PSIBLAST alignment of GI: 254780911 and protein with PDB id: 1cdd

>gi|809280|pdb|1CDD|A Chain A, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212
>gi|809281|pdb|1CDD|B Chain B, Structures Of Apo And Complexed Escherichia Coli Glycinamide Ribonucleotide Transformylase Length = 212
 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 3/194 (1%)

Query: 84  TKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKKLVE--NYQLPFYYLPMTE 141
              ++L+S     L  ++       +   +  V SN      L       +  + L  + 
Sbjct: 1   MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAGIATHTLIASA 60

Query: 142 -QNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANP 200
             ++   +++LI+ I+    ++++LA +M+ILS        GR++NIH S LP + G + 
Sbjct: 61  FDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHYAGRLLNIHPSLLPKYPGLHT 120

Query: 201 YKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKA 260
           ++QA E G +  G + H+   ELD GP+I Q  V V    + +D  A  +  E  +    
Sbjct: 121 HRQALENGDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDITARVQTQEHAIYPLV 180

Query: 261 VNAHIQQRVFINKR 274
           ++     R+ +++ 
Sbjct: 181 ISWFADGRLKMHEN 194