PSIBLAST alignment of GI: 254780911 and protein with PDB id: 2bln

>gi|66361563|pdb|2BLN|A Chain A, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305
>gi|66361564|pdb|2BLN|B Chain B, N-Terminal Formyltransferase Domain Of Arna In Complex With N-5-Formyltetrahydrofolate And Ump Length = 305
 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 42/116 (36%)

Query: 155 IEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGA 214
           I + + +++    Y  ++ D +         N+H S LP ++G  P       G    G 
Sbjct: 71  IAQLSPDVIFSFYYRHLIYDEILQLAPAGAFNLHGSLLPKYRGRAPLNWVLVNGETETGV 130

Query: 215 TAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVF 270
           T H  +   DAG I+ Q  + +              +   ++L + + A     + 
Sbjct: 131 TLHRMVKRADAGAIVAQLRIAIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNIL 186