRAAHDRGVKLIGATAHYVTPELDAGPIIEQEVA 251

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H  T+ED   IG+ +E +VL +AV  H++ RV ++  KTIVF
Sbjct: 252 RVDHRATVEDMRRIGRYVERQVLAQAVTWHVEDRVIVDGEKTIVF 296


>gi|320333501|ref|YP_004170212.1| formyltetrahydrofolate deformylase [Deinococcus maricopensis DSM
           21211]
 gi|319754790|gb|ADV66547.1| formyltetrahydrofolate deformylase [Deinococcus maricopensis DSM
           21211]
          Length = 298

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 113/279 (40%), Positives = 171/279 (61%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCMKLFI 61
           LTI+C   + I + +  +L   G NI+   Q + D      FMR+ F     +     F 
Sbjct: 21  LTISCADRKGIVAAVSQFLHNHGANIIHSDQHSTDPSGGTFFMRMEFHLEGLDLARGPFE 80

Query: 62  ADFQPIVQQ-FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             FQ +V   F + + +    E  +  ILVS+ DHC  DLL+R   G L ++I  ++SNH
Sbjct: 81  RAFQDVVATPFGMDWHVWYNTEPKRMAILVSKYDHCFLDLLWRHRRGELDVDIPMIISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++  E + +P++ +P+T+ NK E+E + I ++ ++  + ++LARYMQILS      +
Sbjct: 141 EDLRRDAEGFGIPYHVIPVTKANKAEAEAEQIALL-RDRCDFVVLARYMQILSGDFLRGV 199

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
              +INIHHSFLP+F GANPY+ A+  GVK++GATAHY   ELDAGPIIEQDV RVTH +
Sbjct: 200 GVPVINIHHSFLPAFIGANPYRAAWTRGVKLVGATAHYVTEELDAGPIIEQDVARVTHRE 259

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  + +G+++E +VL +AV AH++ RV ++  KT+VF
Sbjct: 260 TPETLMRLGRDVERQVLARAVKAHVEDRVLVHGNKTVVF 298


>gi|138895289|ref|YP_001125742.1| formyltetrahydrofolate deformylase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266802|gb|ABO66997.1| Formyltetrahydrofolate deformylase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 300

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 114/279 (40%), Positives = 173/279 (62%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF----VFNTCMKLF 60
           L I+CP    I + +  +L  QG NI++ SQ++ D +    F+R+ F    +     ++ 
Sbjct: 22  LLISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEFDCPNIAGRKEEIE 81

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F PI ++FS+ + +R   E  +  I VS+ +HCL +LL++W  G L  +I  V+SNH
Sbjct: 82  TA-FAPIAEEFSMTWQLRLHNEIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                +VE   +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS     + 
Sbjct: 141 PDLCDVVEPLGIPYVHIPVTKETKADAEAEQIRLLHDYRIDTIVLARYMQILSPAFVAEF 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLP+F GA PY++AYE GVK+IGA +HY   +LD GPIIEQDV RV H  
Sbjct: 201 PGRIINIHHSFLPAFIGARPYERAYERGVKLIGAPSHYVTDDLDKGPIIEQDVARVDHRH 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 261 HPDNLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|308448538|ref|XP_003087678.1| hypothetical protein CRE_17786 [Caenorhabditis remanei]
 gi|308253636|gb|EFO97588.1| hypothetical protein CRE_17786 [Caenorhabditis remanei]
          Length = 288

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 172/279 (61%), Gaps = 7/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCMKLFI 61
           L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +   +  +  I
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRRESLI 70

Query: 62  ADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             F   + +++S+ + +    +  K  ILVS+ DH L +LL+R + G L   I  VVSNH
Sbjct: 71  QTFATNVAERYSMHWRLALVSDIKKVGILVSKVDHALLELLWRHSRGGLPCEITQVVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VEN+ +PFY +P+ ++NK E+  K+  +++ N+  L++LARYMQIL +    K 
Sbjct: 131 EDLRESVENFGIPFYVVPVNKENKREAYTKIDELMQGND--LLVLARYMQILDEEFVQKW 188

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             ++INIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV H  
Sbjct: 189 EMKVINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVNHDF 248

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T++    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 249 TVDQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|296329631|ref|ZP_06872116.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674028|ref|YP_003865700.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296153129|gb|EFG93993.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412272|gb|ADM37391.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 300

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 167/278 (60%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCM--KLFIA 62
           L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F        K  + 
Sbjct: 22  LLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCEGIREKKETLQ 81

Query: 63  D-FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           D F  + + F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH 
Sbjct: 82  DAFASVAETFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNHE 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LVE   +PF+Y+   +  + E E+K + ++E+  ++ ++LARYMQIL+        
Sbjct: 142 EARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYEIDTIVLARYMQILTPDFVSAHP 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H   
Sbjct: 202 NRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRDN 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E    IG+ IE  VL +AV  H++ RV +++ KTIVF
Sbjct: 262 TEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVF 299


>gi|322383925|ref|ZP_08057655.1| formyltetrahydrofolate deformylase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321151402|gb|EFX44589.1| formyltetrahydrofolate deformylase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 291

 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/278 (39%), Positives = 166/278 (59%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLFI 61
           + I+CP    I + +  +L  QG NI+   Q+  D      F+RI F      +   +  
Sbjct: 15  MLISCPDQPGIVAAVSRFLYEQGANIIQSDQYTMDPSGGMFFIRIEFDLPDLGSRRSVLE 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF     +F +Q+ +    E  +  + VS+ DHCL +LL+ W  G L  +I  V+SNH 
Sbjct: 75  QDFAEAASRFDMQWKLFVASEKKRLALFVSKEDHCLLELLWHWRAGDLDADIAMVISNHP 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++LV  + +P++++P+ +  K E+EQK + +++    ++++LARYMQI+S        
Sbjct: 135 DMEELVLPFGIPYFHVPVIKGKKEEAEQKHLELLD-GKADVIVLARYMQIISPAFIDHYK 193

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F G  PY QA+E GVK+IGATAHY   ELD GPIIEQDV RV+H   
Sbjct: 194 NKIINIHHSFLPAFVGGKPYAQAHERGVKLIGATAHYVTEELDGGPIIEQDVQRVSHRDN 253

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED   IG++IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 254 VEDLKRIGRHIERIVLARAVKWHVEDRILVHGNKTVVF 291


>gi|37523894|ref|NP_927271.1| formyltetrahydrofolate deformylase [Gloeobacter violaceus PCC 7421]
 gi|35214900|dbj|BAC92266.1| formyltetrahydrofolate deformylase [Gloeobacter violaceus PCC 7421]
          Length = 300

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 167/282 (59%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCM--- 57
           ++  L I+CP    I + +   +   G NIL   Q   D      FMR+ F++       
Sbjct: 19  ATRTLLISCPDRRGIVAAVSQCVLEAGGNILRSDQHTTDPLGGIFFMRLEFLYANAPADD 78

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F P+ ++F++ + +  T E  +  + VS+ DHC  DLL+R   G L + I  VV
Sbjct: 79  DGFARCFAPVAERFAMDWRLVRTGEPKRMALFVSRLDHCFVDLLWRRQSGELPVKIPLVV 138

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +   Y LP++YL + + N+   E +++N++E   V+ ++LARYM++LS    
Sbjct: 139 SNHPDLEPVAAQYGLPYHYLAIDKTNQPAREAQMLNLLE-GEVDFIVLARYMRVLSPQFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA+PY++A E GVK+IGATAHY   ELDAGPIIEQDVVRV 
Sbjct: 198 ERYAGRIINIHHSFLPAFVGASPYERACERGVKVIGATAHYVTEELDAGPIIEQDVVRVN 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   + D    G++IE  VL +AV  H++ RV I   +T+VF
Sbjct: 258 HRDQVADLKLKGRDIERVVLARAVKWHVEDRVLIYGNRTVVF 299


>gi|150006331|ref|YP_001301075.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus ATCC 8482]
 gi|254881761|ref|ZP_05254471.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_3_47FAA]
 gi|294776134|ref|ZP_06741625.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus PC510]
 gi|319643728|ref|ZP_07998344.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_40A]
 gi|149934755|gb|ABR41453.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus ATCC 8482]
 gi|254834554|gb|EET14863.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_3_47FAA]
 gi|294450008|gb|EFG18517.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus PC510]
 gi|317384670|gb|EFV65633.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_40A]
          Length = 285

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 175/278 (62%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLFIAD 63
           L + CP    I + + ++++    NI+ + Q+ D   +  FMRI +        K  I D
Sbjct: 7   LLLHCPDQPGILAEVTNFITINKGNIVYLDQYVDHVENIFFMRIEWEIKDFFIPKNKIED 66

Query: 64  FQPIV--QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           +   +  Q++ +++ +  +    K  I VS+  HCL D+L R+  G   + I  ++SNH 
Sbjct: 67  YFETLYAQKYEMKFRLYFSDVKPKMAIFVSKLSHCLFDMLARYTAGEWNVEIPLIISNHP 126

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + + E + +PFY  P+T++NK+E E+  + ++EK+N+  ++LARYMQ++S+ +     
Sbjct: 127 DLQHVAERFGIPFYLFPITKENKMEQEKAEMELLEKHNINFIVLARYMQVISEQMIEAYP 186

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+TH  T
Sbjct: 187 NRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTSELDAGPIIEQDVVRITHKDT 246

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++D ++ GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 247 VQDLVSKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|119484296|ref|ZP_01618913.1| formyltetrahydrofolate deformylase [Lyngbya sp. PCC 8106]
 gi|119457770|gb|EAW38893.1| formyltetrahydrofolate deformylase [Lyngbya sp. PCC 8106]
          Length = 284

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 170/277 (61%), Gaps = 4/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIA 62
           + ++CP  + + + I +++ + G NI+   Q  D  +     RI +    FN   ++   
Sbjct: 8   ILLSCPDQQGLVAKIANFIYSNGGNIIHADQHTDFASGVFLTRIEWQLEGFNLPREVINP 67

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  I +  +  + +  + +  +  I +++ DHCL DLL+RW    +A+ I  ++SNHT 
Sbjct: 68  AFGAIAKPLAANWQLHFSDKIPRIAIWITKQDHCLLDLLWRWQAKEMAVEIPVIISNHTD 127

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K L E + + FY++P+T+ NK E E K + I+++  ++L++LA+YMQILS     +   
Sbjct: 128 LKSLAEQFGIDFYHIPITKTNKKEQEIKQLEILKQYQIDLVVLAKYMQILSSTFVAQFPN 187

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
            IINIHHSFLP+F GANPY++AY  GVKIIGATAHY   +LD GPIIEQDVVRV+H   I
Sbjct: 188 -IINIHHSFLPAFPGANPYQRAYTRGVKIIGATAHYVTEDLDEGPIIEQDVVRVSHRDAI 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 247 ADLIRKGKDLERLVLARAVRLHLQNRVLVYNNRTVVF 283


>gi|159489056|ref|XP_001702513.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158280535|gb|EDP06292.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 289

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/280 (39%), Positives = 167/280 (59%), Gaps = 12/280 (4%)

Query: 9   TCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---------TCMKL 59
           +CP  + + + +   L   GCNI+   QF D  +   F RI+F F+           ++ 
Sbjct: 11  SCPDQKGVIAAVSQLLYGFGCNIVASDQFTDSSSGMFFQRITFDFSEIVIGPGNTAVLER 70

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            IA+   +  +F++++ I    +  +  +LVS+ DHCL DLL R   G L   I  ++SN
Sbjct: 71  AIAE---LANRFNMKWKIAYKNKVKRMAVLVSKQDHCLYDLLIRLRSGELRCEIPFIISN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + + + +PF +LP+ + NK   E+ L  +I++  ++++ILARYMQI +   C +
Sbjct: 128 HPDLKHIADTFNVPFVHLPLDKNNKEAQEEALEKLIKEEKIDVVILARYMQIFTQGFCER 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
                INIHHSFLP+F+GA PY +A+E GVKIIGATAH+A  ELDAGPII+Q V R+TH 
Sbjct: 188 HWEHTINIHHSFLPAFEGARPYHRAHERGVKIIGATAHFATAELDAGPIIDQAVARITHR 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +ED I  G+++E  VL +AV  H+  RV +   KT+VF
Sbjct: 248 DNVEDMIRKGRDLERMVLARAVRWHLDDRVMVYNNKTVVF 287


>gi|262280876|ref|ZP_06058659.1| formyltetrahydrofolate deformylase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257776|gb|EEY76511.1| formyltetrahydrofolate deformylase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 287

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 115/282 (40%), Positives = 174/282 (61%), Gaps = 13/282 (4%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN-------TCM 57
           L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +         +
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRKDALI 70

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A+   + +++S+Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V+
Sbjct: 71  QTFAAN---VAERYSMQWRLAFVGDVKKVGILVSKVDHALLELLWRHARGSLPCEITHVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VEN+ +PF  + +T+ NK+E+  ++  +++ N+  L++LARYMQILS+   
Sbjct: 128 SNHEDLRESVENFGIPFSVIKVTKDNKVEAYAQIDEMMQGND--LLVLARYMQILSEDFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 186 AKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVS 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 246 HDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|262375010|ref|ZP_06068244.1| formyltetrahydrofolate deformylase [Acinetobacter lwoffii SH145]
 gi|262310023|gb|EEY91152.1| formyltetrahydrofolate deformylase [Acinetobacter lwoffii SH145]
          Length = 288

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 171/282 (60%), Gaps = 13/282 (4%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN-------TCM 57
           L ITC     I   +  +L  QG NI  + Q+       + FMR+ F  +       +  
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATAAQGGRYFMRVEFELDNLQSRKESIT 70

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F A+   + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G L   I  VV
Sbjct: 71  QTFAAN---VAERYGMQWRLALVSDVKKVGILVSKVDHALLELLWRHARGGLPCEITKVV 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH T ++ VEN+ +PF  +P+T+ NK E+  ++  +++ N+  L++LARYMQIL +   
Sbjct: 128 SNHETLREAVENFGIPFEVVPVTKDNKPEAYAEIDQLMQGND--LLVLARYMQILDEEFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV 
Sbjct: 186 SKWEMKVINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVN 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 246 HDFTVEQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|317152712|ref|YP_004120760.1| formyltetrahydrofolate deformylase [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942963|gb|ADU62014.1| formyltetrahydrofolate deformylase [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 293

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 179/287 (62%), Gaps = 9/287 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC---- 56
           S+  L ITCP    I + +  +L  +  NI+  +Q + D +  + FMR  F         
Sbjct: 7   STVRLLITCPDQPGIVAAVSGFLHRKNANIIHSNQHSTDPEGGRFFMRNEFYLPGLDLDG 66

Query: 57  MKLFIADFQPIVQQ-FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
           +K   A+F   V   F + +S+    E  K +IL S+ DH L +LL+RW  G L  ++  
Sbjct: 67  LKQLRAEFAGQVSNGFIMDWSLNPVWEPKKMVILCSRVDHALMELLWRWKRGDLETDVSM 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM--TEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           V+SNH   +  VE++ +PF+++P+  T ++K+ +E  +++++E    +L++LARYMQIL+
Sbjct: 127 VISNHPHLRGSVEHFGVPFHHVPVGPTLRDKVGAEDTMMDLME-GQADLIVLARYMQILT 185

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                +   +IINIHHSFLP+F GA+PY++A++ GVK+IGATAHY   ELD GPIIEQDV
Sbjct: 186 QDFVARFNRQIINIHHSFLPAFVGADPYRKAHQRGVKLIGATAHYVTQELDEGPIIEQDV 245

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +RVTH+  ++D   +G +IE  VL +AV  H++ RV ++  KTIVFP
Sbjct: 246 IRVTHSHDLDDLKRLGADIERHVLARAVKWHLEDRVIVDGNKTIVFP 292


>gi|284043157|ref|YP_003393497.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
 gi|283947378|gb|ADB50122.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
          Length = 295

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 111/279 (39%), Positives = 172/279 (61%), Gaps = 7/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC----MKLF 60
           L I+C     I + +  +L   G NILD  Q   D +    FMR+ F  +       +L 
Sbjct: 19  LLISCSDQPGIVAAVSRFLFEHGANILDADQHTTDPEGGVFFMRMEFQLDGLDLGRGELE 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A    + + F + + +       +  +LVS+ +HCL DLL+RW  G L  ++  VVSNH
Sbjct: 79  QAFGATVGEPFGMDWRLSYANRRKRVALLVSREEHCLLDLLWRWRSGDLDADVGLVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VE++ +PF ++P+ +++K ++E +++  +     +L++LARYMQILS      +
Sbjct: 139 RDAERDVESFGVPFLHVPVAKESKPQAEAEILRHL--RGFDLVVLARYMQILSGDFLAAL 196

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
              +INIHHSFLP+F GA+PY++A E GVKIIGATAHY   ELDAGPIIEQDV RV+H  
Sbjct: 197 DTPMINIHHSFLPAFAGADPYRRASERGVKIIGATAHYVTEELDAGPIIEQDVARVSHRD 256

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++E+ + IG++IE  VL +AV+ H+  RV +++ +T+VF
Sbjct: 257 SLEELVRIGRDIERIVLARAVSRHLADRVLVHENRTVVF 295


>gi|239905843|ref|YP_002952582.1| formyltetrahydrofolate deformylase [Desulfovibrio magneticus RS-1]
 gi|239795707|dbj|BAH74696.1| formyltetrahydrofolate deformylase [Desulfovibrio magneticus RS-1]
          Length = 285

 Score =  225 bits (574), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 167/279 (59%), Gaps = 6/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L ITCP    I S +  +L T G NI+D+ Q + D +    FMR+ F     +       
Sbjct: 7   LRITCPDRPGIVSAVTTFLYTHGANIIDLDQHSTDPEGGTFFMRLEFYTPYIDVSRAALE 66

Query: 62  ADFQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F  +V  +F + + +  +    +  +LVS+ DHCL +LL+R+    L  +I  V+ NH
Sbjct: 67  AAFGEVVGNRFDMDWRLSYSDVPKRVAVLVSRHDHCLMELLWRYARKELPCDIAMVIGNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++ VE + +P++ +P+ +    E+E ++  ++    V+L++LARYM+++S       
Sbjct: 127 EDPREAVEGFGVPYHCVPVGDGGMPEAEARMAELL-GTGVDLLVLARYMRVVSGDFLRPY 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             R+INIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELDAGPIIEQD  RVTH  
Sbjct: 186 DNRVINIHHSFLPAFVGADPYRQAHEKGVKLIGATAHYVTAELDAGPIIEQDTARVTHRH 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ D  A+G  +E  VL +AV  H++ RV +   KT+VF
Sbjct: 246 SVADLKAMGSELERTVLARAVTWHLEDRVIVFGNKTVVF 284


>gi|88811138|ref|ZP_01126394.1| formyltetrahydrofolate deformylase [Nitrococcus mobilis Nb-231]
 gi|88791677|gb|EAR22788.1| formyltetrahydrofolate deformylase [Nitrococcus mobilis Nb-231]
          Length = 290

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 168/279 (60%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFI 61
           IL + C   + + + I ++++    NI+ + Q  D      FMR+ +    F   ++   
Sbjct: 11  ILLMHCADQQGLVAAISEFIARNEGNIVYLDQHVDERRGIFFMRVEWELARFRVAVEAID 70

Query: 62  ADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             F + I Q+F + +++  + E  +  I+VS+  HCL DLL RW  G   + I  ++SNH
Sbjct: 71  KAFDEAIGQRFGMHWTLSFSDEVPRIAIMVSRLPHCLYDLLSRWQSGEWRVEIPVLISNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                + E + LP++ LP+T +NK   EQ+L+ ++    V+L++LARYMQIL   L    
Sbjct: 131 EDLGDVAEQFGLPYHVLPVTPENKAHQEQRLLELLRAQRVDLIVLARYMQILGPQLIANY 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GA PY  A+  GVKIIGAT+HYA  ELDAGPII QDVV +TH  
Sbjct: 191 PNRIINIHHSFLPAFPGARPYHNAHARGVKIIGATSHYATAELDAGPIIAQDVVHITHRD 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +E+ I  G+++E  VL +AV AHIQ++V   + +T++F
Sbjct: 251 PVEELIRKGRDLEKLVLARAVWAHIQRKVLCYENRTVIF 289


>gi|90410224|ref|ZP_01218241.1| formyltetrahydrofolate deformylase [Photobacterium profundum 3TCK]
 gi|90329577|gb|EAS45834.1| formyltetrahydrofolate deformylase [Photobacterium profundum 3TCK]
          Length = 290

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/281 (38%), Positives = 165/281 (58%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--- 59
           +YILT +CP       ++  +L   GC I +++ F+D    + F+R  F       L   
Sbjct: 7   TYILTASCPGRSGTVDVVTRFLREFGCYISELNSFDDALNQRFFIRTVFRMEDNASLDQP 66

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A F    ++F +++ +  +    K +I+VS+ +HCLNDLLYR+  G L ++I  V+S
Sbjct: 67  VFCATFAERAEEFDMEWELTPSDYRPKVVIMVSKYEHCLNDLLYRFRTGNLPVDIRAVIS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L E + +P+Y+ P+T   K + E ++  ++ +   EL++LARYMQ+LS  +C 
Sbjct: 127 NHPDLQSLAEWHDIPYYHFPITADTKPQQEAQVQAVLAETGCELLVLARYMQVLSHEMCV 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   + INIHHS LP FKGA PY QAY  GVK++GATAHY    LD GPII Q +  V H
Sbjct: 187 RWARKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYVSDFLDEGPIITQGMETVNH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                D    G ++E+  LT+A+  HI++R+F+   KT+VF
Sbjct: 247 TYYPADLARKGMDVESLTLTRAIQYHIEKRIFLFNDKTVVF 287


>gi|81299817|ref|YP_400025.1| formyltetrahydrofolate deformylase [Synechococcus elongatus PCC
           7942]
 gi|81168698|gb|ABB57038.1| formyltetrahydrofolate deformylase [Synechococcus elongatus PCC
           7942]
          Length = 284

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 166/281 (59%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           ++  L I+CP  + + + I +++   G NI+D  Q  D +      RI +    FN   +
Sbjct: 4   ATATLLISCPDQQGLVARISNFIFANGGNIIDADQHTDFEAGLFLSRIEWELTGFNLDRE 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           L    F+ I +    Q+ +  +    +  + VS+ DHCL DLL+R   G L   I  ++S
Sbjct: 64  LIGPAFEAIARPLGAQWQLHFSDRKPRLSLWVSKQDHCLLDLLWRQQAGELDAEIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E + + F +LP+T + K E E + +  I    ++L++LA+YMQ+LS     
Sbjct: 124 NHDKLRPIAEQFGIDFLHLPITRETKAEQEARQLAAIADYGIDLVVLAKYMQVLSSEFLA 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   ++INIHHSFLP+F GANPY++AYE GVKIIGATAHY   +LD GPIIEQDVVRV+H
Sbjct: 184 QFP-QVINIHHSFLPAFAGANPYQRAYERGVKIIGATAHYVTPDLDEGPIIEQDVVRVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D +  GK++E  VL +AV  H+Q RV   + +T+VF
Sbjct: 243 RDDADDLVRKGKDLERIVLARAVRLHLQHRVLTYRNRTVVF 283


>gi|332290780|ref|YP_004429389.1| formyltetrahydrofolate deformylase [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332168866|gb|AEE18121.1| formyltetrahydrofolate deformylase [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 284

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---M 57
           M+   L I C   + I + + +++   G N   I Q  D   +  FMR+   F      +
Sbjct: 1   MAHLTLLIHCKDQKGIIASVTNFILDHGGNTTYIDQHVDAQENVFFMRLECFFEQADFNV 60

Query: 58  KLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +LF   F Q I   F +Q+ +    +  +  I VS+ DHCL D+L R+N G L ++I  +
Sbjct: 61  ELFTKTFAQDIGNPFEMQWQLYPATQKLQMAIFVSKYDHCLYDILGRYNAGELQVHIPFI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     +  N+ +PFY++P+T+  K  +EQ+ ++++ +  V+ ++LARYMQI++  +
Sbjct: 121 VSNHKDLAHIAANFGIPFYHIPVTKDTKALAEQRQLDLLREFKVDFIVLARYMQIVTPTI 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             + T RIINIHHSFLP+F GA PY  A+  GVKIIG T+HY   ELDAGPIIEQD +RV
Sbjct: 181 ISEYTHRIINIHHSFLPAFVGAKPYHAAFARGVKIIGTTSHYVTEELDAGPIIEQDTIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH+ TI D IA GK++E  VL++A+  H Q + F+   KT++F
Sbjct: 241 THSHTIPDLIAKGKDLEKIVLSRAIKLHAQHKCFVYDNKTVIF 283


>gi|319652410|ref|ZP_08006526.1| YkkE protein [Bacillus sp. 2_A_57_CT2]
 gi|317395872|gb|EFV76594.1| YkkE protein [Bacillus sp. 2_A_57_CT2]
          Length = 299

 Score =  224 bits (572), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 174/278 (62%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCMKLFI 61
           L I CP    I + +  +L     NI++ SQ++ + +    F+RI F      +  +   
Sbjct: 22  LLINCPDQPGIVAAVSKFLFQHDANIIESSQYSTNPEGGTFFIRIEFECPGLQSKEEELK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           + F+ I + FS+++ +    E  KT I VS+  HCL +LL+ W  G L  +I  +VSNH 
Sbjct: 82  SQFKEIAETFSMEWKLAFVYELKKTAIFVSKELHCLRELLWEWQSGDLLTDIALIVSNHE 141

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++ E+  +PF Y+P +++N++E E++ + ++++ +++L+ILARYMQIL+        
Sbjct: 142 EAREIAESLHIPFSYIPASKENRVEVEERQLQLLKEFDIDLIILARYMQILTPAFVGAHP 201

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            +IINIHHSFLP+F GA PY +A++ GVKIIGAT+HY   +LD GPIIEQD+ RV H   
Sbjct: 202 FKIINIHHSFLPAFVGARPYDRAHQRGVKIIGATSHYVTNDLDEGPIIEQDIKRVDHRDH 261

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           I+D    G++IE  VL +AV  H++ R+ +++ KTIVF
Sbjct: 262 IDDLKKSGRSIERSVLARAVKWHLEDRIIVHENKTIVF 299


>gi|319951967|ref|YP_004163234.1| formyltetrahydrofolate deformylase [Cellulophaga algicola DSM
           14237]
 gi|319420627|gb|ADV47736.1| formyltetrahydrofolate deformylase [Cellulophaga algicola DSM
           14237]
          Length = 283

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 179/283 (63%), Gaps = 5/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKL 59
           M + IL I CP    I   +  ++  QG NI+ + Q  D  + +LFMRI   F +T + +
Sbjct: 1   MKTTIL-IHCPDQSGIICTVTGFVHAQGGNIIYLDQHVDKASGELFMRIESEFLDTKLSV 59

Query: 60  --FIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F + F+  +  +F +++SI   +   +  + VS+ +HCL DLL R+N G LA++I  +
Sbjct: 60  HHFKSKFEEQLTAKFKIKWSIHTDETKPRMGLFVSKYNHCLYDLLSRFNSGELAVDIPFI 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + + + +PFY++P+T+  K E+E K + ++EK  ++ ++LARYMQI++  +
Sbjct: 120 ISNHNDLEFVAKQFDIPFYHIPVTKATKAEAENKQLELLEKYKIDFIVLARYMQIVTSKI 179

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 +IINIHHSFLP+F GA PY  A++ GVKIIGAT HY   ELDAGPII QD   V
Sbjct: 180 IDHYPNKIINIHHSFLPAFAGAKPYHAAFKRGVKIIGATGHYVTEELDAGPIIAQDTTTV 239

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  +I+D IA G+++E  VL++AV  HIQ++  +   KTI+F
Sbjct: 240 SHTNSIDDLIAKGRDLEKIVLSRAVKLHIQRKTMVYNNKTIIF 282


>gi|239994687|ref|ZP_04715211.1| formyltetrahydrofolate deformylase [Alteromonas macleodii ATCC
           27126]
          Length = 284

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 169/281 (60%), Gaps = 5/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--- 59
           ++ L I CP    + + +  +L+     I++ S   DL T + FMR     ++ +KL   
Sbjct: 4   TFRLVIDCPDQIGLVASVSQFLADHNATIVEASHHTDLQTGRFFMRHEISTDS-LKLDHQ 62

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ +F P+  ++ + + + ++ +  +  +L S   HCL DLL+RW+ G L  +I  ++ 
Sbjct: 63  SFVKEFTPLANEYQMNWKLSDSSKKQRVALLASLESHCLVDLLHRWHTGELHCDIPVIIG 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + Y++PF+++      K  +  ++  ++++  ++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWYKVPFHWVDFKALGKEAAFAQITTLLQEYKIDLTVLARFMQILPDTLCQ 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R++H
Sbjct: 183 ELQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAADMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|332304939|ref|YP_004432790.1| formyltetrahydrofolate deformylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172268|gb|AEE21522.1| formyltetrahydrofolate deformylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 284

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 166/277 (59%), Gaps = 3/277 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKLFIA 62
           L I CP    + + +  +L+     I++ S   DL T + FMR     N+    ++    
Sbjct: 7   LVIDCPDQVGLVASVSQFLAQHNATIVEASHHTDLQTGRFFMRHEICTNSLTMDIEQIRL 66

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F PI  ++S+ + + ++ +  +  +L S   HCL DLL+RW+   L   I  +++NH  
Sbjct: 67  AFTPIADKYSMNWKLVDSNKKPRMALLASHESHCLMDLLHRWHSKELNCEIPCIIANHPQ 126

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K+  + + +PF+++      K  +  ++  ++++ N++L +LAR+MQIL D LC ++ G
Sbjct: 127 MKQFADWHSIPFHWIDFKTLGKEAAFAQISQLLKQYNIDLTVLARFMQILPDSLCKELAG 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ+V+R++H+ + 
Sbjct: 187 RAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTSDLDEGPIIEQEVMRISHSDSA 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +D +  GKN E   L   V  H++ RV I++ KT+VF
Sbjct: 247 QDMVRKGKNCEKTALANGVRYHLEDRVIIHRSKTVVF 283


>gi|330898039|gb|EGH29458.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 237

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 101/230 (43%), Positives = 147/230 (63%), Gaps = 4/230 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKL 59
           +IL I+CP+   I + +  YL+   C I +++QF+D  +   F+R  F FN      ++ 
Sbjct: 8   FILKISCPATSGIVAAVTSYLAGNRCYIGEMAQFDDEYSGTFFIRAVFRFNDGHEGDIQQ 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +VSN
Sbjct: 68  LKAGFDAVANDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+T + K   E  L+ ++++   EL++LARYMQILSD LC +
Sbjct: 128 HLDLRPMAEREGIRFIYLPVTRETKAAQEAALMKVVDETGTELVVLARYMQILSDDLCQQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPII 229
           + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPII
Sbjct: 188 LAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPII 237


>gi|56964545|ref|YP_176276.1| formyltetrahydrofolate deformylase [Bacillus clausii KSM-K16]
 gi|56910788|dbj|BAD65315.1| formyltetrahydrofolate hydrolase [Bacillus clausii KSM-K16]
          Length = 287

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 116/282 (41%), Positives = 166/282 (58%), Gaps = 12/282 (4%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFIADF 64
           L ++C     + + I  +L     NI+   Q++ D +    FMRI F +      F    
Sbjct: 10  LLVSCQDRPGVVANISSFLYNHEANIVQSDQYSTDPEGGMFFMRIEFAWQEEKTAF---- 65

Query: 65  QPIVQQFSL-------QYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             I Q FS+       Q+ +       +  I VS+ +HCL++LL++W  G L   I  V+
Sbjct: 66  SEIKQAFSVLADAEHYQWRMEQASRKKRMAIFVSKENHCLSELLWKWRAGELYAEIPLVI 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH  +K+ VE Y +PF+++P T+ N+ E+E K I ++ ++N+EL++LARYMQILS    
Sbjct: 126 SNHPDNKEEVEAYGIPFFHIPSTKANRREAEDKAIELLHEHNIELIVLARYMQILSPTFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                +IINIHHSFLP+F GANPY +A+E GVK+IGATAHY   +LD GPIIEQDV+RV 
Sbjct: 186 STFPQQIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHYVTDDLDEGPIIEQDVLRVN 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D    G+ IE   L +AVN H+  ++ +   KTIVF
Sbjct: 246 HRHTTADLRIAGRQIERIALARAVNWHLNDQLIVYNNKTIVF 287


>gi|255321188|ref|ZP_05362354.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SK82]
 gi|262380126|ref|ZP_06073281.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SH164]
 gi|255301742|gb|EET80993.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SK82]
 gi|262298320|gb|EEY86234.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SH164]
          Length = 288

 Score =  224 bits (572), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 169/279 (60%), Gaps = 7/279 (2%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCMKLFI 61
           L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F      T  +  I
Sbjct: 11  LLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELEHLQTRKETLI 70

Query: 62  ADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             F   + Q++ + + +    +  K  ILVS+ DH L +LL+R   G L   I  VVSNH
Sbjct: 71  QTFAVNVAQRYDMHWRLAFVSDVKKVGILVSKVDHALLELLWRHARGALPCEITKVVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T +  VEN+ +PF  +P+ ++NK E+  K+  +++ N+  L++LARYMQIL +    K 
Sbjct: 131 ETLRSAVENFGIPFEVVPVNKENKREAYAKIDELMQGND--LLVLARYMQILDEEFVSKW 188

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GANPY+QAY+ GVK+IGATAHY   +LD GPIIEQDV RV+H  
Sbjct: 189 EMKIINIHHSFLPAFVGANPYQQAYDKGVKLIGATAHYVTADLDQGPIIEQDVERVSHDF 248

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T+E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 249 TVEQLRELGQDVERHVLARAVRWHLEDRIIVDGNKTVVF 287


>gi|332139883|ref|YP_004425621.1| formyltetrahydrofolate deformylase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327549905|gb|AEA96623.1| formyltetrahydrofolate deformylase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 284

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 169/281 (60%), Gaps = 5/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--- 59
           ++ L I CP    + + +  +L+     I++ +   DL T + FMR     ++ +KL   
Sbjct: 4   TFRLVIDCPDQIGLVASVSQFLADHNATIVEANHHTDLQTGRFFMRHEISTDS-LKLDHQ 62

Query: 60  -FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ +F P+  ++ + + + ++ +  +  +L S   HCL DLL+RW+ G L  +I  ++ 
Sbjct: 63  SFVKEFTPLANEYQMNWKLSDSNKKQRVALLASLESHCLVDLLHRWHTGELHCDIPVIIG 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + Y++PF+++      K  +  ++  ++E+  ++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWYKVPFHWVDFKALGKEAAFAQISTLLEEYKIDLTVLARFMQILPDSLCQ 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R++H
Sbjct: 183 QLQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAADMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|52079809|ref|YP_078600.1| formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|52785179|ref|YP_091008.1| formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|319646381|ref|ZP_08000611.1| YkkE protein [Bacillus sp. BT1B_CT2]
 gi|52003020|gb|AAU22962.1| Formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|52347681|gb|AAU40315.1| YkkE [Bacillus licheniformis ATCC 14580]
 gi|317392131|gb|EFV72928.1| YkkE protein [Bacillus sp. BT1B_CT2]
          Length = 300

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/278 (39%), Positives = 165/278 (59%), Gaps = 4/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTC---MKLFI 61
           L ++CP    I + +  +L   G NI++ +Q+  D +  + F+RI F        ++   
Sbjct: 22  LLVSCPDQPGIVAAVSSFLFENGANIIESNQYTTDPEGGRFFLRIEFEVQGIREKIEQMK 81

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121