BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate
deformylase [Candidatus Liberibacter asiaticus str. psy62]
         (288 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|296270507|ref|YP_003653139.1| formyltetrahydrofolate deformylase [Thermobispora bispora DSM
           43833]
 gi|296093294|gb|ADG89246.1| formyltetrahydrofolate deformylase [Thermobispora bispora DSM
           43833]
          Length = 282

 Score =  327 bits (838), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 184/280 (65%), Gaps = 1/280 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           MS  Y+LT++CP    + + +   L+ + CNI +  QF D D  + FMR+ F  +  +  
Sbjct: 1   MSAEYVLTLSCPDRPGVVAAVSGLLAERDCNITESQQFGDPDAQRFFMRVQFATDLGIDE 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             + F  +  +F +++ + +    T+ L+LVS+  HCLNDLLYR   G L + IV VVSN
Sbjct: 61  LRSAFAALAPEFGMEFELFDRSVKTRVLVLVSKLGHCLNDLLYRVRSGLLPIEIVAVVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L ++Y + +++LP+T + K + E +++ ++E    +L++LARYMQILS+ +C+K
Sbjct: 121 HPDLRPLTQSYGIDYHHLPVTPETKPKQEAEILALVEHYRADLVVLARYMQILSEDMCNK 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 181 LAGRMINIHHSFLPSFKGARPYHQAYARGVKLIGATAHYVTADLDEGPIIEQEVARVNHT 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED  AIG+++E + L +AV  H + RV ++  KTI+F
Sbjct: 241 HTPEDLAAIGRDLECQALARAVRWHAEHRVLLDGNKTIIF 280


>gi|269796086|ref|YP_003315541.1| formyltetrahydrofolate deformylase [Sanguibacter keddieii DSM
           10542]
 gi|269098271|gb|ACZ22707.1| formyltetrahydrofolate deformylase [Sanguibacter keddieii DSM
           10542]
          Length = 302

 Score =  315 bits (808), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 120/277 (43%), Positives = 178/277 (64%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
            ++LT++CP    I   +   L+  G NI +  QF D +T   FMR+        +   A
Sbjct: 25  HWVLTLSCPDRAGIVHAVAGALAEHGGNITESQQFGDPETQLFFMRVQVESTASREELDA 84

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               + + FS+ + +       +TL+LVS   HCLNDLL+R     L ++IVGVV NH  
Sbjct: 85  AIGALAETFSMTWRLDVVGRPVRTLVLVSTAAHCLNDLLFRQRSENLPIDIVGVVGNHRD 144

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L E Y   F+++P+T+  K E+E +L+ ++ + +VEL++LARYMQILSD LC  + G
Sbjct: 145 LEPLTEFYGKEFHHIPVTKDTKAEAEARLLALVRELDVELVVLARYMQILSDDLCRDLEG 204

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           ++INIHHSFLPSFKGA PY QA++ GVK+IGAT+H+   +LD GPIIEQDV RV H + +
Sbjct: 205 QVINIHHSFLPSFKGAKPYHQAHDRGVKLIGATSHFVTGDLDEGPIIEQDVERVDHTRKV 264

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +A+G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 265 EDLVALGQDVERRVLARAVRWHAEHRVLLNGHRTVIF 301


>gi|271968574|ref|YP_003342770.1| formyltetrahydrofolate deformylase [Streptosporangium roseum DSM
           43021]
 gi|270511749|gb|ACZ90027.1| formyltetrahydrofolate deformylase [Streptosporangium roseum DSM
           43021]
          Length = 284

 Score =  315 bits (807), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 175/279 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + Y+LT++CP    + + +   L+ QGCNI++  QF D    + FMR+ F          
Sbjct: 5   AQYVLTLSCPDRPGVVAAVSGLLAEQGCNIIESQQFGDPVAERFFMRVQFSCPLSDAELR 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                +   F +   +R+     + L++VS+  HCLNDLLYR   G L + IV V SNH 
Sbjct: 65  TAIAALAPDFGMDVRLRDLAVKPRVLVMVSKFGHCLNDLLYRTRSGLLDIEIVAVASNHP 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L ++Y + +++LP+T   K   E +++++++    +L++LARYMQ+LS+ LC K+ 
Sbjct: 125 DMRPLTQSYGIDYHHLPVTSATKSRQEAEILSLVDHYEADLVVLARYMQVLSEDLCVKLA 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  +
Sbjct: 185 GNVINIHHSFLPSFKGAKPYHQAHSRGVKLIGATAHYVTADLDEGPIIEQEVARVNHTHS 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            ED  AIG+++E + L +AV  H +QRV ++  KTIVFP
Sbjct: 245 AEDLAAIGRDVECQALARAVRWHTEQRVLLDGHKTIVFP 283


>gi|320009236|gb|ADW04086.1| formyltetrahydrofolate deformylase [Streptomyces flavogriseus ATCC
           33331]
          Length = 299

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 131/280 (46%), Positives = 187/280 (66%), Gaps = 2/280 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    +   
Sbjct: 20  QYVLTLSCPDRQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTLDKL 79

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F +++ I    +  + +++VS+  HCLNDLL+R   G L + IV VVSNH
Sbjct: 80  RASFAAIGDSFRMEWQIHRASDRMRIVLMVSKFGHCLNDLLFRSRTGALPVEIVAVVSNH 139

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF ++P+ ++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC ++
Sbjct: 140 TDFAELVASYGVPFRHIPVNKENKPEAEAQLLELVRGENVELVVLARYMQVLSDDLCKQL 199

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 200 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGV 259

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           T +  +A+G+++E + L +AV  H ++R+ +N R+T+VFP
Sbjct: 260 TPDQLVAVGRDVECQALARAVTWHAERRILLNGRRTVVFP 299


>gi|197105876|ref|YP_002131253.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
 gi|196479296|gb|ACG78824.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
          Length = 280

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 125/277 (45%), Positives = 176/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLFIAD 63
           ILT++CP    I + +   L  +G NILD  QF+D +T + FMR+ F      +  +   
Sbjct: 2   ILTLSCPDQPGIVARVSALLFERGANILDAQQFDDEETGRFFMRVVFDPGQADVAAWRDA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P+ +Q+ + + +R   E  + +IL SQ DHCL DL++RW  G L ++I  VVSNH   
Sbjct: 62  FAPLGEQYGMTWQMRARGERRRVMILASQQDHCLADLIWRWRQGELPMDITAVVSNHPAS 121

Query: 124 -KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
                + + + F++LP+T   K + E +L  +I++   EL++LARYMQILSD L  K+ G
Sbjct: 122 TYPHTDLHGIAFHHLPITADTKPQQEARLWKLIQETGTELVVLARYMQILSDDLSGKLEG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++H    
Sbjct: 182 RCINIHHSFLPGFKGARPYHQAHARGVKVIGATAHYVTADLDEGPIIEQDVERISHRDHP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            D +  G++IE +VL +AV  H++ RV +N RKT+VF
Sbjct: 242 RDLVRKGRDIERRVLARAVRWHLEDRVLLNGRKTVVF 278


>gi|295691455|ref|YP_003595148.1| formyltetrahydrofolate deformylase [Caulobacter segnis ATCC 21756]
 gi|295433358|gb|ADG12530.1| formyltetrahydrofolate deformylase [Caulobacter segnis ATCC 21756]
          Length = 280

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 126/277 (45%), Positives = 182/277 (65%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLFIAD 63
           ILT++CP    I + +  +L  +GCNILD  QF+D +T + FMR+ F  +          
Sbjct: 2   ILTLSCPDQRGIVAKVSAFLYERGCNILDAQQFDDQETGQFFMRVVFDADGADRAALRDA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F  +    ++++++R+  E  + L+L S+ DHCL DL+YRW IG L ++I GVVSNH   
Sbjct: 62  FGTLASTLAMKWTLRDRAERYRVLLLASKFDHCLADLVYRWRIGELPMDITGVVSNHPAE 121

Query: 124 KKLV-ENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
                +   LPF++LP+T++ K E E +L  +I++   E+++LARYMQ+LSD L  K+ G
Sbjct: 122 TYAHIDLSDLPFHHLPVTKETKFEQEAELWKLIQETQTEIVVLARYMQVLSDGLSAKLQG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGA+AHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGAKPYHQAHARGVKLIGASAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G++IE +VL +A+   ++ RV +N RKT+VF
Sbjct: 242 EDLVRKGRDIERRVLARALRYRLEDRVLLNGRKTVVF 278


>gi|222109639|ref|YP_002551903.1| formyltetrahydrofolate deformylase [Acidovorax ebreus TPSY]
 gi|221729083|gb|ACM31903.1| formyltetrahydrofolate deformylase [Acidovorax ebreus TPSY]
          Length = 282

 Score =  313 bits (802), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 185/281 (65%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M+ SYILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F   +  + 
Sbjct: 1   MTHSYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGLFFMRVQFACESTDEA 60

Query: 60  F-IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+     ++ S+++S+  T  A KT+++VS+  HCLNDLL+R+  G L ++I  ++S
Sbjct: 61  TLKAELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLFRYKSGLLPIDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E K   II+    EL++LARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAELVVLARYMQVLSNDLCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|182436856|ref|YP_001824575.1| formyltetrahydrofolate deformylase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465372|dbj|BAG19892.1| putative formyltetrahydrofolate deformylase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 298

 Score =  313 bits (801), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  +     
Sbjct: 19  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKL 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 79  RASFAAIGEAFRMEWQIHRSAERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +L  +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC ++
Sbjct: 139 TDFAELTASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQL 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 199 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 259 TPDQLVAIGRDVECRALARAVKWHAERRILLNGRRTVIF 297


>gi|326777451|ref|ZP_08236716.1| formyltetrahydrofolate deformylase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657784|gb|EGE42630.1| formyltetrahydrofolate deformylase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 298

 Score =  313 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  +     
Sbjct: 19  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKL 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 79  RASFAAIGEAFRMEWQIHRSAERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +L  +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC ++
Sbjct: 139 TDFAELTASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQL 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 199 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 259 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVIF 297


>gi|121592860|ref|YP_984756.1| formyltetrahydrofolate deformylase [Acidovorax sp. JS42]
 gi|120604940|gb|ABM40680.1| formyltetrahydrofolate deformylase [Acidovorax sp. JS42]
          Length = 282

 Score =  312 bits (800), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 185/281 (65%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M+ SYILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F   +  + 
Sbjct: 1   MTHSYILTLSCPDRLGLVHAVSGFLLDHGGNIEEAAQYNDQGTGLFFMRVQFACESTDEA 60

Query: 60  F-IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+     ++ S+++S+  T  A KT+++VS+  HCLNDLL+R+  G L ++I  ++S
Sbjct: 61  TLKAELATFAEEHSMRWSLHATSAAMKTVLMVSKEGHCLNDLLFRYKSGLLPIDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E K   II+    EL++LARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKAQAEAKQYEIIQAEGAELVVLARYMQVLSNDLCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|16127860|ref|NP_422424.1| formyltetrahydrofolate deformylase [Caulobacter crescentus CB15]
 gi|221236681|ref|YP_002519118.1| formyltetrahydrofolate deformylase [Caulobacter crescentus NA1000]
 gi|13425382|gb|AAK25592.1| formyltetrahydrofolate deformylase [Caulobacter crescentus CB15]
 gi|220965854|gb|ACL97210.1| formyltetrahydrofolate deformylase [Caulobacter crescentus NA1000]
          Length = 280

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 127/277 (45%), Positives = 184/277 (66%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLFIAD 63
           ILT++CP    I + +  +L  +GCNILD  QF+D +T + FMR+ F  +    +    D
Sbjct: 2   ILTLSCPDQRGIVAKVSAFLFERGCNILDAQQFDDQETGQFFMRVVFDADGADREALRGD 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT- 122
           F  +   F +++++RN  +  + L+L S+ DHCL DL+YRW IG L ++I GVVSNH   
Sbjct: 62  FGALADGFKMKWTLRNRADRYRVLLLASKFDHCLADLVYRWRIGELPMDITGVVSNHPAQ 121

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
               V+   L F++LP+T++ K E E +L  +I++   ++++LARYMQ+LSD L  K+ G
Sbjct: 122 TYAHVDLSGLDFHHLPVTKETKFEQEAELWKLIQETKTDIVVLARYMQVLSDGLSAKLQG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGA+AHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGAKPYHQAHARGVKLIGASAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G++IE +VL +A+   ++ RV +N RKT+VF
Sbjct: 242 EDLVRKGRDIERRVLARALRYRLEDRVLLNGRKTVVF 278


>gi|269128050|ref|YP_003301420.1| formyltetrahydrofolate deformylase [Thermomonospora curvata DSM
           43183]
 gi|268313008|gb|ACY99382.1| formyltetrahydrofolate deformylase [Thermomonospora curvata DSM
           43183]
          Length = 287

 Score =  312 bits (799), Expect = 4e-83,   Method: Composition-based stats.
 Identities = 126/286 (44%), Positives = 180/286 (62%), Gaps = 7/286 (2%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF-----VFN 54
           MSS YILT++CP    I + +   L+ +GCNI++  Q+ D  T + FMR+ F        
Sbjct: 1   MSSDYILTLSCPDRPGIVAAVSGLLAERGCNIVESQQYGDPITGRFFMRVQFTVPGPEPG 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTL-ALNI 113
                       +V +F+L + + +    T+ LILVS+  HCLNDLLYR   G L  ++I
Sbjct: 61  AVADGLRTALAALVPEFALDWRLYDASVPTRVLILVSKAGHCLNDLLYRRRSGQLSTIDI 120

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           V V SNH   + L ++Y + +++LP+    K   E +++ ++E   V+L++LARYMQ+LS
Sbjct: 121 VAVASNHPDLRPLTQSYGIDYHHLPIGPGGKAAQEAEILALVEHYRVDLVVLARYMQVLS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +C K+ GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   ELD GPIIEQ+V
Sbjct: 181 DEMCGKLPGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTPELDEGPIIEQEV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV H  +  D +A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 ARVDHTHSPADLMAVGRDMECLALARAVRWHSEHRILLNGDKTVVF 286


>gi|119385340|ref|YP_916396.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119387626|ref|YP_918660.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119375107|gb|ABL70700.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
 gi|119378201|gb|ABL72964.1| formyltetrahydrofolate deformylase [Paracoccus denitrificans
           PD1222]
          Length = 294

 Score =  312 bits (799), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 150/288 (52%), Positives = 213/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M  Y LT+ CPS   I + +  +L+  GCNI D SQF+D++T + FMR+SFV      ++
Sbjct: 1   MKKYTLTVACPSTRGIVATVAGFLAEHGCNITDSSQFDDIETGRFFMRVSFVSEEGVGLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A      + F + Y+I +  E  K +I+VS+  HCLNDLLYRW IG L + IV V+S
Sbjct: 61  ELRAGLAEPAKPFDMDYAIHDEAEKMKVVIMVSRFGHCLNDLLYRWRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T +NK ++E +L+ ++E +  EL++LARYMQ+LSD LC 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIKVTRENKPQAEAQLMQVVEDSGAELVVLARYMQVLSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD++RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVESQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|197104547|ref|YP_002129924.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
 gi|196477967|gb|ACG77495.1| formyltetrahydrofolate deformylase [Phenylobacterium zucineum HLK1]
          Length = 280

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 126/277 (45%), Positives = 182/277 (65%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLFIAD 63
           ILT++CP    I + +   L  +G NILD  QF+D +T + FMR+ F   +   + + A 
Sbjct: 2   ILTLSCPDQPGIVARVSALLFERGANILDAQQFDDEETGRFFMRVVFDPGDAGAEAWRAA 61

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P+ +Q+++ +++R  KE  + +IL SQ DHCL+DL++RW  G L +++  VVSNH   
Sbjct: 62  FAPLAEQYAMTWTLRGRKERRRVMILASQQDHCLSDLIWRWRQGELQMDLTAVVSNHPAS 121

Query: 124 K-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
                +   + F++LP+T + K + E +L ++IE+   EL++LARYMQ+LSD L  K+ G
Sbjct: 122 TFPHTDLQGIAFHHLPITPETKPQQEARLWSLIEETRTELVVLARYMQVLSDDLAGKLEG 181

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++H  T 
Sbjct: 182 RCINIHHSFLPGFKGARPYHQAHARGVKVIGATAHYVTGDLDEGPIIEQDVERISHRDTP 241

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              I  G++IE +VL +AV   ++ RV +N RKT+VF
Sbjct: 242 AALIRKGRDIERRVLARAVRWRLEDRVLLNGRKTVVF 278


>gi|264680505|ref|YP_003280415.1| formyltetrahydrofolate deformylase [Comamonas testosteroni CNB-2]
 gi|299532934|ref|ZP_07046321.1| formyltetrahydrofolate deformylase [Comamonas testosteroni S44]
 gi|262211021|gb|ACY35119.1| formyltetrahydrofolate deformylase [Comamonas testosteroni CNB-2]
 gi|298719158|gb|EFI60128.1| formyltetrahydrofolate deformylase [Comamonas testosteroni S44]
          Length = 282

 Score =  311 bits (798), Expect = 5e-83,   Method: Composition-based stats.
 Identities = 129/281 (45%), Positives = 185/281 (65%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  +     
Sbjct: 1   MTQAYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPVTGLFFMRVQFACDGKDAA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    +  Q+ +Q+S+ +  E  KT+I+VS+  HCLNDLL+RW  G L + I  ++S
Sbjct: 61  SLKASVAELADQYQMQWSLHSKAERIKTVIMVSKEGHCLNDLLFRWKSGLLPIEIKAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E++   IIE+   EL++LARYMQ+LS+ LC 
Sbjct: 121 NHREFYQLAASYNIPFHHIPVTAATKAQAEERQYEIIEEEGAELVVLARYMQVLSNDLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLSGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H ++RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSERRVILNGHKTVVF 281


>gi|146279003|ref|YP_001169162.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557244|gb|ABP71857.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 294

 Score =  311 bits (798), Expect = 6e-83,   Method: Composition-based stats.
 Identities = 150/288 (52%), Positives = 210/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           MS ++LT+TCP+   I + I ++L+  GCNI D +QF+D +T + FMR+ F   T   + 
Sbjct: 1   MSKFVLTVTCPTRRGIVAAISNFLADNGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F + + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  ALNDSFARIAPDFEMGWQIFDSSRKLKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ +PF+ + +T++NK ++E +L+ ++E+   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKLVVNHDIPFHLIRVTKENKPDAEARLLALVEETGAELVVLARYMQVLSDSFCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL +A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLARAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|260427697|ref|ZP_05781676.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260422189|gb|EEX15440.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 149/288 (51%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMK 58
           MS + LT+TCPS   I + I  +L+ QGCNI D SQF+D +T   FMR+SF       + 
Sbjct: 1   MSKFALTVTCPSTRGIVAAIATFLAEQGCNITDSSQFDDFETGNFFMRVSFQSETGASLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    + F + Y+  +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  GLQEQFAATAKGFGMDYAFHDEAAKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +++ ++E+   +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHNIRVTKENKPQAEGRIMEVVEETGADLIVLARYMQILSDEMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|282860684|ref|ZP_06269750.1| formyltetrahydrofolate deformylase [Streptomyces sp. ACTE]
 gi|282564420|gb|EFB69956.1| formyltetrahydrofolate deformylase [Streptomyces sp. ACTE]
          Length = 300

 Score =  311 bits (797), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 131/280 (46%), Positives = 185/280 (66%), Gaps = 2/280 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF-- 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    +   
Sbjct: 21  QYVLTLSCPDRQGIVHAVSSYLLVTGCNIEDSQQFGDHDTGLFFMRVHFSADGPADVVKL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I    E  + +++VS+  HCLNDLL+R + G L + IV VVSNH
Sbjct: 81  RAGFAAIGDSFRMDWQIHRASERMRVVLMVSKFGHCLNDLLFRASTGALPVEIVAVVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF ++P+T   K E+E +L+ ++   NVEL++LARYMQ+LSD LC ++
Sbjct: 141 TDFAELVASYGIPFRHIPVTRDTKQEAEAQLLELVRGENVELVVLARYMQVLSDDLCKQL 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 201 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGV 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           T +  +A+G+++E + L +AV  H ++R+ +N R+T++FP
Sbjct: 261 TPDQLVAVGRDVECRALARAVKWHAERRILLNGRRTVIFP 300


>gi|319779080|ref|YP_004129993.1| Formyltetrahydrofolate deformylase [Taylorella equigenitalis MCE9]
 gi|317109104|gb|ADU91850.1| Formyltetrahydrofolate deformylase [Taylorella equigenitalis MCE9]
          Length = 281

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 134/281 (47%), Positives = 191/281 (67%), Gaps = 1/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKL 59
           M  YILTI+CP    I   +  +L   G NI+D  QF D ++   F+RI F   N+  + 
Sbjct: 1   MKHYILTISCPDRTGIVHTVTGFLLNLGGNIIDSQQFGDHESQTFFLRIHFSLANSDAET 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+ I ++F++ + I +    +K LILVS+  HCLNDLL+R   G L ++IVGVVSN
Sbjct: 61  LGKSFENIAKEFNMNWKIWDKDRKSKVLILVSKQGHCLNDLLFRTKSGNLPIDIVGVVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +KL ++Y +PFY+LP++++N+ E E ++I ++++  V+L++LARYMQILS+ +C  
Sbjct: 121 HRVFEKLSKSYGIPFYHLPVSKENRPEQEAQIIKLVDELQVDLVVLARYMQILSNDMCKA 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLPSFKGA PY QAY  GVKIIGATAHY   +LD GPIIEQ++  V H 
Sbjct: 181 LNGKAINIHHSFLPSFKGAKPYHQAYARGVKIIGATAHYVTSDLDEGPIIEQEIEHVDHR 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           QT ED + +G +IE+ VL++AV  HI+ R+ +N  KT+VF 
Sbjct: 241 QTAEDLVQVGSDIESLVLSRAVRGHIEHRILLNGNKTVVFD 281


>gi|298290475|ref|YP_003692414.1| formyltetrahydrofolate deformylase [Starkeya novella DSM 506]
 gi|296926986|gb|ADH87795.1| formyltetrahydrofolate deformylase [Starkeya novella DSM 506]
          Length = 289

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 123/284 (43%), Positives = 188/284 (66%), Gaps = 5/284 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--- 56
           M+  Y+LT++CP    I + +  +L  +G NIL+  QF+D ++ + FMR+ F        
Sbjct: 4   MTEPYVLTLSCPDRPGIVAAVASFLFERGGNILEAQQFDDTESGRFFMRVVFDRAADSGA 63

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F+ + ++F+L + +R   +  + ++LVS+ DHCL DLLYRW IG + + I G+
Sbjct: 64  IAELKAEFEAVAEKFALNWRLRGRNQKRRVMLLVSKFDHCLADLLYRWRIGEIPMEIAGI 123

Query: 117 VSNHTTHKKLV-ENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++N+        +   +PF+YLP+T+Q K+E E +L  + +K+  E+ +LARYMQ+LSD 
Sbjct: 124 IANYPRETYAHLDFADIPFHYLPVTKQTKMEQEAQLWELFQKSGAEVAVLARYMQVLSDG 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           L  K++GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 184 LSAKLSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTSDLDEGPIIEQDVER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++H  T +D +  G++IE +VL +A+  H+  RV +N  +T+VF
Sbjct: 244 ISHQDTADDLVRKGRDIERRVLARALAWHLDDRVLLNGHRTVVF 287


>gi|221064880|ref|ZP_03540985.1| formyltetrahydrofolate deformylase [Comamonas testosteroni KF-1]
 gi|220709903|gb|EED65271.1| formyltetrahydrofolate deformylase [Comamonas testosteroni KF-1]
          Length = 282

 Score =  311 bits (797), Expect = 8e-83,   Method: Composition-based stats.
 Identities = 129/281 (45%), Positives = 184/281 (65%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  +     
Sbjct: 1   MTQAYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPVTGLFFMRVQFACDGKDAA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    +  Q+ +Q+S+ +  E  KT+I+VS+  HCLNDLL+RW  G L + I  ++S
Sbjct: 61  SLKASVAQLADQYQMQWSLHSKAERIKTVIMVSKEGHCLNDLLFRWKSGLLPIEIKAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E++   IIE+   EL++LARYMQ+LS+ LC 
Sbjct: 121 NHREFYQLAASYNIPFHHIPVTAATKAQAEERQYEIIEEEGAELVVLARYMQVLSNDLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H ++RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSERRVILNGHKTVVF 281


>gi|239943392|ref|ZP_04695329.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
 gi|239989845|ref|ZP_04710509.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           11379]
 gi|291446861|ref|ZP_06586251.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
 gi|291349808|gb|EFE76712.1| formyltetrahydrofolate deformylase [Streptomyces roseosporus NRRL
           15998]
          Length = 298

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 132/279 (47%), Positives = 187/279 (67%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  +     
Sbjct: 19  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADATVTVDKL 78

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I + F +++ I  + E  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 79  RASFAAIGEAFRMEWQIHRSDEKMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVVSNH 138

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF +LP+T+ NK E+E  L+ ++ + NVEL++LARYMQ+LSD LC ++
Sbjct: 139 TDFAELVASYGIPFRHLPVTKDNKPEAEAALLELVREENVELVVLARYMQVLSDDLCKQL 198

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 199 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 258

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T++F
Sbjct: 259 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVIF 297


>gi|239981526|ref|ZP_04704050.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
 gi|291453377|ref|ZP_06592767.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
 gi|291356326|gb|EFE83228.1| formyltetrahydrofolate deformylase [Streptomyces albus J1074]
          Length = 299

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 192/279 (68%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLF 60
           SY+LT+ CP  + I   +  YL   GCNI D  QF D DT   FMR+SF   +   ++  
Sbjct: 20  SYVLTLACPDRQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVSFSAGSPVSVEKL 79

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F +++ I  ++E  + +++VS+  HCLNDLL+R  IG L ++I  VVSNH
Sbjct: 80  RASFAAIGDSFRMEWQIHRSEERMRIVLMVSKFGHCLNDLLFRARIGALPVDIAAVVSNH 139

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               +LVE+Y +PF+++P+T+  K E+EQ++++++E+  VEL++LARYMQ+LS++ C ++
Sbjct: 140 PAFAELVESYGIPFHHIPVTKDTKAEAEQRVLDLVEREGVELVVLARYMQVLSENFCKQL 199

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 200 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQEVERVGHEV 259

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +A+G+++E + L +AV  H + R+ +N  +T+VF
Sbjct: 260 TPEQLVAVGRDVECQALARAVKWHAEHRILLNGHRTVVF 298


>gi|117927364|ref|YP_871915.1| formyltetrahydrofolate deformylase [Acidothermus cellulolyticus
           11B]
 gi|117647827|gb|ABK51929.1| formyltetrahydrofolate deformylase [Acidothermus cellulolyticus
           11B]
          Length = 283

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 128/282 (45%), Positives = 186/282 (65%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--- 57
           M+  ILT++CP    I   +  +L+ +G NILD  QF D  T + FMR+           
Sbjct: 1   MNRCILTLSCPDRLGIVHAVSGFLADRGANILDSQQFGDRSTRRFFMRVHIECTDPRIGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                DF  + + FS+ + I + +E T+T+I+VS+  HCLNDLLYRW+IG L  +IV VV
Sbjct: 61  AELRRDFSAVAEAFSMTWQIHDEEERTRTIIMVSRLGHCLNDLLYRWHIGALPADIVAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L  +Y +P++Y+P+T + K ++E KL+ ++++ +V+L++LARYMQILS  +C
Sbjct: 121 SNHRDFEDLAASYGIPYHYIPVTPETKAQAEDKLLALVDEASVDLIVLARYMQILSPTVC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ G+IINIHHSFLPSF+GA PY QAYE GVK+IGATAHY    LD GPIIEQ+V RV 
Sbjct: 181 ERLPGKIINIHHSFLPSFRGARPYHQAYERGVKLIGATAHYVTATLDEGPIIEQEVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +     +G+++E   L +AV  H++ RV ++  KT+VF
Sbjct: 241 HTYDVAHLAEVGRDLECLALARAVRWHLEHRVLLDGNKTVVF 282


>gi|68346410|gb|AAY94016.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 294

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I+CP    I + + ++L++    I + S  +D  +   FMR     +     +
Sbjct: 13  MRTFRLVISCPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADSLPFGL 72

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T E  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 73  EAFREAFAPIAEEFSMDWRITDTAEKKRVVLMASRESHCLADLLHRWHSDELDCQIACVI 132

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 133 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHDAEVVVLARYMQILPPELC 192

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 193 SEYAHKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 252

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 253 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 294


>gi|161501967|ref|YP_261867.2| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 282

 Score =  310 bits (795), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I+CP    I + + ++L++    I + S  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADSLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T E  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMDWRITDTAEKKRVVLMASRESHCLADLLHRWHSDELDCQIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHDAEVVVLARYMQILPPELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 SEYAHKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|86355884|ref|YP_467776.1| formyltetrahydrofolate deformylase [Rhizobium etli CFN 42]
 gi|86279986|gb|ABC89049.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CFN 42]
          Length = 294

 Score =  310 bits (794), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 153/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT + FMR+SF+    +   
Sbjct: 1   MKSYVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGRFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   + L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMRVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVDLVEQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|302552227|ref|ZP_07304569.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302469845|gb|EFL32938.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 293

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +    +   
Sbjct: 14  QYVLTLSCPDRKGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVSLDKL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F +++ I    +  + L++VS+  HCLNDLL+R   G L + I GVVSNH
Sbjct: 74  RASFAAIGDSFQMEWQINRADQKMRILLMVSKFGHCLNDLLFRARTGALPVEIAGVVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T+  K E+E +L++++ +  VEL++LARYMQ+LSD LC ++
Sbjct: 134 TDFAELVGSYNIPFHHIPVTKDTKPEAEARLLDLVREEGVELVVLARYMQVLSDDLCKQL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 194 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +AIG+++E + L + V  H ++R+ +N R+T++F
Sbjct: 254 TPEGLVAIGRDVECQALARGVKWHAERRILLNGRRTVIF 292


>gi|163761527|ref|ZP_02168599.1| formyltetrahydrofolate deformylase [Hoeflea phototrophica DFL-43]
 gi|162281241|gb|EDQ31540.1| formyltetrahydrofolate deformylase [Hoeflea phototrophica DFL-43]
          Length = 294

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 146/288 (50%), Positives = 222/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M++++LT++CPS   I + +  +L+  GCNI+D SQF+DL+T K FMRIS V   +  ++
Sbjct: 1   MTTFVLTVSCPSTRGIVAALSGFLAEMGCNIVDSSQFDDLETGKFFMRISCVSEKDATLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI ++FS++  I +  +  K +++VS+  HCLND+LYRW IG L + IVGVVS
Sbjct: 61  KLAERLKPIAEKFSMETGIFDQSDRMKVMLMVSRFGHCLNDILYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ +++    +L++LARYMQ+LSD +C 
Sbjct: 121 NHLDYQKVVVNHDIPFHHIPVTKENKPQAEARIMELVDSTGTDLIVLARYMQVLSDKMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQDVV VTH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDVVGVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++EA+VL++A++AHI +RVF+N  +T+VFP  P +Y
Sbjct: 241 AQSPGDYVSLGRDVEARVLSRAIHAHIHRRVFLNGNRTVVFPPSPGSY 288


>gi|239930613|ref|ZP_04687566.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
 gi|291438978|ref|ZP_06578368.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
 gi|291341873|gb|EFE68829.1| formyltetrahydrofolate deformylase [Streptomyces ghanaensis ATCC
           14672]
          Length = 293

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 185/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  +  +  
Sbjct: 14  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVTVEKL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I    +  + L++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 74  RASFAAIGDSFQMDWRIDRGDQKMRILLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T++ K E+E +L+ I+ +  VEL++LARYMQ+LSD LC ++
Sbjct: 134 TDFAELVSSYDIPFHHIPVTKETKPEAEARLLEIVREEQVELVVLARYMQVLSDDLCKQL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 194 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDA 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 254 TPDQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 292


>gi|269925496|ref|YP_003322119.1| formyltetrahydrofolate deformylase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789156|gb|ACZ41297.1| formyltetrahydrofolate deformylase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 283

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 124/283 (43%), Positives = 183/283 (64%), Gaps = 5/283 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTC 56
           MS +  L I CP  + + + I  +++    NIL   Q+   D+ + FMR+      F   
Sbjct: 1   MSYNIRLLIDCPDRKGLIAAISSFIAMHNGNILSADQYV-SDSGRFFMRLVIEGEGFGLR 59

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            + F A F P+ +Q+S+ + I  T +  +  ILVS+ DHCL DLL+RW+ G L   I  V
Sbjct: 60  KEEFGAAFTPLARQYSMNWQIYYTDQPKRVAILVSKQDHCLVDLLWRWDAGELPAEIPLV 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNHT     VE Y +PFY+LP+T++ + E E K++ +++K +++L++LARYMQIL+  +
Sbjct: 120 ISNHTNAASRVEAYGIPFYHLPVTKETREEQEDKILELLDKYSIDLVVLARYMQILTPKV 179

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    R+INIHHSFLP+F GANPY QA+  GVKIIGATAHY   ELDAGPII QD+  V
Sbjct: 180 VNAYRQRMINIHHSFLPAFVGANPYHQAHARGVKIIGATAHYVTEELDAGPIINQDIAHV 239

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  T++D I IG+ +E +VL +AV  H++ RV ++  +T+VF
Sbjct: 240 SHRDTVQDMIRIGREVERRVLARAVRWHLEDRVLVDGNRTVVF 282


>gi|302560077|ref|ZP_07312419.1| formyltetrahydrofolate deformylase [Streptomyces griseoflavus
           Tu4000]
 gi|302477695|gb|EFL40788.1| formyltetrahydrofolate deformylase [Streptomyces griseoflavus
           Tu4000]
          Length = 293

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F  +  +  +  
Sbjct: 14  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSADAPVTVEKL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I       + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 74  RASFAAIGDSFQMDWQINRADAKMRIVLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T+  K E+E KL+ I+ +  VEL++LARYMQ+LSD LC ++
Sbjct: 134 TDFAELVASYNVPFHHIPVTKDTKAEAEAKLLEIVREERVELVVLARYMQVLSDDLCKQL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 194 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +A+G+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 254 TPEGLVAVGRDVECQALARAVKWHAERRILLNGRRTVVF 292


>gi|227497338|ref|ZP_03927570.1| Formyltetrahydrofolate deformylase [Actinomyces urogenitalis DSM
           15434]
 gi|226833209|gb|EEH65592.1| Formyltetrahydrofolate deformylase [Actinomyces urogenitalis DSM
           15434]
          Length = 303

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 178/278 (64%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
              +LT++CP    I   +   L+ +G NI +  QF D ++   FMR++ +         
Sbjct: 25  QHLVLTLSCPDRPGIVHAVTGALARRGGNITESQQFGDAESGLFFMRVAVLTRVPRTELE 84

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           AD   +   + +++S+       +TL++VS+  HCL+DLL+R     L +++VGVV NH 
Sbjct: 85  ADIAELAATYEVRWSLDEADRPIRTLLMVSKEGHCLSDLLFRAKSQGLPIDVVGVVGNHE 144

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + + E Y +PF+++P+T+  K E+E +L+++++   VEL++LARYMQILS  LC  + 
Sbjct: 145 TLRDVAEFYGVPFHHIPVTKDTKAEAEAELLSLVDSLEVELVVLARYMQILSPALCETLH 204

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY+QA++ GVK+IGATAHY   +LD GPIIEQDV R +HA +
Sbjct: 205 GNVINIHHSFLPSFKGAKPYQQAHDRGVKLIGATAHYVTPDLDEGPIIEQDVTRASHADS 264

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 265 ALQLQRKGQDVERRVLAQAVKWHAEHRVLLNGHRTVVF 302


>gi|83749369|ref|ZP_00946364.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum UW551]
 gi|83723946|gb|EAP71129.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum UW551]
          Length = 315

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 133/287 (46%), Positives = 182/287 (63%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 28  MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 87

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 88  DLQTLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 147

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQIL
Sbjct: 148 IVSNHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQIL 207

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 208 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 267

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 268 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 314


>gi|241767211|ref|ZP_04764959.1| formyltetrahydrofolate deformylase [Acidovorax delafieldii 2AN]
 gi|241362149|gb|EER58237.1| formyltetrahydrofolate deformylase [Acidovorax delafieldii 2AN]
          Length = 282

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 124/281 (44%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L  +G NI + +Q+ND  T   FMR+ F  +     
Sbjct: 1   MTQAYILTLSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDPATGLFFMRVQFACSQHDQA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                     +   +++S+  T +  +T++LVS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  TLQTHLAQFAEPHQMRWSLHATAQPVRTVLLVSKEGHCLNDLLFRWKSGLLPVDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E +   II+  + EL+ILARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNVPFHHIPVTAATKAQAEARQYEIIQAEDAELVILARYMQVLSNDLCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHSEHRVLVNGHKTVVF 281


>gi|146342112|ref|YP_001207160.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. ORS278]
 gi|146194918|emb|CAL78943.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Bradyrhizobium sp. ORS278]
          Length = 287

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 122/285 (42%), Positives = 181/285 (63%), Gaps = 6/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNT 55
           MS   Y+LT++CP    I S +  +L+  G NILD  QF D +T   FMR+ F       
Sbjct: 1   MSDHQYVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFGDFETGHFFMRVVFTAADLAV 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F  I ++F++ + +R+     + ++LVS+ DHCL D+LYRW    L++    
Sbjct: 61  NLPALQTGFAAIAERFAMDWQMRDRAGQRRVMLLVSKFDHCLVDILYRWRTRDLSMIPTA 120

Query: 116 VVSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           +VSNH        +   +PF+++P+T++ K + EQ ++ +++    +L++LARYMQILSD
Sbjct: 121 IVSNHPRETYAGLDLGEIPFHHMPVTKETKRDQEQAILKLVDDTKTDLVVLARYMQILSD 180

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +   ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPII+QDV 
Sbjct: 181 EMSASLSGRCINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTRDLDEGPIIDQDVE 240

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R++H  T ED +  G++IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 241 RISHRDTPEDLVRKGRDIERRVLARAIRYHLEDRVILNGRKTVVF 285


>gi|318056978|ref|ZP_07975701.1| formyltetrahydrofolate deformylase [Streptomyces sp. SA3_actG]
 gi|318080281|ref|ZP_07987613.1| formyltetrahydrofolate deformylase [Streptomyces sp. SA3_actF]
 gi|333026314|ref|ZP_08454378.1| putative formyltetrahydrofolate deformylase [Streptomyces sp.
           Tu6071]
 gi|332746166|gb|EGJ76607.1| putative formyltetrahydrofolate deformylase [Streptomyces sp.
           Tu6071]
          Length = 305

 Score =  309 bits (792), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 132/286 (46%), Positives = 185/286 (64%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------- 54
           SSY+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F          
Sbjct: 19  SSYVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSVESTGQDGE 78

Query: 55  -TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
            T +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I
Sbjct: 79  PTGLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSKFGHCLNDLLFRSRSGALPVEI 138

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNHT  ++L  +Y +PF+++P+ +  K ++EQ+ ++++ + +VEL++LARYMQ+LS
Sbjct: 139 AAVVSNHTDFRELTASYGVPFHHIPVPKDGKAQAEQRFLDLVAEEDVELVVLARYMQVLS 198

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC K++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 199 DDLCKKLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEV 258

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 259 ERVTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 304


>gi|86360691|ref|YP_472579.1| formyltetrahydrofolate deformylase [Rhizobium etli CFN 42]
 gi|86284793|gb|ABC93852.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CFN 42]
          Length = 294

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M S+ILT++C S   I + I  YL+ +GCNI+D SQF+DLDT + FMR+SF+    +   
Sbjct: 1   MKSFILTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGRFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVDLVEQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|120609348|ref|YP_969026.1| formyltetrahydrofolate deformylase [Acidovorax citrulli AAC00-1]
 gi|120587812|gb|ABM31252.1| formyltetrahydrofolate deformylase [Acidovorax citrulli AAC00-1]
          Length = 282

 Score =  309 bits (791), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +T    
Sbjct: 1   MTQAYILTLSCPDKLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRFACDTHDQA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A      +   + +S+    E  KT I+VS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  ALRARLTEFAEPHRMHWSLHAASEPMKTAIMVSREGHCLNDLLFRWKSGLLPVHICAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T+ NK ++E +   II++   EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFYQLAASYNVPFHHIPVTKDNKPQAEARQYEIIQQEGAELVVLARYMQVLSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLEGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHTEHRVLLNGHKTVIF 281


>gi|229592325|ref|YP_002874444.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229364191|emb|CAY51858.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 282

 Score =  309 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWHITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKEPAFAEVSRLVKQHEADVVVLARYMQILPPELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  G++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAGKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|150378015|ref|YP_001314610.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150032562|gb|ABR64677.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 293

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 153/286 (53%), Positives = 218/286 (76%), Gaps = 2/286 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++C S   I + I  YL+ QGCNI+D SQF+DLDT + FMR+SF+        + 
Sbjct: 2   KYVLTVSCQSTRGIVAAISGYLAEQGCNIVDSSQFDDLDTGQFFMRVSFISEEGAVQTII 61

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ ++F + +++ +  +  K L++VS+  HCLNDLLYRW IG L ++IVGVVSNH
Sbjct: 62  EQGFVPVAERFGMNWNLFDAAKREKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNH 121

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             ++K+V N+ +PF+++P+T+ NK E E ++++++E+   EL++LARYMQILSD +C KM
Sbjct: 122 FDYQKVVVNHDIPFHHIPVTKANKPEVEARIMDLVEQTGTELIVLARYMQILSDQMCQKM 181

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLPSFKGANPYKQA+E GVK+IGATAHY   +LD GPIIEQD VRVTHAQ
Sbjct: 182 SGKIINIHHSFLPSFKGANPYKQAFERGVKLIGATAHYVTADLDEGPIIEQDTVRVTHAQ 241

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           + EDY+++G+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 242 SPEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 287


>gi|328884274|emb|CCA57513.1| Formyltetrahydrofolate deformylase [Streptomyces venezuelae ATCC
           10712]
          Length = 283

 Score =  308 bits (790), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 131/282 (46%), Positives = 188/282 (66%), Gaps = 3/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-- 57
           M+  Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     +  
Sbjct: 1   MTDQYVLTLSCPDKQGIVHAVSSYLFITGCNIEDSQQFGDRDTGLFFMRVHFSAEAPVNV 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               A F  +   F++ + I    +  + +++VS+  HCLNDLL+R  IG L + IV VV
Sbjct: 61  DKLRASFAAVGDSFTMDWQINRADQRMRIVLMVSKFGHCLNDLLFRSRIGALPVEIVAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT  ++LV +Y +PF ++P+T+  K  +E +L++++ + NVEL++LARYMQ+LSD LC
Sbjct: 121 SNHTDFQELVGSYGIPFRHIPVTKDTKAAAEAELLDLVREENVELVVLARYMQVLSDDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 181 KQLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVG 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T +  +AIG+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 241 HEVTPDQLVAIGRDVECQALARAVKWHAEHRILLNGRRTVVF 282


>gi|126463363|ref|YP_001044477.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105027|gb|ABN77705.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 294

 Score =  308 bits (790), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M  ++LT+TCP+   I + I  +L+  GCNI D +QF+D +T + FMR+ F   T   + 
Sbjct: 1   MPKFVLTVTCPTRRGIVAAISTFLADHGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  + +     + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  GLTADFAAVGETLEANWQIFDSASKIKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+ + +T+ NK E+E +L+ ++++   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKVVVNHDIPFHLIKVTKDNKPEAEARLMALVDETGAELVVLARYMQVLSDAFCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|15606867|ref|NP_214247.1| formyltetrahydrofolate deformylase [Aquifex aeolicus VF5]
 gi|2984098|gb|AAC07636.1| formyltetrahydrofolate deformylase [Aquifex aeolicus VF5]
          Length = 283

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCM 57
           M + IL ++CP  + +   I  +++  G NI+   Q  D  T     R+ +    F    
Sbjct: 1   MQNAILLVSCPDRKGLVKEISSFIADNGGNIVSFDQHIDEQTKTFLARVEWSLEDFKIPR 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +    +F+ + Q+FS+ + I  +    K  I VS+ +HC  DL++R+  G L   +  V+
Sbjct: 61  EKIENEFKKVAQKFSMNFQISFSDYVKKVAIFVSKQEHCFYDLMHRFYSGELKGEVKLVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +K  E + +PFY++P T++NK+E+E++ + ++++  VEL++LARYMQILS    
Sbjct: 121 SNHEKARKTAEFFGVPFYHIPKTKENKLEAEKRELELLKEYGVELVVLARYMQILSPKFV 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GA PY++A+  GVKIIGATAHY   ELD GPIIEQDVVRV+
Sbjct: 181 KEYENKIINIHHSFLPAFPGAKPYERAFGKGVKIIGATAHYVTEELDEGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  ++ED+I  GK+IE  VL +AV  H++ ++ +   KT+VF
Sbjct: 241 HKDSLEDFIRKGKDIEKVVLARAVKWHLEDKILVYNGKTVVF 282


>gi|15889735|ref|NP_355416.1| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|15157649|gb|AAK88201.1| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M+SY+LT+ C S   I + I  YL+ +GCNI+D SQF+DL+T K FMR+SF+      ++
Sbjct: 1   MTSYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFISEEGASLQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP+ ++F +   I    +  K +++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AITEGFQPVSEKFGMASDIYPDGQRMKAMLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+++IE +  EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDLIETSGTELVVLARYMQVLSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTGDLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|325294563|ref|YP_004281077.1| formyltetrahydrofolate deformylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065011|gb|ADY73018.1| formyltetrahydrofolate deformylase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 284

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           + IL I+CP  + I + I  +++  G NIL   Q  D      FMRI +    F    + 
Sbjct: 4   TAILLISCPDRKGILAEITGFIAKHGGNILHADQHIDFQKEIFFMRIEWDLSNFEIPKEK 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               FQPI ++F + Y I+ + +     I VS+ DHCL +LLYR+  G L  N+  V+SN
Sbjct: 64  LPESFQPIAEKFQMDYQIKFSSDIQNVAIFVSKYDHCLYELLYRFKAGELRGNLKFVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K +VE Y +PFY+ P +++NK+E E+K I +++K  ++L+ILARYMQILSD   ++
Sbjct: 124 HPDLKPVVEMYGVPFYHFPKSKKNKLEVEEKEIELLKKEKIDLIILARYMQILSDRFVNE 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +IINIHHSFLP+F GA PY +AYE GVKIIGAT+HY   ELD GPIIEQDVVRV+H 
Sbjct: 184 FRNKIINIHHSFLPAFVGAKPYHRAYERGVKIIGATSHYVTEELDQGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +IED I  G+++E  VL +AV  H++ ++ +   KT++F 
Sbjct: 244 DSIEDMIRKGRDLEKLVLARAVRWHLENKILVYDNKTVIFD 284


>gi|114767063|ref|ZP_01445960.1| formyltetrahydrofolate deformylase protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114540782|gb|EAU43847.1| formyltetrahydrofolate deformylase protein [Roseovarius sp.
           HTCC2601]
          Length = 294

 Score =  308 bits (789), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMK 58
           MS + LT+TCPS   I + I  +L+ QGCNI D SQF+D +T   FMR+S     +  ++
Sbjct: 1   MSKFALTVTCPSTRGIVAAIAAFLAEQGCNITDSSQFDDFETGNFFMRVSVMSEKDATLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    + F + Y   +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ELRERFAETAKNFKMDYEFHDEAEKMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +++ ++E+   EL++LARYMQILSD LC 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIRVTKENKPQAEARIMEVVEETGAELVVLARYMQILSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 VMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 288


>gi|326315436|ref|YP_004233108.1| formyltetrahydrofolate deformylase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372272|gb|ADX44541.1| formyltetrahydrofolate deformylase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 282

 Score =  308 bits (788), Expect = 7e-82,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +T    
Sbjct: 1   MTQAYILTLSCPDKLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRFACDTHDQA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A      +   + +S+    E  KT I+VS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  ALRARLAEFAEPHRMHWSLHAASEPMKTAIMVSREGHCLNDLLFRWKSGLLPVHICAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T+ NK ++E +   II++   EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFYQLAASYNVPFHHIPVTKDNKPQAEARQYEIIQQEGAELVVLARYMQVLSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLEGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 TDTVEDLTARGRDTESQVLARAVKWHTEHRVVLNGHKTVIF 281


>gi|302519940|ref|ZP_07272282.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB78]
 gi|302428835|gb|EFL00651.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB78]
          Length = 305

 Score =  308 bits (788), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 131/286 (45%), Positives = 185/286 (64%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------- 54
           SSY+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F          
Sbjct: 19  SSYVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSVESTRQDGE 78

Query: 55  -TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
            T +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I
Sbjct: 79  PTGLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSKFGHCLNDLLFRSRSGALPVEI 138

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNHT  ++L  +Y +PF+++P+ +  K ++E++ ++++ + +VEL++LARYMQ+LS
Sbjct: 139 AAVVSNHTDFRELTASYGVPFHHIPVPKDGKGQAEERFLDLVAEEDVELVVLARYMQVLS 198

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC K++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 199 DDLCKKLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEV 258

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 259 ERVTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 304


>gi|77464523|ref|YP_354027.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|221640433|ref|YP_002526695.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides KD131]
 gi|332559415|ref|ZP_08413737.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides WS8N]
 gi|77388941|gb|ABA80126.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides 2.4.1]
 gi|221161214|gb|ACM02194.1| Formyltetrahydrofolate deformylase [Rhodobacter sphaeroides KD131]
 gi|332277127|gb|EGJ22442.1| formyltetrahydrofolate deformylase [Rhodobacter sphaeroides WS8N]
          Length = 294

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M  ++LT+TCP+   I + I  +L+  GCNI D +QF+D +T + FMR+ F   T   + 
Sbjct: 1   MPKFVLTVTCPTRRGIVAAISTFLADHGCNITDSAQFDDQETGRFFMRVGFQSETGATLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  + +     + I ++    K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  GLTADFAAVGETLEADWQIFDSASKIKVLLMVSNFGHCLNDLLYRWRIGALPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+ + +T+ NK E+E +L+ ++++   EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKVVVNHDIPFHLIKVTKDNKPEAEARLMALVDETGAELVVLARYMQVLSDAFCA 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P  +
Sbjct: 241 AQSPDDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGAH 288


>gi|311897860|dbj|BAJ30268.1| putative formyltetrahydrofolate deformylase [Kitasatospora setae
           KM-6054]
          Length = 287

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 131/280 (46%), Positives = 189/280 (67%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           S Y+LT++CP  + I   +  YL   GCNI+D  Q+ D  T   FMR+ F     +  + 
Sbjct: 7   SQYVLTLSCPDKQGIVHAVSSYLFMTGCNIIDSQQYGDAGTGLFFMRVHFSAEEPVTAEK 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I   F +++ I  + E  + L++VS+  HCLNDLL+R  IG L + I GVVSN
Sbjct: 67  LRASFAAIGASFRMEWQIHASAERMRVLLMVSKFGHCLNDLLFRTRIGALPVEIAGVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT  ++L E+Y +PF++LP+T   K ++EQ+L++++    V+L++LARYMQ+LSD LC  
Sbjct: 127 HTDFRELTESYGIPFHHLPVTRDTKADAEQRLLDLVAAERVDLVVLARYMQVLSDDLCKA 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RVTH 
Sbjct: 187 LSGRVINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVARVTHD 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +  +A+G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 247 VTPDQLVALGRDVECQALARAVKWHSERRVLLNGSRTVVF 286


>gi|302536000|ref|ZP_07288342.1| formyltetrahydrofolate deformylase [Streptomyces sp. C]
 gi|302444895|gb|EFL16711.1| formyltetrahydrofolate deformylase [Streptomyces sp. C]
          Length = 295

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 130/280 (46%), Positives = 186/280 (66%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           + Y+LT++CP  + I   +  YL   GCNI+D  QF D +T   FMR+ F     +  + 
Sbjct: 15  AQYVLTVSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDRETGLFFMRVHFEAEPAVTVEK 74

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I   F + + I  + E  + +++VS+  HCLNDLL+R  IG L + I  VVSN
Sbjct: 75  LRASFAAIGDSFRMDWQIHRSDERMRIVLMVSKFGHCLNDLLFRSRIGALPVEIAAVVSN 134

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT   +LV +Y +PF ++P+T+  K ++E +L+ ++ + NVEL++LARYMQ+LSD LC +
Sbjct: 135 HTDFAELVGSYDIPFVHIPVTKDTKADAEARLLELVREQNVELVVLARYMQVLSDTLCKE 194

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 195 LSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHE 254

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +  +AIG+++E + L +AV  H + RV +N  +T+VF
Sbjct: 255 VTPDQLVAIGRDVECQALARAVKWHSEHRVLLNGSRTVVF 294


>gi|52079809|ref|YP_078600.1| formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|52785179|ref|YP_091008.1| formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|319646381|ref|ZP_08000611.1| YkkE protein [Bacillus sp. BT1B_CT2]
 gi|52003020|gb|AAU22962.1| Formyltetrahydrofolate deformylase [Bacillus licheniformis ATCC
           14580]
 gi|52347681|gb|AAU40315.1| YkkE [Bacillus licheniformis ATCC 14580]
 gi|317392131|gb|EFV72928.1| YkkE protein [Bacillus sp. BT1B_CT2]
          Length = 300

 Score =  308 bits (788), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 164/282 (58%), Gaps = 4/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMK--- 58
              L ++CP    I + +  +L   G NI++ +Q+  D +  + F+RI F      +   
Sbjct: 19  KARLLVSCPDQPGIVAAVSSFLFENGANIIESNQYTTDPEGGRFFLRIEFEVQGIREKIE 78

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  + + F + +S+    E  +  I VS+  HCL++LL+ W  G L   I  V+S
Sbjct: 79  QMKAAFASVAESFQMTWSMNLASELKRVAIFVSKELHCLHELLWEWQSGNLMAEIAAVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE+  +PF Y+   +  + E E++ +  +E+   ++++LARYMQIL+     
Sbjct: 139 NHEDARETVESLNIPFLYMKANKDIRQEVEKQQLKWLEEYRADVIVLARYMQILTPDFVS 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               +IINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   ELD GPIIEQD+ RV H
Sbjct: 199 AHPNKIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNELDEGPIIEQDIERVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +E    IG+ IE  VL +AV  H++ R+ ++  KTIVF 
Sbjct: 259 RDNVEALKNIGRTIERSVLARAVKWHLEDRIIVHGNKTIVFN 300


>gi|190889899|ref|YP_001976441.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190695178|gb|ACE89263.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 294

 Score =  307 bits (787), Expect = 9e-82,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MRSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|83944246|ref|ZP_00956701.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. EE-36]
 gi|83953287|ref|ZP_00962009.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. NAS-14.1]
 gi|83842255|gb|EAP81423.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. NAS-14.1]
 gi|83844790|gb|EAP82672.1| formyltetrahydrofolate deformylase [Sulfitobacter sp. EE-36]
          Length = 294

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 149/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M +Y LT+TCPS   + + I +YL+ QGCNI D +QF+D +T   FMR+SF       + 
Sbjct: 1   MKTYALTVTCPSARGVVAAIANYLADQGCNISDSAQFDDKETGGFFMRVSFESEAEVDLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    + F + Y   +     K +I+VS+  HCLNDLLYRW IG L ++IV VVS
Sbjct: 61  TLSDGFADAARPFDMAYEFHDEAVKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N  +PF+ + +T +NK ++E +++ ++E    EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNNDIPFHCIKVTPENKADAEARIMAVVEDAGAELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGAT+HY   +LD GPIIEQD+VRVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATSHYVTADLDEGPIIEQDIVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHRRVFVNGNKTVVFPASPGSY 288


>gi|325293815|ref|YP_004279679.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325061668|gb|ADY65359.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 156/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M++Y+LT+ C S   I + I  YL+ +GCNI+D SQF+DL+T K FMR+SF+      M+
Sbjct: 1   MTTYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFISEEGATMQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP+ ++F ++  I +  +  KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AITEGFQPVAEKFGMEARIYSDGQRMKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+++IE +  EL++LARYMQ+LSD++C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIKVTKENKPQAEAQLMDLIETSGTELVVLARYMQVLSDNMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYDRGVKLIGATAHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|207742872|ref|YP_002259264.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           IPO1609]
 gi|206594266|emb|CAQ61193.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           IPO1609]
          Length = 288

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 133/287 (46%), Positives = 182/287 (63%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLQTLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 181 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|77460657|ref|YP_350164.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
 gi|77384660|gb|ABA76173.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf0-1]
          Length = 282

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I+CP    I + + ++L+     I + S  +D      FMR     +     +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLAAHNGWITEASHHSDNQVGWFFMRHEIRADSLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           ++    F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EVLREKFAPIAEEFSMDWRITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEISCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   +C
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKQPAFDEVSRLVKQHDAEVVVLARYMQILPPDMC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHKVINIHHSFLPSFVGAKPYHQASMRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|148256983|ref|YP_001241568.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. BTAi1]
 gi|146409156|gb|ABQ37662.1| formyltetrahydrofolate deformylase [Bradyrhizobium sp. BTAi1]
          Length = 287

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 123/285 (43%), Positives = 183/285 (64%), Gaps = 6/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNT 55
           MS   Y+LT++CP    I S +  +L+  G NILD  QF D +T   FMR+ F       
Sbjct: 1   MSDHQYVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFGDFETDHFFMRVVFTAADLAV 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F  I ++FS+ + +R+     + ++LVS+ DHCL D+LYRW    L++    
Sbjct: 61  NLPALQTGFAAIAERFSMDWQMRDRAAQRRVMLLVSKFDHCLVDILYRWRTRDLSMIPTA 120

Query: 116 VVSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           +VSNH        ++  +PF+++P+T++ K + EQ ++ ++E+   +L++LARYMQILSD
Sbjct: 121 IVSNHPRETYAGLDFGDIPFHHMPVTKETKRDQEQAILKLVEETKTDLVVLARYMQILSD 180

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +   ++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPII+QDV 
Sbjct: 181 EMSASLSGRCINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTRDLDEGPIIDQDVE 240

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R++H  T +D +  G++IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 241 RISHRDTPDDLVRKGRDIERRVLARAIRYHLEDRVILNGRKTVVF 285


>gi|29830389|ref|NP_825023.1| formyltetrahydrofolate deformylase [Streptomyces avermitilis
           MA-4680]
 gi|29607500|dbj|BAC71558.1| putative formyltetrahydrofolate deformylase [Streptomyces
           avermitilis MA-4680]
          Length = 293

 Score =  307 bits (787), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 185/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     +  +  
Sbjct: 14  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAEAPVTVEKL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I   ++  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 74  RASFTAIGDAFHMDWQIHRAEDRMRVVLMVSKFGHCLNDLLFRARTGALPVEIAAVVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T  NK E+E +L+ ++   N+EL++LARYMQ+LSD LC ++
Sbjct: 134 TDFAELVASYDIPFHHIPVTRDNKAEAEAQLLELVRSENIELVVLARYMQVLSDDLCKQL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 194 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 254 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 292


>gi|149926683|ref|ZP_01914943.1| formyltetrahydrofolate deformylase [Limnobacter sp. MED105]
 gi|149824612|gb|EDM83828.1| formyltetrahydrofolate deformylase [Limnobacter sp. MED105]
          Length = 284

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 132/283 (46%), Positives = 179/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M  YILTI+CP    I   +  +L  Q CNILD +QF D  T+  F+R+ F      +L 
Sbjct: 1   MRDYILTISCPDTTGIVYNVSKFLFDQQCNILDSAQFGDESTNLFFLRVHFSLPLESQLT 60

Query: 61  I----ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                A+F  +   F+++Y   + +   + L++VS+  HCLNDLL+RW  G L   I  +
Sbjct: 61  EVELQANFAKVAAPFAMKYQFFDARVKPRVLLMVSKFGHCLNDLLFRWKSGQLPCEIPAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     L  +Y +PFY+LP+  + K   E ++  IIE+  ++L++LARYMQILS  L
Sbjct: 121 VSNHQDFALLAASYGVPFYHLPVKAEAKELQETQIRQIIEREKIDLVVLARYMQILSPEL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  M GR+INIHHSFLPSFKGA PY+QA++ GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 181 CRDMLGRVINIHHSFLPSFKGAKPYQQAFDRGVKLIGATAHYVTSDLDEGPIIEQDVARV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T E+  A G++ E  VL +AV  H + RV +N  KT+VF
Sbjct: 241 DHSLTPEELTARGRDTECMVLARAVKWHCEHRVVLNGSKTVVF 283


>gi|300703773|ref|YP_003745375.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum
           CFBP2957]
 gi|299071436|emb|CBJ42755.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum
           CFBP2957]
          Length = 288

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 133/287 (46%), Positives = 182/287 (63%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLQTLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQEARIGEIIEEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 181 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|226314544|ref|YP_002774440.1| formyltetrahydrofolate deformylase [Brevibacillus brevis NBRC
           100599]
 gi|226097494|dbj|BAH45936.1| formyltetrahydrofolate deformylase [Brevibacillus brevis NBRC
           100599]
          Length = 298

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 120/282 (42%), Positives = 173/282 (61%), Gaps = 6/282 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMK 58
              + I+CP    I + + ++L  QG NI+   Q+  D +T + FMRI F     +   +
Sbjct: 19  RARMLISCPDRAGIVAAVSNFLFQQGANIVQSDQYTTDPETGRFFMRIEFDLINLDERCE 78

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ + F +++S+    +  K  + VS+ DHCL +LL+RW  G L  +I  VVS
Sbjct: 79  EIKQAFSPVAESFGMEWSLVEANKRKKVALFVSKEDHCLLELLWRWKSGELFADIAVVVS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +P+  +P+T+ NK ++E++ I       V+L++LARYMQILS     
Sbjct: 139 NHPDMQETVESFGIPYRCIPVTKDNKPQAEEEQIA--AAEGVDLIVLARYMQILSPRFLE 196

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GA PY+QAY  GVK+IGATAHY   ELDAGPIIEQDV RV+H
Sbjct: 197 DYAMRIINIHHSFLPAFVGAKPYEQAYRRGVKLIGATAHYVTEELDAGPIIEQDVQRVSH 256

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            + +E    +G+ +E  VL +AV  H++ RV +   KTIVFP
Sbjct: 257 QEDVETLKQLGRQVERTVLARAVRWHLEDRVLVYGNKTIVFP 298


>gi|209551777|ref|YP_002283694.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537533|gb|ACI57468.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 294

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 155/288 (53%), Positives = 217/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKSYVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 61  I--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   FS++Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  EIGADFAAVAAPFSMEYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E  ++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEAHIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|86605467|ref|YP_474230.1| formyltetrahydrofolate deformylase [Synechococcus sp. JA-3-3Ab]
 gi|86554009|gb|ABC98967.1| formyltetrahydrofolate deformylase [Synechococcus sp. JA-3-3Ab]
          Length = 282

 Score =  307 bits (786), Expect = 1e-81,   Method: Composition-based stats.
 Identities = 100/282 (35%), Positives = 165/282 (58%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +  L ++CP  + + + + +++ +   NIL      DL+      RI +         
Sbjct: 1   MPTATLLVSCPDQKGLVAKLSNFIYSYDGNILHADHHTDLEAGLFLSRIEWDLEGFRLER 60

Query: 61  IAD---FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  I +     + +  +    +  + VS+  HCL DL++R   G L   I  ++
Sbjct: 61  SEIVPAFSGIARGIQANWELHFSDTRRRIAVWVSKQPHCLLDLIWRQRAGELPAEIPLII 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L  ++ + +Y++P++ +N+ E+E + + ++++  ++L++LA+YMQ+LS  L 
Sbjct: 121 SNHPDLEPLARSFGIDYYHIPVSPENRAEAEARQLALLQEYRIDLVVLAKYMQVLSGWLL 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +    +INIHHS LP+F GANPY++A++ GVKIIGATAHYA  ELD GPIIEQDVVRV+
Sbjct: 181 RQAP-PVINIHHSTLPAFAGANPYQRAHQRGVKIIGATAHYATEELDEGPIIEQDVVRVS 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+ D I  G+++E  VL +AV  H++ RV +   KT+VF
Sbjct: 240 HRDTVADLIRKGRDVERLVLARAVRYHLENRVLVYCNKTVVF 281


>gi|121603212|ref|YP_980541.1| formyltetrahydrofolate deformylase [Polaromonas naphthalenivorans
           CJ2]
 gi|120592181|gb|ABM35620.1| formyltetrahydrofolate deformylase [Polaromonas naphthalenivorans
           CJ2]
          Length = 282

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 185/281 (65%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    I   +  +L   G NI + +Q+ND DT   FMR+ F  +    +
Sbjct: 1   MNHAYILTLSCPDRRGIVHAVSGFLFEHGGNIEEAAQYNDPDTGLFFMRVRFACDELAPE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +  +   + F + + + +T +  +T+ILVS+  HCLNDLL+RW  G L L++  ++S
Sbjct: 61  ALSSQLKTFAEPFEMNWKLHDTTQPMRTVILVSKEGHCLNDLLFRWKSGLLPLDVRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF++LP++   K + E + + IIE    EL++LARYMQILS+ +C 
Sbjct: 121 NHRDFYQLAASYNIPFHHLPVSAATKGQVEARQLEIIEAEGAELVVLARYMQILSNDMCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++T+ED  A+G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 SKTVEDLTAMGRDTESQVLARAVKWHSEHRVVLNGHKTVIF 281


>gi|312962785|ref|ZP_07777272.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
 gi|311282812|gb|EFQ61406.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
          Length = 282

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFGL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T++  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWHITDTEQKKRVVLMASRESHCLADLLHRWHSDELDCEIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHIPVDPQDKEPAFAEVSRLVKQHEADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  G++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAGKVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|260577260|ref|ZP_05845234.1| formyltetrahydrofolate deformylase [Rhodobacter sp. SW2]
 gi|259020504|gb|EEW23826.1| formyltetrahydrofolate deformylase [Rhodobacter sp. SW2]
          Length = 294

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 207/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M SY+L + C S   I + I  +L+  GCNI D +QF+D  T   FMRI+F         
Sbjct: 1   MKSYVLVVKCVSTRGIVAAISGFLAQNGCNITDSAQFDDAQTGMFFMRITFRSEAGVSAA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   FS+ ++I +     K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  DLTAGFAAVADGFSMDWAIHDAAHRVKVLLMVSNFGHCLNDLLYRWRIGGLPIEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ LPF+ + +T+ NK ++E +L+ ++E++  EL++LARYMQ+LSD  C 
Sbjct: 121 NHLTYQKLVVNHDLPFHLIKVTKDNKADAEARLLALVEESGAELVVLARYMQVLSDAFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAH+   +LD GPIIEQD VRVTH
Sbjct: 181 RMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHFVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA VL++A++AHI  RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVEASVLSRAIHAHIHHRVFLNGNKTVVFPASPGSY 288


>gi|218296480|ref|ZP_03497208.1| formyltetrahydrofolate deformylase [Thermus aquaticus Y51MC23]
 gi|218243022|gb|EED09554.1| formyltetrahydrofolate deformylase [Thermus aquaticus Y51MC23]
          Length = 285

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 119/284 (41%), Positives = 178/284 (62%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFV---FNTC 56
           M    L ITCP    I + +  +L   G NI D+ Q   D +    FMR++F     +  
Sbjct: 1   MEEARLLITCPDRPGIVAAVTGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +  ++F + + +    E  +T ILVS+P H L +LL+R+ +G L +++  
Sbjct: 61  RPALERAFQEVVAERFGMAWRLAFASERKRTAILVSKPAHALLELLWRYRVGELPMDLRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           VVSNH  H++ VE + +P++++P+  + K E+E +++ ++E+  VEL++LARYMQILS  
Sbjct: 121 VVSNHPDHREEVERFGIPYHHVPVERERKEEAEGRILALLEEAGVELLVLARYMQILSPS 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GANPY+QAYE GVK+IGATAHY   ELD GPIIEQDV R
Sbjct: 181 FVARFPMRIINIHHSFLPAFAGANPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVAR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++E+   +G+ +E  VL +AV  H++ R+ +   KT+VF
Sbjct: 241 VSHRHSVEELRRLGQELERTVLARAVRWHLEDRILVQGNKTVVF 284


>gi|297200447|ref|ZP_06917844.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
 gi|197709569|gb|EDY53603.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
          Length = 292

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 187/279 (67%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     +     
Sbjct: 13  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAEAPVTVDKL 72

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I   ++  + +++VS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 73  RASFAAIGDSFHMDWQIHRAEDKMRVVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNH 132

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T +NK E+E +L+ ++ + +VEL++LARYMQ+LSD LC ++
Sbjct: 133 TDFAELVGSYDIPFHHIPVTRENKAEAEARLLELVREQDVELVVLARYMQVLSDDLCKQL 192

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 193 SGKIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 252

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 253 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 291


>gi|319761222|ref|YP_004125159.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           BC]
 gi|330823089|ref|YP_004386392.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           K601]
 gi|317115783|gb|ADU98271.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           BC]
 gi|329308461|gb|AEB82876.1| formyltetrahydrofolate deformylase [Alicycliphilus denitrificans
           K601]
          Length = 282

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 121/277 (43%), Positives = 177/277 (63%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIA 62
           YILT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F  +         
Sbjct: 5   YILTLSCPDRLGLVHAVSGFLLEHGGNIEEAAQYNDDATGLFFMRVQFACSQHDGATLKE 64

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
                 + +++++S+    EA +T++LVS+  HCLNDLL+R   G L +++  ++SNH  
Sbjct: 65  HLARFAEPYAMRWSLHAKAEAMRTVLLVSREGHCLNDLLFRVKSGLLPIDVRAIISNHRD 124

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
             +L  +Y +PF+++P+T   K ++E +   IIE    EL++LARYMQ+LS+ LC ++ G
Sbjct: 125 FYQLAASYNIPFHHIPVTAATKAQAEARQYEIIESEGAELVVLARYMQVLSNELCARLAG 184

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T+
Sbjct: 185 RAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHTDTV 244

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 245 EDLTARGRDTESQVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|56750546|ref|YP_171247.1| formyltetrahydrofolate deformylase [Synechococcus elongatus PCC
           6301]
 gi|56685505|dbj|BAD78727.1| phosphoribosylglycinamide formyltransferase [Synechococcus
           elongatus PCC 6301]
          Length = 284

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 110/284 (38%), Positives = 165/284 (58%), Gaps = 6/284 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           M   +  L I+CP  + + + I +++   G NI+D  Q  D +      RI +    FN 
Sbjct: 1   MKRPTATLLISCPDQQGLVARISNFIFANGGNIIDADQHTDFEAGLFLSRIEWELTGFNL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +L    F+ + +    Q+ +  +    +  + VS+ DHCL DLL+R   G L   I  
Sbjct: 61  DRELIGPAFEAVARPLGAQWQLHFSDRKPRLSLWVSKQDHCLLDLLWRQQAGELDAEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   + + E + + F +LP+T + K E E + +  I    ++L++LA+YMQ LS  
Sbjct: 121 IISNHDKLRPIAEQFGIDFLHLPITRETKAEQEARQLAAIADYGIDLVVLAKYMQALSSE 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   ++INIHHSFLP+F GANPY++AYE GVKIIGATAHY   +LD GPIIEQDVVR
Sbjct: 181 FLAQFP-QVINIHHSFLPAFAGANPYQRAYERGVKIIGATAHYVTPDLDEGPIIEQDVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H    +D +  GK++E  VL +AV  H+Q RV   + +T+VF
Sbjct: 240 VSHRDDADDLVRKGKDLERIVLARAVRLHLQHRVLTYRNRTVVF 283


>gi|17546592|ref|NP_519994.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum GMI1000]
 gi|17428891|emb|CAD15575.1| probable formyltetrahydrofolate deformylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 288

 Score =  306 bits (784), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 132/287 (45%), Positives = 182/287 (63%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLQALRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFLHLPLLKGTDAQKAQQEARIREIIEEQRIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC ++ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 181 SDDLCRQLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|163746436|ref|ZP_02153794.1| putative formyltetrahydrofolate deformylase [Oceanibulbus indolifex
           HEL-45]
 gi|161380321|gb|EDQ04732.1| putative formyltetrahydrofolate deformylase [Oceanibulbus indolifex
           HEL-45]
          Length = 294

 Score =  306 bits (784), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 147/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M+ + LT+TCPS   I + I  Y++  GCNI D +QF+D D  + FMR+S    T   ++
Sbjct: 1   MTKFCLTVTCPSRRGIVAAIAKYIAENGCNITDSAQFDDADNGQFFMRVSAEAETGNTLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  I + F + Y   +T    K +++VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  DLRAGFAEIAEPFGMDYKFHDTDSTMKVVVMVSRFGHCLNDLLYRVRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK E+E +++ ++E    EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHHIKVTKENKSEAEARIMEVVEDAGAELIVLARYMQILSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+VR+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E+ VL++A++AH   RVF+N  KT+VFPA P +Y
Sbjct: 241 AQSASDYVSLGRDVESGVLSRAIHAHAHHRVFLNGNKTVVFPASPGSY 288


>gi|290959549|ref|YP_003490731.1| formyltetrahydrofolate deformylase [Streptomyces scabiei 87.22]
 gi|260649075|emb|CBG72189.1| putative formyltetrahydrofolate deformylase [Streptomyces scabiei
           87.22]
          Length = 293

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 130/279 (46%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT+ CP    I   +  YL   G NI D  QF D DT   FMR+ F     +  +  
Sbjct: 14  QYVLTLACPDKPGIVHAVSSYLFMTGGNIEDSQQFGDHDTGLFFMRVHFSAEAPVNVEKL 73

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I    E  + +++VS+  HCLNDLL+R +IG L + I  VVSNH
Sbjct: 74  RASFAAIGDSFRMDWQINRADEKMRVVLMVSRFGHCLNDLLFRASIGALPVEIAAVVSNH 133

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T+  K ++E +++ I+ + NVEL++LARYMQ+LSD LC ++
Sbjct: 134 TDFAELVRSYDIPFHHVPVTKDTKAQAEARILEIVREENVELVVLARYMQVLSDDLCKQL 193

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 194 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHGV 253

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +A+G+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 254 TPEGLVAVGRDVECQALARAVKWHAERRILMNGRRTVVF 292


>gi|307327708|ref|ZP_07606892.1| formyltetrahydrofolate deformylase [Streptomyces violaceusniger Tu
           4113]
 gi|306886606|gb|EFN17608.1| formyltetrahydrofolate deformylase [Streptomyces violaceusniger Tu
           4113]
          Length = 289

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            YILT++CP  + I   +  YL   GCNI D  QF D DT   FMR++F   + +  +  
Sbjct: 10  QYILTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDRDTGLFFMRVAFRAVSPVKVEDL 69

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  + + F + + I       + L++VS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 70  RASFAAVGESFQMDWEIHPADRKMRILLMVSKFGHCLNDLLFRSRIGALPVEIAAVVSNH 129

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T  ++LV +Y +PF++LP+T+  K E+E  L++++   +VEL++LARYMQ+LSD LC  +
Sbjct: 130 TDFEELVGSYGIPFHHLPVTKDTKQEAEAWLLDLVRTEHVELVVLARYMQVLSDDLCKAL 189

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 190 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHEL 249

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +A+G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 250 TPDQLVAVGRDVECQALARAVKWHSERRVLLNGHRTVVF 288


>gi|81299817|ref|YP_400025.1| formyltetrahydrofolate deformylase [Synechococcus elongatus PCC
           7942]
 gi|81168698|gb|ABB57038.1| formyltetrahydrofolate deformylase [Synechococcus elongatus PCC
           7942]
          Length = 284

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 110/281 (39%), Positives = 166/281 (59%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L I+CP  + + + I +++   G NI+D  Q  D +      RI +    FN   +
Sbjct: 4   ATATLLISCPDQQGLVARISNFIFANGGNIIDADQHTDFEAGLFLSRIEWELTGFNLDRE 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           L    F+ I +    Q+ +  +    +  + VS+ DHCL DLL+R   G L   I  ++S
Sbjct: 64  LIGPAFEAIARPLGAQWQLHFSDRKPRLSLWVSKQDHCLLDLLWRQQAGELDAEIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E + + F +LP+T + K E E + +  I    ++L++LA+YMQ+LS     
Sbjct: 124 NHDKLRPIAEQFGIDFLHLPITRETKAEQEARQLAAIADYGIDLVVLAKYMQVLSSEFLA 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   ++INIHHSFLP+F GANPY++AYE GVKIIGATAHY   +LD GPIIEQDVVRV+H
Sbjct: 184 QFP-QVINIHHSFLPAFAGANPYQRAYERGVKIIGATAHYVTPDLDEGPIIEQDVVRVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D +  GK++E  VL +AV  H+Q RV   + +T+VF
Sbjct: 243 RDDADDLVRKGKDLERIVLARAVRLHLQHRVLTYRNRTVVF 283


>gi|329941335|ref|ZP_08290614.1| formyltetrahydrofolate deformylase [Streptomyces griseoaurantiacus
           M045]
 gi|329299866|gb|EGG43765.1| formyltetrahydrofolate deformylase [Streptomyces griseoaurantiacus
           M045]
          Length = 295

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 128/279 (45%), Positives = 183/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI+D  QF D DT   FMR+ F     +  +  
Sbjct: 16  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDQDTGLFFMRVHFSAEPSVTSEKL 75

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I    E  + +++VS+  HCLNDLL+R   G L + I  VVSNH
Sbjct: 76  RASFAAIGDSFHMDWQIHRADEKMRIVLMVSRFGHCLNDLLFRARTGALPVEIAAVVSNH 135

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T + K ++E +L+ I+ +  VEL++LARYMQ+LSD LC K+
Sbjct: 136 TDFAELVASYGIPFHHVPVTRETKADAEARLLGIVREAEVELVVLARYMQVLSDDLCKKL 195

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 196 NGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 255

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +A+G+++E + L +AV  H ++R+ +N  +T++F
Sbjct: 256 TPDQLVAVGRDVECQALARAVKWHAERRILLNGHRTVIF 294


>gi|330811419|ref|YP_004355881.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327379527|gb|AEA70877.1| Putative formyltetrahydrofolate deformylase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 282

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 110/282 (39%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNQSGWFFMRHEIRADSLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I +T +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  EAFREAFAPIAEEFSMDWRITDTAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  Q+K  +  ++  ++++++ E+++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYYHVPVNPQDKQPAFAEVSRLVKQHDAEVVVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHKVINIHHSFLPSFVGAKPYHQASMRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +IED +  G+++E  VL + +  H++ RV ++  KT+VF
Sbjct: 241 HSDSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVF 282


>gi|260222615|emb|CBA32352.1| Formyltetrahydrofolate deformylase [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 327

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 128/281 (45%), Positives = 186/281 (66%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMK 58
           MS +YILT +CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F  +     
Sbjct: 46  MSQTYILTFSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDHDTGLFFMRVQFSCSQLSHA 105

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +      +   LQ++++   +  +T+I+VS+  HCLNDLL+RW  G L L+I  +VS
Sbjct: 106 ELKSQLGTFAEPLKLQWNLQTVAQPMRTVIMVSKEGHCLNDLLFRWKSGLLPLDIRAIVS 165

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E K + IIE    EL++LARYMQILSD++C 
Sbjct: 166 NHREFYQLAASYNVPFHHIPVTAATKEQAEAKQLEIIEAEGAELVVLARYMQILSDNMCR 225

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H
Sbjct: 226 QLNGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARVDH 285

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++T+ED   +G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 286 SRTVEDLTTLGRDTESQVLARAVKWHSEHRVLLNGHKTVIF 326


>gi|193213317|ref|YP_001999270.1| formyltetrahydrofolate deformylase [Chlorobaculum parvum NCIB 8327]
 gi|193086794|gb|ACF12070.1| formyltetrahydrofolate deformylase [Chlorobaculum parvum NCIB 8327]
          Length = 289

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 112/282 (39%), Positives = 183/282 (64%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S  +L ++CP    + + I +++  +G NILD+++  D+D  + F+R+S+    F+    
Sbjct: 8   SKAVLLLSCPDRVGLVARIANFIYERGGNILDLNEHVDVDERQFFLRVSWSLDNFSIPAD 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ ++F   ++IR +    +  + VS+ DHCL ++L+R ++G   ++I  V+S
Sbjct: 68  DLESAFAPLAREFRANWTIRFSGTRNRMAVFVSKYDHCLREILWRHSLGEFDIDIPLVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     LVE + +PF+ +P+T + K  +EQ+ + + E++ ++ ++LARYMQ+LS     
Sbjct: 128 NHPDLAPLVEAHGIPFHVVPVTPETKAAAEQRQMALCEEHGIDTIVLARYMQVLSPEFTG 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F G NPY+QAY  GVK+IGAT+HY   ELD GPIIEQD++R+TH
Sbjct: 188 RWAGRIINIHHSFLPAFVGGNPYRQAYRRGVKLIGATSHYVTDELDEGPIIEQDIIRITH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             T++D +  G+++E  VL +A+  H   R+ IN RKT+VF 
Sbjct: 248 RDTLDDLVRKGRDLERLVLARALRLHCDHRILINGRKTVVFD 289


>gi|310815109|ref|YP_003963073.1| formyltetrahydrofolate deformylase protein [Ketogulonicigenium
           vulgare Y25]
 gi|308753844|gb|ADO41773.1| formyltetrahydrofolate deformylase protein [Ketogulonicigenium
           vulgare Y25]
          Length = 294

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 152/288 (52%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           MS+YILT+TC +   I + +  +L+  GCNI D +QF+D+ T K FMRIS        + 
Sbjct: 1   MSNYILTVTCATTRGIVAAVSGFLAENGCNITDSAQFDDVLTGKFFMRISVTSQEGATLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F  +  +F ++++  +  E  K +I+VS+  HCLNDLLYR  IG L ++IVGV+S
Sbjct: 61  DLQSRFATVGARFGMEFAFFDASERVKAVIMVSRFGHCLNDLLYRQRIGALPIDIVGVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++KLV N+ +PF+++ +T QNK E+E   + I+ +   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKLVVNHDIPFHHIRVTPQNKPEAEAAQMQILRETGAELVVLARYMQILSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++E++VL +A++AHI +RVFIN  KT+VFPA P +Y
Sbjct: 241 AQSPEDYVSLGRDVESQVLARAIHAHIHRRVFINGNKTVVFPASPGSY 288


>gi|297158245|gb|ADI07957.1| formyltetrahydrofolate deformylase [Streptomyces bingchenggensis
           BCW-1]
          Length = 290

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 131/279 (46%), Positives = 183/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
            YILT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F       ++  
Sbjct: 11  QYILTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDRDTGLFFMRVHFRAVSPVRVEDL 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  + + F + + I    E  + ++LVS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 71  RASFAAVGESFQMDWQIHPAAEKMRVVLLVSKFGHCLNDLLFRSRIGALPVEIAAVVSNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF ++P+T++NK ++E +L+ ++E   VEL++LARYMQ+LSD LC ++
Sbjct: 131 TDFAELVGSYGVPFRHIPVTKENKAQAEAELLELVEAEKVELVVLARYMQVLSDDLCKRL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 191 AGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHEL 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +  +A G+++E + L +AV  H ++RV +N  +T+VF
Sbjct: 251 NPDQLVAAGRDVECQALARAVKWHSERRVLLNGHRTVVF 289


>gi|239817750|ref|YP_002946660.1| formyltetrahydrofolate deformylase [Variovorax paradoxus S110]
 gi|239804327|gb|ACS21394.1| formyltetrahydrofolate deformylase [Variovorax paradoxus S110]
          Length = 285

 Score =  306 bits (783), Expect = 3e-81,   Method: Composition-based stats.
 Identities = 128/284 (45%), Positives = 178/284 (62%), Gaps = 5/284 (1%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC 56
           M++    YILT++CP    I   +  +L  +G NI + +Q+ND DT   FMR+ F  +  
Sbjct: 1   MTTTTPAYILTLSCPDRTGIVHAVSGFLLERGGNIEEAAQYNDHDTGLFFMRVRFACSDH 60

Query: 57  MKLF-IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +             F +   +    E  KT+ILVS+  HCLNDLL+RW  G LA+++  
Sbjct: 61  PEAALREQLATFGAGFGMSLQLHAAAEPMKTVILVSKEGHCLNDLLFRWKSGLLAIDVRA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH    +L  +Y +PF+++P+T   K + E K + IIE    EL++LARYMQILS+ 
Sbjct: 121 IISNHRDFYQLAASYNVPFHHIPVTAATKAQGEAKQLEIIESEGAELVVLARYMQILSNG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 181 LCKSLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVAR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             H  T+ED  A G++ E++VL +AV  H + RV +N  +T+VF
Sbjct: 241 ADHTDTVEDLTARGRDTESQVLARAVKWHSEHRVLLNGHRTVVF 284


>gi|222106953|ref|YP_002547744.1| formyltetrahydrofolate deformylase [Agrobacterium vitis S4]
 gi|221738132|gb|ACM39028.1| formyltetrahydrofolate deformylase [Agrobacterium vitis S4]
          Length = 294

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 155/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M+SY+LT++CPS   I + +  YL+  GCNI+D SQF+DLDT + FMR+SF+       +
Sbjct: 1   MTSYVLTVSCPSKRGIVAALSGYLAEMGCNIVDSSQFDDLDTDRFFMRVSFISEQGASRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A   PIV  F ++  + ++ E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  KIEAGLAPIVDNFQMEIGLYDSTERVKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK ++E +L+ ++++   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKDNKPQAEAQLMELVQQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQA+E GVK+IGATAHY   +LD GPIIEQDV RVTH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAFERGVKLIGATAHYVTADLDEGPIIEQDVARVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ  EDY++IG+++E++VL +A++AHI  R FIN  K++VFPA P +Y
Sbjct: 241 AQNAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNKSVVFPASPGSY 288


>gi|91786348|ref|YP_547300.1| formyltetrahydrofolate deformylase [Polaromonas sp. JS666]
 gi|91695573|gb|ABE42402.1| formyltetrahydrofolate deformylase [Polaromonas sp. JS666]
          Length = 282

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 128/281 (45%), Positives = 183/281 (65%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMK 58
           M+  YILT++CP    I   +  +L   G NI + +Q+ND DT   FMR+ F  +    +
Sbjct: 1   MNHAYILTLSCPDRRGIVHAVSGFLLQNGGNIEEAAQYNDHDTGLFFMRVQFACDQLTHE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +   + F + + +  T +  +T+I+VS+  HCLNDLL+R   G L L++  +VS
Sbjct: 61  ELSQQLKGFAEPFQMNWKLHATTQPMRTVIMVSKEGHCLNDLLFRCKSGLLPLDVRAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF++ P+T  +K + E K + IIE    EL++LARYMQILS+ LC 
Sbjct: 121 NHREFYQLAASYNIPFHHFPVTAASKAQVEDKQLEIIESEGAELVVLARYMQILSNDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H
Sbjct: 181 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVARVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++T+ED  A+G++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 SKTVEDLTAMGRDTESQVLARAVKWHSEHRVLLNGHKTVIF 281


>gi|319796076|ref|YP_004157716.1| formyltetrahydrofolate deformylase [Variovorax paradoxus EPS]
 gi|315598539|gb|ADU39605.1| formyltetrahydrofolate deformylase [Variovorax paradoxus EPS]
          Length = 291

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 123/277 (44%), Positives = 175/277 (63%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKLFIA 62
           YIL ++CP    I   +  +L  +G NI + +Q+ND  T   FMR+ F   +        
Sbjct: 14  YILNLSCPDRTGIVHAVSGFLLERGANIEEAAQYNDHGTGLFFMRVRFACSDHSEAALRE 73

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           + +     F +   +    E  KT+ILVS+  HCLNDLL+RW  G L++++  ++SNH  
Sbjct: 74  ELKTFAAGFGMNLQLHAAAEPMKTVILVSKEGHCLNDLLFRWKSGLLSIDVRAIISNHRD 133

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
             +L  +Y +PF+++P+T   K ++E K + IIE    EL++LARYMQ+LS+ LC  + G
Sbjct: 134 FYQLAASYNVPFHHIPVTAATKPQAEAKQLEIIEAEGAELVVLARYMQVLSNDLCKSLAG 193

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H  T+
Sbjct: 194 RAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADHTDTV 253

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED  A G++ E++VL +AV  H + RV +N  +T+VF
Sbjct: 254 EDLTARGRDTESQVLARAVKWHSEHRVLLNGHRTVVF 290


>gi|254385822|ref|ZP_05001142.1| formyltetrahydrofolate deformylase [Streptomyces sp. Mg1]
 gi|194344687|gb|EDX25653.1| formyltetrahydrofolate deformylase [Streptomyces sp. Mg1]
          Length = 291

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 128/280 (45%), Positives = 186/280 (66%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKL 59
             Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F   T   ++ 
Sbjct: 11  QQYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSRQFGDHDTGLFFMRVHFSAETPVTLEK 70

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I   F + + +  +    + +++VS+  HCLNDLL+R +IG L + I  VVSN
Sbjct: 71  LRASFAAIGDSFRMDWELHRSDARMRIVLMVSKFGHCLNDLLFRASIGALPVEIAAVVSN 130

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT  ++LV +Y +PF ++P+T+  K  +E++L+ ++ + +VEL++LARYMQ+LSD LC +
Sbjct: 131 HTDFEELVGSYDIPFVHIPVTKDTKAAAEERLLELVREQDVELVVLARYMQVLSDTLCKE 190

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H 
Sbjct: 191 LSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHE 250

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +  +A+G+++E + L +AV  H + RV +N  +T+VF
Sbjct: 251 VTPDQLVAVGRDVECQALARAVKWHSEHRVLLNGSRTVVF 290


>gi|154248622|ref|YP_001419580.1| formyltetrahydrofolate deformylase [Xanthobacter autotrophicus Py2]
 gi|154162707|gb|ABS69923.1| formyltetrahydrofolate deformylase [Xanthobacter autotrophicus Py2]
          Length = 289

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 123/287 (42%), Positives = 188/287 (65%), Gaps = 8/287 (2%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VF 53
           M++    +ILT +CP+   I + +  +L  +GCNIL+  QF+D +T++ FMR+ F     
Sbjct: 1   MTTPSDHFILTFSCPNKPGIVAGVSTFLFEKGCNILEAQQFDDTETNRFFMRVVFNVVAS 60

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +      F  + + F+L +++R   E  + L+L S+ DHCL DLLYRW IG + ++I
Sbjct: 61  EASLSEIREGFTAVAEGFALNWTLRPKAEKRRVLLLASKFDHCLADLLYRWRIGEIPMDI 120

Query: 114 VGVVSNHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
            G++SNH        ++  +PF++LP+T+  K+E E K+  I + +  EL +LARYMQ+L
Sbjct: 121 TGIISNHPRETYAHLDFDGIPFHHLPVTKATKLEQETKIWEIFQSSGSELAVLARYMQVL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD L  K++G+ INIHHSFLP FKGA PY QA+  GVK++GAT+HY   +LD GPIIEQD
Sbjct: 181 SDGLTAKLSGKCINIHHSFLPGFKGAKPYHQAHARGVKLMGATSHYVTSDLDEGPIIEQD 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V R++H  + ED +  G++IE +VL +A++ H+Q RV +N  +T+VF
Sbjct: 241 VERISHQDSPEDLVRKGRDIERRVLARAISWHLQDRVLLNGSRTVVF 287


>gi|325962558|ref|YP_004240464.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468645|gb|ADX72330.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 330

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 121/277 (43%), Positives = 177/277 (63%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           Y++T++CP    I   +   L   GCNI D  Q+    T   FMR+            A 
Sbjct: 54  YVVTLSCPDRPGIVHAVAGALLVAGCNITDSQQYGSPVTGNFFMRVEVTTAAPASELRAA 113

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
            +P+   F +Q+S+    +  +TL++ S   HCLNDLL++   GTL + I  +VSNH   
Sbjct: 114 LEPVAGAFGMQWSLNAVGQKVRTLVMASTSAHCLNDLLFQQRSGTLPIEIPAIVSNHQDL 173

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L E Y +PF+Y+P+T++ K ++E KL  ++ ++++EL +LARYMQILSD LC ++TG+
Sbjct: 174 AGLAEFYGIPFHYIPVTKETKAQAEDKLRALMAEHDIELTVLARYMQILSDELCSELTGK 233

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
            INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V+RV HA+T E
Sbjct: 234 AINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTAALDEGPIIEQEVIRVDHARTPE 293

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            ++ +G+++E + L +AV  H + RV ++  +T+VF 
Sbjct: 294 QFVQMGRDVEGRTLVQAVQWHAEHRVLLDGNRTVVFN 330


>gi|300691173|ref|YP_003752168.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum PSI07]
 gi|299078233|emb|CBJ50880.1| Formyltetrahydrofolate deformylase [Ralstonia solanacearum PSI07]
          Length = 288

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/287 (45%), Positives = 184/287 (64%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLQTLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K++ E ++ +I+E+  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFLHLPLLKGTDAQKVQQEARIWDIVEEQRIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC ++ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 181 SDDLCRRLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|168699784|ref|ZP_02732061.1| formyltetrahydrofolate deformylase [Gemmata obscuriglobus UQM 2246]
          Length = 284

 Score =  305 bits (782), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 105/282 (37%), Positives = 173/282 (61%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++ +L ITCP  + I + + ++L     NIL   Q  D +    FMR+ +    F   + 
Sbjct: 3   NTAVLLITCPDRKGIVAAVAEFLYKHDANILHADQHQDAEGKLFFMRVEWDLSGFALDLA 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F P+  +F +++ + +++   +  + VS+ DHCL DLLYR   G L   I  +V+
Sbjct: 63  EFSRRFSPLADRFEMRWRLEDSRNPLRVALFVSKYDHCLMDLLYRHKTGELLCEIPVIVA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +K  + Y +PF+ +P+   +K  +E+K ++++    ++L+++ARYMQILS     
Sbjct: 123 NHPDAQKWGDFYGVPFHVIPVPAGDKEAAERKQLDLLAAEKIDLVVMARYMQILSREFVA 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   R+IN+HHSFLP+F GA PY +A+E GVK+IGAT+HYA  +LD GPIIEQDVVR++H
Sbjct: 183 RYPQRVINVHHSFLPAFMGARPYHRAFERGVKLIGATSHYATEDLDEGPIIEQDVVRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED +  G+++E  VL++AV  H+  R+ +   K+++F 
Sbjct: 243 RDGLEDLLEKGRDLEKVVLSRAVRWHLDHRILVYNHKSVIFD 284


>gi|297193747|ref|ZP_06911145.1| formyltetrahydrofolate deformylase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|297151924|gb|EFH31430.1| formyltetrahydrofolate deformylase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 289

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 131/282 (46%), Positives = 185/282 (65%), Gaps = 3/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-- 57
           M+  Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F   T +  
Sbjct: 7   MTDQYVLTLSCPDKQGIVHAVSSYLFITGCNIEDSRQFGDRDTGLFFMRVHFSAETPVTV 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               A F  +   F + + I    E  + +++VS+  HCLNDLL+R   G L + I  VV
Sbjct: 67  DKLRASFAAVGDAFQMDWQIHLADERMRIVLMVSKFGHCLNDLLFRSRTGALPVEIAAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT   +LV +Y +PF+++P+T+ NK  +E +L++++    VEL++LARYMQ+LSD LC
Sbjct: 127 SNHTDFAELVASYDIPFHHIPVTKDNKAAAEAQLLDLVHAEQVELVVLARYMQVLSDDLC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 187 KQLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVG 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 247 HEVTPEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVF 288


>gi|94985588|ref|YP_604952.1| formyltetrahydrofolate deformylase [Deinococcus geothermalis DSM
           11300]
 gi|94555869|gb|ABF45783.1| formyltetrahydrofolate deformylase [Deinococcus geothermalis DSM
           11300]
          Length = 296

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 171/283 (60%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNT---CM 57
           ++ +LTITCP    I + +  +L + G NIL   Q   D      FMR+ F  +      
Sbjct: 14  NTAVLTITCPDRGGIVAAVSQFLFSHGANILHSDQHSTDPAGGTFFMRMEFHLDGLDLAR 73

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + F   F  +    F + + +  T +  +  ILVS+ DHC  DLL+R   G L + I  V
Sbjct: 74  EPFERAFAQVIAAPFGMDWRLSYTAQPKRMAILVSRYDHCFLDLLWRRRRGELNVEIPLV 133

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH    +  + + +PF+ +P+T +NK E+E + + ++++   +  +LARYMQILS   
Sbjct: 134 ISNHPDLARDADMFGIPFHVVPVTRENKAEAEAEQVRLLQEAGADFAVLARYMQILSGDF 193

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +    +INIHHSFLP+F GANPY+ A++ GVK+IGAT+HY   ELDAGPII QDV+ V
Sbjct: 194 LREFGRPVINIHHSFLPAFVGANPYRAAFQRGVKLIGATSHYVTEELDAGPIIAQDVIPV 253

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH +T +  + +G+++E +VL +AV AH++ RV ++  KT+VF
Sbjct: 254 THRETPDTLMRLGRDVERQVLARAVKAHVEDRVLVHGNKTVVF 296


>gi|32141235|ref|NP_733636.1| formyltetrahydrofolate deformylase [Streptomyces coelicolor A3(2)]
 gi|256786134|ref|ZP_05524565.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
 gi|289770029|ref|ZP_06529407.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
 gi|24427864|emb|CAD55482.1| putative formyltetrahydrofolate deformylase (fragment)
           [Streptomyces coelicolor A3(2)]
 gi|289700228|gb|EFD67657.1| formyltetrahydrofolate deformylase [Streptomyces lividans TK24]
          Length = 297

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 132/279 (47%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F     +     
Sbjct: 18  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIEDSQQFGDHDTGLFFMRVHFSAGEPVTVDKL 77

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F + + I      T+ +++VS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 78  RASFTAIGDAFHMDWQINRADAKTRIVLMVSRFGHCLNDLLFRARIGALPVEIAAVVSNH 137

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T+  K E+E +++ I+ + NVEL++LARYMQ+LSD LC  +
Sbjct: 138 TDFAELVGSYDIPFHHIPVTKDTKPEAEARVLEIVREENVELVVLARYMQVLSDDLCKAL 197

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 198 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 257

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +AIG+++E + L +AV  H ++R+ +N R+T+VF
Sbjct: 258 TPDQLVAIGRDVECQALARAVKWHAERRILLNGRRTVVF 296


>gi|84516018|ref|ZP_01003379.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
 gi|84510460|gb|EAQ06916.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
          Length = 294

 Score =  305 bits (781), Expect = 5e-81,   Method: Composition-based stats.
 Identities = 146/288 (50%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M+ + LT+TC S   I + I  +L+  GCNI D SQF+D +T K FMR+SF   T   + 
Sbjct: 1   MTKFALTVTCDSARGIVAAIAGFLADHGCNITDSSQFDDTETGKFFMRVSFTSETGAALD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               DF  I  +F + ++  +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  TIADDFGDIGTRFGMAFAFHDEAVRMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ +P+T+QNK E+E +++++++    +L++LARYMQ+LSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIPVTKQNKPEAEARIMDVVDATGADLVVLARYMQVLSDRMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+ RVTH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIARVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI +RV +N  KT+VFPA P +Y
Sbjct: 241 AQSPADYVSLGRDVESQVLARAIHAHIHRRVMLNGNKTVVFPASPGSY 288


>gi|27381066|ref|NP_772595.1| formyltetrahydrofolate deformylase [Bradyrhizobium japonicum USDA
           110]
 gi|27354232|dbj|BAC51220.1| formyltetrahydrofolate deformylase [Bradyrhizobium japonicum USDA
           110]
          Length = 287

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 184/281 (65%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
            Y+LT++CP    I S +  +L+  G NILD  QF+D++T K FMR+ F        +  
Sbjct: 5   QYVLTLSCPDRPGIVSAVSTFLAHNGQNILDAQQFDDVETKKFFMRVVFTAADLAVELTA 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I ++F +++ +R+     K ++LVS+ DHCL D+LYRW  G L +    +VSN
Sbjct: 65  LQTGFAAIAERFGMEWQMRDRAAHRKVMLLVSKSDHCLVDILYRWRTGELPMVPTAIVSN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PF++LP+T+++K E E ++++++ K   +L++LARYMQILSD L  
Sbjct: 125 HPREVYAGLDFGGIPFHHLPVTKESKREQEAQILDLVAKTGTDLVVLARYMQILSDDLSA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPII+QDV R++H
Sbjct: 185 KLSGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTRDLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T ED +  G++IE +VL +A+  H+  RV  N RKT+VF
Sbjct: 245 RDTPEDLVRKGRDIERRVLARAIRYHLDDRVIPNGRKTVVF 285


>gi|187479291|ref|YP_787316.1| formyltetrahydrofolate deformylase [Bordetella avium 197N]
 gi|115423878|emb|CAJ50430.1| formyltetrahydrofolate deformylase [Bordetella avium 197N]
          Length = 284

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 180/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F     +    
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFDLGCNILDSQQFGDEETGRFFLRVHFDLPASVSAAS 63

Query: 61  -IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +     + + I + +   + LI+VS+  HCLNDLL+R + G L   +  ++SN
Sbjct: 64  LRERFGALAGNDGMDWQIHDARRKARLLIMVSKQGHCLNDLLFRVSSGQLPAEVAAIISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP+T   K E E+++++I+E+  ++L++LARYMQILS  LC  
Sbjct: 124 HNDYAGLAASYGIPFHHLPVTADTKAEQEKQVLDIVERERIDLVVLARYMQILSADLCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD+ RV H+
Sbjct: 184 LSGRAINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQDIERVDHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +    +G ++E+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAQALTQVGSDVESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|295838217|ref|ZP_06825150.1| formyltetrahydrofolate deformylase [Streptomyces sp. SPB74]
 gi|295826919|gb|EDY43570.2| formyltetrahydrofolate deformylase [Streptomyces sp. SPB74]
          Length = 298

 Score =  305 bits (781), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 129/284 (45%), Positives = 181/284 (63%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--------T 55
           Y+LT++CP  + I   +  +L   G NI D  QF D DT   FMR+ F            
Sbjct: 14  YVLTLSCPDKQGIVHAVSSFLFMTGGNIEDSQQFGDADTGLFFMRVGFSLASAGPDEEAA 73

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F  I + F + + I    E  +  ILVS+  HCLNDLL+R   G L + I  
Sbjct: 74  GLDKLRASFAAIGEAFRMDWQIHRAGERMRVAILVSRFGHCLNDLLFRSRSGALPVEIAA 133

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           VVSNHT  ++L  +Y +PF+++P+    K E+E++ ++++ + NVEL++LARYMQ+LSD 
Sbjct: 134 VVSNHTDFRELTGSYGVPFHHIPVPRDGKAEAERRFLDLVAEENVELVVLARYMQVLSDD 193

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V R
Sbjct: 194 LCKRLSGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVER 253

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           VTHA T    +A G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 254 VTHAATPAQLVATGRDVECQALARAVKWHAEHRILLNGRRTVVF 297


>gi|115526213|ref|YP_783124.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisA53]
 gi|115520160|gb|ABJ08144.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisA53]
          Length = 287

 Score =  304 bits (780), Expect = 6e-81,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 176/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
            Y+LT++CP    I + +  +L   G NI+D  QF+D +T   FMR+ F        ++ 
Sbjct: 5   QYVLTLSCPDLPGIVATVSTFLFDNGQNIVDAQQFDDSETGLFFMRVVFNAAQTRASLQG 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ ++F +++ +R+     + ++LVSQ  HCL D+LYRW  G L +    ++SN
Sbjct: 65  LREAFMPVAERFMMRWQMRDRANRRRVMLLVSQSHHCLVDILYRWRTGELEMQPTAIISN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PF+YLP+ ++ + + E  +  +I     +L++LARYMQILS+ +  
Sbjct: 125 HPRETYKGIDFGEIPFHYLPVNKETRRQQETAISGVIAHTKTDLVVLARYMQILSNEMSG 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPII+QDV R++H
Sbjct: 185 RLEGRCINIHHSFLPGFKGARPYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D    G++IE +VL++A+  H++ RV +N +KT+VF
Sbjct: 245 RDTPADLARKGRDIERRVLSRAIRYHLEDRVILNGKKTVVF 285


>gi|241666498|ref|YP_002984582.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861955|gb|ACS59620.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 294

 Score =  304 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M S++LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKSFVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   F + Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DIDAGFATVAAPFEMDYDFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ N++++E  +++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANRVQAEGHIMDVVEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|190895648|ref|YP_001985940.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190699593|gb|ACE93677.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 294

 Score =  304 bits (780), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 152/288 (52%), Positives = 215/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYEFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|241663346|ref|YP_002981706.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12D]
 gi|240865373|gb|ACS63034.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12D]
          Length = 288

 Score =  304 bits (780), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 130/287 (45%), Positives = 179/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGLPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLATLRDRFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP    T+  K + E ++  I ++  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|220911959|ref|YP_002487268.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
 gi|219858837|gb|ACL39179.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
          Length = 286

 Score =  304 bits (779), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 122/277 (44%), Positives = 176/277 (63%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           Y+LT++CP    I   +   L   G NI+D  Q+    T   FMR+            A 
Sbjct: 10  YVLTLSCPDRPGIVHAVAGALLVAGSNIMDSQQYGSPATGNFFMRVEVTTAAPASELRAA 69

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
            +P+   FS+Q+S+    +  +TLI+ S   HCLNDLL++   GTL + I  +VSNH   
Sbjct: 70  LEPVAAAFSMQWSLNTVGDKVRTLIMASTSAHCLNDLLFQQRSGTLPIEIPAIVSNHRDL 129

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L E Y +PF+Y+P+T+  K ++E KL  ++ ++++EL +LARYMQILSD LC  +TG+
Sbjct: 130 AGLAEFYGVPFHYIPVTKDTKEQAEDKLRALLAEHDIELTVLARYMQILSDELCTDLTGK 189

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
            INIHHSFLPSFKGA PY QA+  GVK+IGATAH+    LD GPIIEQ+V+RV HA+T E
Sbjct: 190 AINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHFVTAALDEGPIIEQEVIRVDHARTPE 249

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            ++ +G+++E + L +AV  H + RV ++  +T+VF 
Sbjct: 250 QFVQMGRDVEGRTLVQAVQWHAEHRVLLDGNRTVVFN 286


>gi|229821474|ref|YP_002883000.1| formyltetrahydrofolate deformylase [Beutenbergia cavernae DSM
           12333]
 gi|229567387|gb|ACQ81238.1| formyltetrahydrofolate deformylase [Beutenbergia cavernae DSM
           12333]
          Length = 280

 Score =  304 bits (779), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 124/279 (44%), Positives = 183/279 (65%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ ++LT++CP    I S +   L+  G NI +  QF D DT   FMR+    +   ++ 
Sbjct: 1   MTHWVLTLSCPDRPGIVSAVAGVLAGLGGNITESQQFGDADTGLYFMRVQVECDASREVL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                 + +QF + + +       +T+++VS   HCLNDLL+R     L + IV VVSNH
Sbjct: 61  DRAVGGVAEQFGMSWELDVVGRPVRTVVMVSTAAHCLNDLLFRQRSERLPIEIVAVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +L   Y + F+++P+T + ++++E +L+ ++   + EL++LARYMQILSD LC  +
Sbjct: 121 TMLAELAAFYGIDFHHVPVTRETRVDAEAQLLELVHALDAELVVLARYMQILSDDLCRDL 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAHYA  +LD GPIIEQDV RV H  
Sbjct: 181 EGRIINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYATADLDEGPIIEQDVERVRHDD 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T+ED +A+G+++E +VL +AV  H + RV +++ +T+VF
Sbjct: 241 TVEDLVAMGQDVERRVLARAVRWHAEHRVLLDRTRTVVF 279


>gi|260430256|ref|ZP_05784230.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260418728|gb|EEX11984.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M+ Y LT+TC +   I + I  +L+  GCNI D SQF+D++TS+ FMRISF       + 
Sbjct: 1   MTKYCLTVTCATTRGIVAAIATFLAEHGCNITDSSQFDDVETSRFFMRISFESQDGVDLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  I + FS+Q++  +  E  K +I+VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  ALEADFAAIAKTFSMQFAFHDEAEKMKVVIMVSRFGHCLNDLLYRVRIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+ + +T++NK ++E  ++ ++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKAVVNSDIPFHCIRVTKENKPQAEAAIMKVVEEAGAELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+  GVK+IGAT+HY   +LD GPIIEQD VR+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFARGVKLIGATSHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++E++VL +A++AH   RVF+N  KT+VF A P +Y
Sbjct: 241 AQSPDDYVSLGRDVESQVLARAIHAHANHRVFLNGNKTVVFQASPGSY 288


>gi|261419936|ref|YP_003253618.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC61]
 gi|319766750|ref|YP_004132251.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC52]
 gi|261376393|gb|ACX79136.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC61]
 gi|317111616|gb|ADU94108.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y412MC52]
          Length = 300

 Score =  304 bits (779), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 173/282 (61%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
               + I+CP    I + +  +L  QG NI++ SQ+  D +    F+R+ F         
Sbjct: 18  QRARILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEFDCPNIAERK 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+
Sbjct: 78  EEIEAAFAPIAAEFQMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVI 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS    
Sbjct: 138 SNHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV 
Sbjct: 198 AEFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVD 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 258 HRHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|309782420|ref|ZP_07677144.1| formyltetrahydrofolate deformylase [Ralstonia sp. 5_7_47FAA]
 gi|308918757|gb|EFP64430.1| formyltetrahydrofolate deformylase [Ralstonia sp. 5_7_47FAA]
          Length = 288

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 130/287 (45%), Positives = 179/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLATLRDCFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP    T+  K + E ++  I ++  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|169772989|ref|XP_001820963.1| formyltetrahydrofolate deformylase [Aspergillus oryzae RIB40]
 gi|83768824|dbj|BAE58961.1| unnamed protein product [Aspergillus oryzae]
          Length = 285

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 123/285 (43%), Positives = 177/285 (62%), Gaps = 5/285 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---- 56
           M+ +ILT++CP    I   +  +L     NI+D SQF D  + + FMR  F  +      
Sbjct: 1   MTGFILTLSCPDRPGIVHAVTAFLVQHNLNIIDSSQFGDPTSHRFFMRTHFSADKDASKK 60

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F+P  +  S+ + +    +  + LI+VS+  HCLNDLL+R + G LA+ I  
Sbjct: 61  NIDELREAFEPTAKSLSMDFQLVPATQKPRVLIMVSKIGHCLNDLLFRTSTGQLAIEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF +LP+ +  K + E +++ +I ++N++L++LARYMQ+LS  
Sbjct: 121 IVSNHPDFATLAATYNIPFVHLPVNKDTKPQQEARILELISEHNIDLVVLARYMQVLSPT 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 181 LCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 241 VNHGMSPKELTHAGSNVESNVLAAAVKYFSERRVLLNGHKTVVFN 285


>gi|209546027|ref|YP_002277917.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538884|gb|ACI58817.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 294

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 61  I--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF P+   FS+ Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  EIGADFSPVAAPFSMDYEFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E +++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEARIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|84515453|ref|ZP_01002815.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
 gi|84510736|gb|EAQ07191.1| formyltetrahydrofolate deformylase [Loktanella vestfoldensis SKA53]
          Length = 294

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 149/288 (51%), Positives = 209/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M+S+ L + C S   I + +  YL+  GCNI+D +QF+D DT   FMR+SF       ++
Sbjct: 1   MNSFALRVQCTSRRGIVAAVSTYLAEAGCNIIDSAQFDDADTGNFFMRVSFRSEEGLPLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +DF PI   F +     +     K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  KLRSDFAPIADAFGMNAHFFDEAVKPKVVIMVSRFGHCLNDLLYRWRIGALPVDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V ++ LPF Y+ +T+ NK E+E +++ ++E+   EL++LARYMQILSD LC 
Sbjct: 121 NHMDYQKVVVSHDLPFRYINVTKANKPEAEAQIMQVVEETGTELIVLARYMQILSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA E GVK+IGAT+HY   +LD GPIIEQD +RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQALERGVKLIGATSHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA+VL++A++AH+  RVFIN  KT+VFPA P ++
Sbjct: 241 AQSADDYVSLGRDVEAQVLSRAIHAHVHGRVFINGDKTVVFPASPGSF 288


>gi|311067811|ref|YP_003972734.1| formyltetrahydrofolate deformylase [Bacillus atrophaeus 1942]
 gi|310868328|gb|ADP31803.1| formyltetrahydrofolate deformylase [Bacillus atrophaeus 1942]
          Length = 300

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 168/280 (60%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFIA- 62
            L ++CP    I + +  +L   G NI++ +Q+  D +  + F+RI F  +   +     
Sbjct: 21  RLLVSCPDQPGIVAAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCDGIREKKEQL 80

Query: 63  --DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I + F++ +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH
Sbjct: 81  KQAFASIAEPFNMTWSLTMASELKRVAIFVSKELHCLHELIWEWQSGNLLAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE   +PF+Y+   +  + E E++ + ++++  +++++LARYMQIL+       
Sbjct: 141 EDARELVEPLNIPFHYMKANKDIRAEVEKQQLELLDQYGIDVIVLARYMQILTPDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             +    IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 NTDALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|218460526|ref|ZP_03500617.1| formyltetrahydrofolate deformylase [Rhizobium etli Kim 5]
          Length = 294

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M + +LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVSCKSTRGIVAAISSYLAEKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F++ Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFAMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|227821997|ref|YP_002825968.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227340997|gb|ACP25215.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 147/288 (51%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M++Y+LT+ C S   I + I  +L+  GCNI D SQF+DL T + FMR+ F+       +
Sbjct: 1   MTTYVLTVACKSTRGIVAAISGFLAEMGCNITDSSQFDDLGTGRFFMRVGFISEKGATRQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              +  +PI ++F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++I+GVVS
Sbjct: 61  DLASGLKPIAEKFEMETTLHDQAERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIIGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ + E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKENKPQAEARIMELAESTGTELIVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 TMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  +TIVFP  P +Y
Sbjct: 241 AQSPEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGARTIVFPPSPGSY 288


>gi|116669675|ref|YP_830608.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116609784|gb|ABK02508.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 286

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 175/279 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           S+Y+LT++CP    I   +   L   GCNI D  Q+    T   FMR+            
Sbjct: 8   SAYVLTLSCPDRPGIVHAVAGALLVAGCNITDSQQYGSQTTGTFFMRVEVTTAASQSDVH 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A  +P+   F +Q+S+       +TL++ S+  HCLNDLL+    GTL + I  +VSNH 
Sbjct: 68  AALEPVAVAFGMQWSLNPAGRKVRTLLMASKSAHCLNDLLFLQRSGTLPIEIPAIVSNHE 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               L E Y +PF+Y+P+T   K+++E +L  II + +VEL +LARYMQILS+ LC ++T
Sbjct: 128 DLAGLAEFYGIPFHYIPVTADTKVQAEDQLRKIIAEEDVELTVLARYMQILSNELCTELT 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+ INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V+RV H +T
Sbjct: 188 GKAINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTAALDEGPIIEQEVIRVDHRRT 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            E ++ +G+++E + L +AV  H + RV ++  +T+VF 
Sbjct: 248 AEQFVQMGRDVEGRTLAQAVQWHAEHRVLLDGNRTVVFN 286


>gi|163855162|ref|YP_001629460.1| formyltetrahydrofolate deformylase [Bordetella petrii DSM 12804]
 gi|163258890|emb|CAP41189.1| formyltetrahydrofolate deformylase [Bordetella petrii]
          Length = 284

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 176/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           + YILT++CP    I   +   L   GCNILD  QF D +T++ F+R+ F          
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDDETNRFFLRVHFNLPAAATEAS 63

Query: 61  -IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +   + + + I + +   + LI+VS+  HCLNDLL+R   G L   I  +VSN
Sbjct: 64  LREQFGALAGAYGMDWQIHDARRKARLLIMVSKQGHCLNDLLFRVQSGQLHAEIAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP++   K E E++++ ++E   ++L++LARYMQILS  +C  
Sbjct: 124 HNDYAGLAASYGIPFHHLPVSADTKAEQEKQVLALVESEQIDLVVLARYMQILSPEMCVA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +TGR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H 
Sbjct: 184 LTGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D   +G ++E+ VL +AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAADLTQVGSDVESLVLARAVRSHVEHRILLNRNKTVVF 283


>gi|86609882|ref|YP_478644.1| formyltetrahydrofolate deformylase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86558424|gb|ABD03381.1| formyltetrahydrofolate deformylase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 282

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 96/282 (34%), Positives = 162/282 (57%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M S  L ++CP  + + + +  ++ + G NI+      D +      RI +    F    
Sbjct: 1   MPSATLLVSCPDQKGLVAKLSSFIYSYGGNIIHADHHTDPEAGLFLSRIEWDLEGFQLER 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              +  F  I +     + +  +    +  +  S+  HCL DL++R   G L   I  ++
Sbjct: 61  GEIVPAFSGIARGIQANWELHFSDTRRRIALWASKQSHCLLDLIWRQRAGELPAEIPLII 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +  ++ + +Y++P++ + K  +E + + ++++  ++L++LA+YMQ+LS  L 
Sbjct: 121 SNHPDLESVARSFGIDYYHIPVSPEGKAAAEARQLALLQEYRIDLVVLAKYMQVLSGSLL 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +    +INIHHS LP+F GANPY +A++ GVKIIGATAHYA  +LD GPIIEQDVVRV+
Sbjct: 181 RQAP-PVINIHHSTLPAFAGANPYHRAHQRGVKIIGATAHYATEDLDEGPIIEQDVVRVS 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+ D +  G+++E  VL +AV  H++ RV +   KT+VF
Sbjct: 240 HRDTVADIVRKGRDMERLVLARAVRYHLENRVLVYHNKTVVF 281


>gi|158423000|ref|YP_001524292.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
 gi|158329889|dbj|BAF87374.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
          Length = 314

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 156/287 (54%), Positives = 215/287 (74%), Gaps = 2/287 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           +SY+LT++C +   I + I  +L+T GCNI D SQF+D DT + FMRI F     +  + 
Sbjct: 22  ASYVLTVSCTTRRGIVAAISGFLATAGCNITDSSQFDDADTGRFFMRIRFRSEEGIGQEE 81

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F PI  Q  + Y + N     K L++VS+  HCLNDLLYRW IG L ++IVGVVSN
Sbjct: 82  LDAAFAPIAGQMGIDYQLHNASRRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSN 141

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  ++K+V N+ +PF+ + +T++NK E+E +L++I+E+   EL++LARYMQ+LSD LC K
Sbjct: 142 HFDYQKVVVNHDIPFHCIKVTKENKAEAEAQLLSIVEQTGTELVVLARYMQVLSDALCRK 201

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+THA
Sbjct: 202 MSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTSDLDEGPIIEQDIARITHA 261

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           Q+ +DY++IG+++E++VL +A++AHI  R+FIN  +T+VFPA P +Y
Sbjct: 262 QSPDDYVSIGRDVESQVLARAIHAHIHHRIFINGNRTVVFPASPGSY 308


>gi|55981290|ref|YP_144587.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB8]
 gi|55772703|dbj|BAD71144.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB8]
          Length = 285

 Score =  304 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 116/284 (40%), Positives = 179/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFV---FNTC 56
           M    L +TCP    I + +  +L   G NI D+ Q   D +    FMR++F     +  
Sbjct: 1   MEEARLLVTCPDRPGIVAAVSGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +   +F +Q+ +    E  +T ILVS+P H L +LL+R+ +G L + +  
Sbjct: 61  RPALERAFQEVVASRFQMQWRLAYASERKRTAILVSKPAHALLELLWRYRVGELPMELRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+ +  K E+E++++ ++E   VEL++LARYMQILS  
Sbjct: 121 VISNHPDHREEVERFGIPYHHVPVEKGRKEEAEERILALLEAEGVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVERFPMRIINIHHSFLPAFAGADPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++ +   +G+ +E  VL +AV  H++ R+ +++ +T+VF
Sbjct: 241 VSHRHSVREMKRLGRELERTVLARAVRWHLEDRILVHENRTVVF 284


>gi|187929153|ref|YP_001899640.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12J]
 gi|187726043|gb|ACD27208.1| formyltetrahydrofolate deformylase [Ralstonia pickettii 12J]
          Length = 288

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 130/287 (45%), Positives = 180/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLATLRDCFAPIGERFSMQWGMFDAAAKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP    T+  K + E ++  I ++  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLQATDAQKAQQEARIWEIAQEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD+LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDNLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|113868472|ref|YP_726961.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
 gi|113527248|emb|CAJ93593.1| formyltetrahydrofolate hydrolase [Ralstonia eutropha H16]
          Length = 288

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 122/287 (42%), Positives = 180/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MS+  +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F       
Sbjct: 1   MSNTGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDEYAGRFFMRVHFTPAAGGP 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+  QFS+Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  
Sbjct: 61  DLDTLKAAFAPVGDQFSMQWELNDAAVKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF++LP    + + K   E ++ +++++  ++L++LARYMQ+L
Sbjct: 121 IVSNHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFDVVQEQKIDLVVLARYMQVL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLAGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|207723967|ref|YP_002254365.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           MolK2]
 gi|206589174|emb|CAQ36136.1| formyltetrahydrofolate deformylase protein [Ralstonia solanacearum
           MolK2]
          Length = 288

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 132/287 (45%), Positives = 181/287 (63%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NT 55
           MS   +ILT++CP    I   +   L  QGCNILD  QF D  T + FMR+ FV      
Sbjct: 1   MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F PI ++FS+Q+ + +     + +ILVS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLQTLRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP+   T+  K + E ++  IIE+  ++L++LARYMQIL
Sbjct: 121 IVSNHRDFYQLAASYDVPFMHLPLLKGTDAQKAQQETRIGEIIEEQQIDLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   ELD GPIIEQ+
Sbjct: 181 SDDLCRKLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  K +VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKNVVF 287


>gi|116255754|ref|YP_771587.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115260402|emb|CAK03506.1| putative formyltetrahydrofolate deformylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 294

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 150/288 (52%), Positives = 215/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M +++LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNFVLTVSCKSTRGIVAAISSYLADKGCNIIDSSQFDDLDTGKFFMRVSFISEEGLSGA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + Y   ++++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DIDTGFAAVAAPFEMDYDFHDSEKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK+++E +++ + E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKANKVQAEARIMEVAEQTGTELIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|194290105|ref|YP_002006012.1| formyltetrahydrofolate deformylase [Cupriavidus taiwanensis LMG
           19424]
 gi|193223940|emb|CAQ69949.1| Formyltetrahydrofolate deformylase [Cupriavidus taiwanensis LMG
           19424]
          Length = 288

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 119/287 (41%), Positives = 178/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MS+  +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F       
Sbjct: 1   MSTTGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDEFAGRFFMRVHFTPAAGGP 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R   G L + I  
Sbjct: 61  DLGTLKAAFAPVGDQFGMQWELNDATVKPRVMIMVSKIGHCLNDLLFRAKAGGLPVEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF++LP    + + K   E ++ +++++  ++L++LARYMQ+L
Sbjct: 121 IVSNHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFDVVQEQKIDLVVLARYMQVL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   +   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPDQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|307545564|ref|YP_003898043.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
 gi|307217588|emb|CBV42858.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
          Length = 349

 Score =  303 bits (777), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 182/283 (64%), Gaps = 4/283 (1%)

Query: 1   MSSY-ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---C 56
           MS Y  L I+CP    I + +  +++  G +I + SQ +D ++ + FMR   + +T    
Sbjct: 66  MSHYYRLVISCPDRLGIVARVSSFITGHGGSITEASQHSDFESGRFFMRYEILADTVGMT 125

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            +     F+PI ++F +Q+++ +T++  + +++VS+  HCL DLLYRW  G L  +I  V
Sbjct: 126 PEALREAFEPIAREFDMQWALTDTRQRRRVVLMVSRESHCLVDLLYRWTAGELDCDIAAV 185

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + LVE +++P++++P+  ++K  +  ++  ++E  + + ++LARYMQIL   +
Sbjct: 186 ISNHDDLRSLVEWHEIPYHHVPVPAEDKAPAFAEIEQLVESADADCVVLARYMQILPPGI 245

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +  GR++NIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD+ RV
Sbjct: 246 CQRYAGRVLNIHHSFLPSFAGAKPYHQAYRRGVKLIGATCHYVTEELDAGPIIEQDIHRV 305

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  T  D +  G+++E  VL + V  H++ RV ++  KT+VF
Sbjct: 306 SHCHTPNDLVRFGRDVEKAVLARGVRWHLEDRVLLHGNKTVVF 348


>gi|144898230|emb|CAM75094.1| formyltetrahydrofolate deformylase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 334

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 177/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
            +++LTITCP    I + +  +L+   C I + +Q+ D  + + FMRI F          
Sbjct: 53  QTFVLTITCPDTVGIVAAVSGFLTQYDCFITEAAQYGDPVSRRFFMRIVFAGGALTPAAA 112

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I  +F + + + +     + +I+VS+  HCL DLL+R++ G L + I  V+S
Sbjct: 113 EFRKLFAAIADRFQMIWQLHDLTRKPRVVIMVSKFGHCLVDLLHRYHTGQLNIEIPAVIS 172

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE + +P++YL + + +K   E +++ +I+++  EL++LARYMQILS  LC 
Sbjct: 173 NHPDMRSIVEWHGIPYHYLAVDKHDKEAQEGRVMEVIDRSGAELVVLARYMQILSTTLCQ 232

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H
Sbjct: 233 TLQGRAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTADLDEGPIIEQSVERVDH 292

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T +D +A+G++IE  VL +AV  H++ RV +N  KT+VF
Sbjct: 293 THTPDDLVAMGRDIENLVLGRAVRWHVEHRVLLNGSKTVVF 333


>gi|320532698|ref|ZP_08033490.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|320135087|gb|EFW27243.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 171
           str. F0337]
          Length = 290

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 177/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +         
Sbjct: 12  AHLVLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELE 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D   +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH 
Sbjct: 72  KDLAELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHE 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + + E Y +PF+++P+T++ K  +E +L+ +++  +VEL++LARYMQILS  LC ++ 
Sbjct: 132 TLRDVAEFYGVPFHHIPVTKETKEAAEAELLGLVDSLDVELVVLARYMQILSPTLCERLH 191

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  +
Sbjct: 192 GGVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDS 251

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 252 VSMLQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|294814255|ref|ZP_06772898.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|326442646|ref|ZP_08217380.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|294326854|gb|EFG08497.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
          Length = 283

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 130/283 (45%), Positives = 187/283 (66%), Gaps = 3/283 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--M 57
           M+  Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F       +
Sbjct: 1   MTDQYVLTLSCPDKQGIVHAVSSYLFITGCNIEDSKQFGDQDTGLFFMRVQFSAEEPVTL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F  +   F + + I    E  + +++VS+  HCLNDLL+R  IG L + I  VV
Sbjct: 61  EKLRASFAAVGDAFQMDWRINRADEPMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++L  +Y +PF+++P+T++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC
Sbjct: 121 SNHREFEELAGSYHIPFHHIPVTKENKPEAEARLLELVRAENVELVVLARYMQVLSDDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 181 KELSGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVG 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  + E  +A+G+++E + L +AV  H + R+ +N R+T+VF 
Sbjct: 241 HGLSPEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVFD 283


>gi|21674639|ref|NP_662704.1| formyltetrahydrofolate deformylase [Chlorobium tepidum TLS]
 gi|21647842|gb|AAM73046.1| formyltetrahydrofolate deformylase [Chlorobium tepidum TLS]
          Length = 289

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 185/282 (65%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S  IL ++CP    + + I +++  +G NILD+++  D+D  + F+R+S+    F+   +
Sbjct: 8   SKAILLLSCPDRVGLVARIANFIYERGGNILDLNEHVDVDERQFFLRVSWSLDHFSIPAE 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ ++F   + IR + + ++  + VS+ DHCL ++L+R ++G   +++  V+S
Sbjct: 68  DLESAFAPLGREFRANWQIRLSGKRSRMAVFVSKYDHCLREILWRHSLGEFDIDLPLVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     LVE + +PF+ +P+T + K  +EQ+ + + +++ ++ ++LARYMQ+LS     
Sbjct: 128 NHPDLAPLVEAHGIPFHVIPVTPEAKAAAEQRQMALCDEHGIDTIVLARYMQVLSPEFTR 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F G NPY+QAY  GVK+IGAT+HY   ELD GPIIEQD++R+TH
Sbjct: 188 RWVGRIINIHHSFLPAFVGGNPYRQAYRRGVKLIGATSHYVTDELDEGPIIEQDIIRITH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             T+ED +  G+++E  VL +A+  H   R+ +N RKT+VF 
Sbjct: 248 RDTLEDLVRKGRDLERLVLARALRLHCDHRILLNGRKTVVFD 289


>gi|94311174|ref|YP_584384.1| formyltetrahydrofolate deformylase [Cupriavidus metallidurans CH34]
 gi|93355026|gb|ABF09115.1| formyltetrahydrofolate hydrolase [Cupriavidus metallidurans CH34]
          Length = 288

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 122/287 (42%), Positives = 178/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MSS  +ILT++CP    I   +   L   GCNI+D  Q+ D    + FMR+ F       
Sbjct: 1   MSSTGFILTLSCPDQPGIVHAVSGLLFQHGCNIVDSDQYGDAFAGRFFMRVHFSAAPGGP 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  
Sbjct: 61  DLAELRAAFAPVGDQFGMQWEVHDATVKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF++LP    + + K   E ++  ++ + N++L++LARYMQ+L
Sbjct: 121 IVSNHRDFYQLAASYDVPFFHLPLMNASAEQKAAQEARVFEVVREQNIDLVVLARYMQVL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLQGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   E   A+G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|226939945|ref|YP_002795018.1| PurU [Laribacter hongkongensis HLHK9]
 gi|226714871|gb|ACO74009.1| PurU [Laribacter hongkongensis HLHK9]
          Length = 286

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            S  L ++CP  + + + I ++L T   NIL   Q  D   +   MR+ +  +     M+
Sbjct: 5   QSATLLMSCPDKKGLVAAIANFLMTYNANILHADQHQDEVENLFLMRVEWDLDGFTLPME 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A FQPI  +  + + +  +    +  I VS+ +HCL DLL+RW IG LA +I  V+S
Sbjct: 65  SFSAAFQPIADEHQMNWHVSLSSRKPRMAIFVSKYEHCLVDLLHRWRIGELACDIPLVIS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++VE   +PF+ +P+T  NK E+E +   ++E+  V+ M+LARYMQ+LS     
Sbjct: 125 NHEDCRRIVEFNGIPFHVIPVTRDNKAEAEAEQFRLLEEAGVDFMVLARYMQVLSGEFVK 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY   +LD GPIIEQ+V R++H
Sbjct: 185 RYPNRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEDLDEGPIIEQEVTRISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             ++ED +  G+++E  VL++AV  H+  RV     KT+VF 
Sbjct: 245 RDSVEDLVERGRDLEKVVLSRAVRWHVDNRVLSYSNKTVVFD 286


>gi|297565948|ref|YP_003684920.1| formyltetrahydrofolate deformylase [Meiothermus silvanus DSM 9946]
 gi|296850397|gb|ADH63412.1| formyltetrahydrofolate deformylase [Meiothermus silvanus DSM 9946]
          Length = 287

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 115/287 (40%), Positives = 179/287 (62%), Gaps = 9/287 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VF 53
           MS      L ITCP    I + +  +L   G NI D+ Q   D +    FMR+ F     
Sbjct: 1   MSRETLARLLITCPDRPGIVAAVSTFLFNHGANITDLQQHSTDPEGGTFFMRLEFQTPHL 60

Query: 54  NTCMKLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
           +    +    F + + ++F++++     +E  K  +LVS+ DH L ++L+RW+ G L   
Sbjct: 61  DVSRGVLERAFAEAVAERFAMEWRFAYAEEPKKMALLVSRYDHALLEVLWRWSRGELPAK 120

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +  V+SNH   +  V  + LP++++P++++NK E+E  ++ ++E    +L++LARYMQIL
Sbjct: 121 VSMVISNHPDLEPAVRAFGLPYHHVPVSKENKAEAEASILELLEGQ-ADLVVLARYMQIL 179

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S     +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQD
Sbjct: 180 SADFVSRFPHRIINIHHSFLPAFVGASPYRQAYERGVKLIGATAHYVTEELDQGPIIEQD 239

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV+H  ++ED + +G+++E +VL +AV  H++ R+ ++  KT+VF
Sbjct: 240 VARVSHRHSVEDLVELGRDLERQVLARAVRWHLEDRIIVHGNKTVVF 286


>gi|297530102|ref|YP_003671377.1| formyltetrahydrofolate deformylase [Geobacillus sp. C56-T3]
 gi|297253354|gb|ADI26800.1| formyltetrahydrofolate deformylase [Geobacillus sp. C56-T3]
          Length = 300

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 172/282 (60%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
               + I+CP    I + +  +L  QG NI++ SQ+  D +    F+R+ F         
Sbjct: 18  QRARILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEFDCPNIAEQK 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V 
Sbjct: 78  EEIEAAFAPIAAEFQMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVT 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS    
Sbjct: 138 SNHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV 
Sbjct: 198 AEFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVD 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 258 HRHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|226355854|ref|YP_002785594.1| formyltetrahydrofolate deformylase [Deinococcus deserti VCD115]
 gi|226317844|gb|ACO45840.1| putative Formyltetrahydrofolate deformylase (Formyl-FH(4)
           hydrolase) [Deinococcus deserti VCD115]
          Length = 291

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 164/283 (57%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNT---CM 57
           ++  LTITCP  + I + +  +L   G NI+   Q   D +    FMR+ F         
Sbjct: 9   NTATLTITCPDRQGIVAAVSQFLHNHGANIIHSDQHSTDPEGGTFFMRMEFHLEGLAQAR 68

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F   F  +  +  ++ + +       +  +LVS+ DHC  DLL+R   G L + I  V
Sbjct: 69  DSFERAFAGVVAEPLNMAWQVSYATRPKRMAVLVSRYDHCFLDLLWRKRRGELNVEIPLV 128

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++  E + +PF+ +P+T  NK E+E + I ++ +  V+  +LARYMQILS   
Sbjct: 129 ISNHEDLRRDAEMFGIPFHLVPVTRDNKAEAEAEQIRLMHEAGVDFAVLARYMQILSGEF 188

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                  +INIHHSFLP+F GANPY+ A+  GVK+IGAT+HY   ELDAGPII QDVV V
Sbjct: 189 LQAFGRPVINIHHSFLPAFVGANPYRAAFNRGVKLIGATSHYVTEELDAGPIIAQDVVPV 248

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH +T +  + +G+++E +VL +AV AH + RV +   KT+VF
Sbjct: 249 THRETPDTLMRLGRDVERQVLARAVKAHAEDRVLVYGNKTVVF 291


>gi|89068495|ref|ZP_01155892.1| formyltetrahydrofolate deformylase [Oceanicola granulosus HTCC2516]
 gi|89045914|gb|EAR51974.1| formyltetrahydrofolate deformylase [Oceanicola granulosus HTCC2516]
          Length = 292

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 136/286 (47%), Positives = 196/286 (68%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ Y LT++CP+   I + I   L+ +  NI+D +QFND +  + FMR+SF  +T     
Sbjct: 1   MAHYNLTLSCPTAPGIVAAISGELARREGNIVDSAQFNDAEAGRFFMRLSFTTDTPRAAL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A    I     + +++R   E    +ILVS+  HCLNDLLYR  IG L + I  V+SNH
Sbjct: 61  EAGLADIAAPLGIDWTLRARTEKLGIVILVSRFGHCLNDLLYRARIGALPVEIRAVISNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
             + + VEN  +PF+++P+T + K ++E   + ++E+    L++LARYMQ+LS+ +C +M
Sbjct: 121 RDYARAVENEGIPFHHIPVTPETKADAEAATLRVVEETEAGLVVLARYMQVLSEEMCRRM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGANPY+QA+  GV++IGATAHY   +LD GPIIEQD VRVTHAQ
Sbjct: 181 SGRIINIHHSFLPSFKGANPYRQAHRKGVRLIGATAHYVTADLDEGPIIEQDTVRVTHAQ 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           + +DY+A+G+++EA+VL +AV AH   RV +N  +T+VFPA P  +
Sbjct: 241 SPQDYVALGRDVEAQVLARAVQAHAHGRVLLNGDRTVVFPAGPGEH 286


>gi|297539789|ref|YP_003675558.1| formyltetrahydrofolate deformylase [Methylotenera sp. 301]
 gi|297259136|gb|ADI30981.1| formyltetrahydrofolate deformylase [Methylotenera sp. 301]
          Length = 294

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 112/282 (39%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L ITCP ++ I + I D+L     NIL   Q  D + +   MR+ +    FN    
Sbjct: 13  NTATLLITCPDSKGIVAAIADFLYQHNANILHADQHQDAENNLFLMRVEWDLAGFNLLPA 72

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I ++FS+++ ++ +++  +  I+VSQ DHCL DLL+R   G L  +I  ++S
Sbjct: 73  DFEQHFAEIAKRFSMEWQLKLSQKPLRVAIMVSQYDHCLADLLHRHKNGELVCDIPLIIS 132

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L + Y + F+Y+ + + NK E+E +   + ++ +++L++LARYMQILS     
Sbjct: 133 NHKDTEALAKFYGVDFHYIEVKKDNKPEAEARQFALFDQYDIDLIVLARYMQILSPDFVA 192

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   +IINIHHSFLP+F GA PY +A+E GVK+IGAT HY    LD GPIIEQD+ R++H
Sbjct: 193 RYPKQIINIHHSFLPAFIGARPYHRAFERGVKLIGATGHYVTEVLDEGPIIEQDIDRISH 252

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED I  G+++E  VL+KAV  HI+ R+ +   KT++F 
Sbjct: 253 RDQVEDLIQKGRDLERIVLSKAVRWHIENRILLYANKTVIFD 294


>gi|294500807|ref|YP_003564507.1| formyltetrahydrofolate deformylase [Bacillus megaterium QM B1551]
 gi|294350744|gb|ADE71073.1| formyltetrahydrofolate deformylase [Bacillus megaterium QM B1551]
          Length = 300

 Score =  303 bits (776), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 108/280 (38%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF--- 60
            L I+CP    I + +  +L   G NI++ SQ   + +    F+R  F     +      
Sbjct: 21  RLLISCPDKPGIVAAVSTFLHEHGANIVESSQHSTNHEGGMFFIRFEFECEDLLAKEVKL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+ I   FS+ +         +T I VS+  HCL +LL+ W  G L  +I  VVSNH
Sbjct: 81  EESFKKIADTFSMNWQFTYAHNLKRTAIFVSKEPHCLLELLWAWESGDLMTDIAVVVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++VE++ +PF ++P T+  + E+E K + +++  N++++ILARYMQIL+     + 
Sbjct: 141 EDAREVVESFGIPFKHIPATKDIRQEAEAKQLQVLKDYNIDVIILARYMQILTPTFVAEN 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GA PY++AY+ GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PYRIINIHHSFLPAFIGARPYERAYQRGVKLIGATSHYVTDDLDEGPIIEQDIERVNHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             +D    G+ IE  VL +AV  H++ R+ +++ +TIVF 
Sbjct: 261 DADDLKKKGRLIERTVLARAVKWHLEDRILVHENRTIVFN 300


>gi|114763913|ref|ZP_01443154.1| formyltetrahydrofolate deformylase protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114543505|gb|EAU46519.1| formyltetrahydrofolate deformylase protein [Roseovarius sp.
           HTCC2601]
          Length = 294

 Score =  303 bits (775), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 147/288 (51%), Positives = 207/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           MS  ILT+ CP    I + I  +L+ QGCNI D SQF+D+   + FMR+SF        +
Sbjct: 1   MSQIILTVACPVRSGIVAAISTFLAEQGCNIHDSSQFSDIGNDRFFMRLSFESEQGRSRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    Q F ++++  +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ALAEGFAATAQSFGMEFAFHDPSEKMKVIIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T+ NK E+E + + I+ +   EL++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDIPFHCIKVTKANKPEAEAEQMRIVRETGAELIVLARYMQILSDEMCT 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL++A++AH+ +RVF+N  KT+VFPA P  Y
Sbjct: 241 AQSPSDYVSLGRDVESQVLSRAIHAHMHRRVFLNGDKTVVFPASPGEY 288


>gi|15599510|ref|NP_253004.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|107100103|ref|ZP_01364021.1| hypothetical protein PaerPA_01001124 [Pseudomonas aeruginosa PACS2]
 gi|116052348|ref|YP_792659.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218893404|ref|YP_002442273.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
 gi|254239018|ref|ZP_04932341.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|254244876|ref|ZP_04938198.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|296391017|ref|ZP_06880492.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAb1]
 gi|9950538|gb|AAG07702.1|AE004848_1 formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PAO1]
 gi|115587569|gb|ABJ13584.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126170949|gb|EAZ56460.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa C3719]
 gi|126198254|gb|EAZ62317.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 2192]
 gi|218773632|emb|CAW29446.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa LESB58]
          Length = 283

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 177/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     +     +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|220934864|ref|YP_002513763.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996174|gb|ACL72776.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 290

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 112/281 (39%), Positives = 170/281 (60%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           +Y L ++CP    I + +  +LS  G  I + SQ  D  +   FMR     +      + 
Sbjct: 10  TYRLIVSCPDRVGIVAAVSGFLSRHGGWITEASQHADQGSGWFFMRYEIRADSLPFDDQG 69

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F PI +QF +Q+ + + +   + +++VS+ DHCL DLLYRW    +  +I  V+SN
Sbjct: 70  LREAFAPIAEQFEMQWQVTDAQVPKRVVLMVSKLDHCLTDLLYRWRSKEMFFDIPCVISN 129

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +  VE + +P++++P+   NK  +  ++  ++E  + + ++LARYMQIL   +CH 
Sbjct: 130 HEDMRDYVEWHGIPYHHVPVDRDNKAPAFAEVTRLVESYDADAVVLARYMQILPPDMCHT 189

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR+INIHHSFLPSF GA PY +A+E GVK+IGAT HY   ELDAGPIIEQDV+RV H 
Sbjct: 190 YAGRVINIHHSFLPSFIGAKPYHKAFERGVKLIGATCHYVTEELDAGPIIEQDVIRVRHD 249

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T  D + +G+++E  VL + +  H++ RV I+  KT+VF 
Sbjct: 250 DTANDLVRLGRDVEKAVLARGLRYHLEDRVLIHGNKTVVFD 290


>gi|90425638|ref|YP_534008.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB18]
 gi|90107652|gb|ABD89689.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB18]
          Length = 287

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 179/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KL 59
            ++LT++CP    I S +  +L   G NILD  QF+D +T + FMR+ F          +
Sbjct: 5   QFVLTLSCPDLPGIVSAVSTFLFDNGQNILDAQQFDDTETGQFFMRVVFNAAQTRVTLPV 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ ++F +++ +R+     + L+LVS+ DHCL DLLYRW  G L +    V+SN
Sbjct: 65  LRELFIPVAERFMMRWQMRDRGNRRRVLLLVSKSDHCLVDLLYRWRTGELEMTPTAVISN 124

Query: 120 HT-THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H     + ++  ++PF+YLP++++ + + E  +  +I     +L++LARYMQ+LSD +  
Sbjct: 125 HPRDTYEGLDFGEVPFHYLPVSKETRRQQETAISGVIAHTKTDLVVLARYMQVLSDEMSG 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 185 RLAGRCINIHHSFLPGFKGAKPYHQAHERGVKLIGATAHYVTGTLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               ED +  G++IE +VL +A+  H++ RV +N +KT+VF
Sbjct: 245 RDRPEDLVRKGRDIERRVLARAIRYHLEDRVILNGKKTVVF 285


>gi|56420271|ref|YP_147589.1| formyltetrahydrofolate deformylase [Geobacillus kaustophilus
           HTA426]
 gi|56380113|dbj|BAD76021.1| formyltetrahydrofolate hydrolase [Geobacillus kaustophilus HTA426]
          Length = 300

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 174/282 (61%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
               + I+CP    I + +  +L  QG NI++ SQ+  D +    F+R+ F         
Sbjct: 18  QRARILISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEFDCPNIAERK 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F PI  +F +++ +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+
Sbjct: 78  EEIEAAFAPIAAEFEMRWQLRLHNDIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVI 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VE++ +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS    
Sbjct: 138 SNHPDLRETVESFGIPYVHIPVTKETKADAEAEQIRLLRDYQIDTIVLARYMQILSPAFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            + +GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV 
Sbjct: 198 AEFSGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVD 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 258 HRHHPDDLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|291294723|ref|YP_003506121.1| formyltetrahydrofolate deformylase [Meiothermus ruber DSM 1279]
 gi|290469682|gb|ADD27101.1| formyltetrahydrofolate deformylase [Meiothermus ruber DSM 1279]
          Length = 286

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 169/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
           ++  L ITCP    I + + ++L   G NI  + Q   D +    FMR+ F     +   
Sbjct: 5   TTARLLITCPDRPGIVAAVSNFLFNHGANITALDQHSTDPEGGLFFMRLEFQTPHLDVSR 64

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++    F   +  +F + + I    +  K  ILVS+ DH L +LL+R +   L   I  V
Sbjct: 65  EILEKAFAERVAARFEMNWRIAYAADLKKVAILVSKYDHALLELLWRHSNRELPCTITQV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   +  VE + +P++++P+ +  K E+E ++++++   + +L++LARYMQIL+   
Sbjct: 125 ISNHPDLRPEVERFGIPYHHVPVEKDRKEEAEAQILHLLG--DTDLVVLARYMQILTPQF 182

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   RIINIHHSFLP+F GANPYKQAY  GVKIIGATAHY   ELD GPIIEQDV RV
Sbjct: 183 VARYPHRIINIHHSFLPAFVGANPYKQAYMRGVKIIGATAHYVTEELDQGPIIEQDVARV 242

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   + D + +G+++E  VL +AV  H++ R+ +   KT+VF
Sbjct: 243 SHRHDVADLVRLGRDLERNVLARAVQWHLEDRIIVYGNKTVVF 285


>gi|46199259|ref|YP_004926.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB27]
 gi|46196884|gb|AAS81299.1| formyltetrahydrofolate deformylase [Thermus thermophilus HB27]
          Length = 285

 Score =  303 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 117/284 (41%), Positives = 178/284 (62%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFV---FNTC 56
           M    L +TCP    I + +  +L   G NI D+ Q   D +    FMR++F     +  
Sbjct: 1   MEEARLLVTCPDRPGIVAAVSGFLYAHGANITDLQQHSTDPEGGTFFMRVAFTASHLDLA 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +   +F +Q+ +    E  +T ILVS+P H L +LL+R+ +G L + +  
Sbjct: 61  RPALERAFQEVVASRFQMQWRLAYASERKRTAILVSKPAHALLELLWRYRVGELPMELRL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+    K E+E+K++ ++E   VEL++LARYMQILS  
Sbjct: 121 VISNHPDHREEVERFGIPYHHVPVERGRKEEAEEKILALLEAEGVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QAYE GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVERFPMRIINIHHSFLPAFAGADPYRQAYERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  ++ +   +G+ +E  VL +AV  H++ R+ +++ +T+VF
Sbjct: 241 VSHRHSVREMKRLGRELERTVLARAVRWHLEDRILVHENRTVVF 284


>gi|288960097|ref|YP_003450437.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
 gi|288912405|dbj|BAI73893.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
          Length = 288

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 129/282 (45%), Positives = 184/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S YILT++CP    I   +  +L+ + CNI+D +QF D  +   FMR+SF  +      +
Sbjct: 6   SDYILTVSCPDTVGIVFAVSGFLAERSCNIIDSAQFGDRISGLFFMRVSFNGDPGGATRQ 65

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              A+F   + ++F++ + I + +   + LI+VS+  HCLNDLLYR+  G L + I  +V
Sbjct: 66  QLEAEFAAQVAERFAMTWKIHDARRRPRVLIMVSKFGHCLNDLLYRYRTGYLPIEIPAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    +L   + +PF++LP+   NK   E +L+ I+E+  V+L++LARYMQ+LS  LC
Sbjct: 126 SNHRDFYQLAAWHNIPFHHLPVGSDNKAHQEARLLEIVEEEKVDLVVLARYMQVLSGALC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +M GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+  RV 
Sbjct: 186 ERMAGRVINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTSNLDEGPIIEQEAERVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T +D +AIG++IE  VL +AV  H++ RV +N  KT+VF
Sbjct: 246 HTMTPDDLVAIGRDIENIVLARAVRYHVEHRVLLNGNKTVVF 287


>gi|16331472|ref|NP_442200.1| formyltetrahydrofolate deformylase [Synechocystis sp. PCC 6803]
 gi|2500008|sp|Q55135|PURU_SYNY3 RecName: Full=Formyltetrahydrofolate deformylase; AltName:
           Full=Formyl-FH(4) hydrolase
 gi|1001129|dbj|BAA10270.1| phosphoribosylglycinamide formyltransferase [Synechocystis sp. PCC
           6803]
          Length = 284

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 101/280 (36%), Positives = 162/280 (57%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           +  L ++CP    I + I  ++     NI+   Q  D  +     R+ +  +        
Sbjct: 5   TATLLVSCPDQPGIVAQIAQFIYQNQGNIIHADQHTDFSSGLFLNRVEWQLDNFRLSRPE 64

Query: 63  DFQP---IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                  + +Q    + I  + +  +  + VS+ DHCL D+L+RW  G L   I  ++SN
Sbjct: 65  LLSAWSQLAEQLQATWQIHFSDQLPRLALWVSKQDHCLLDILWRWRSGELRCEIPLIISN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + + + + F+ LP+T++NK+  E   + ++++  ++L++LA+Y+QIL+     +
Sbjct: 125 HPDLKSIADQFGIDFHCLPITKENKLAQETAELALLKQYQIDLVVLAKYLQILTTDFVVQ 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
               IINIHHSFLP+F GANPY +A+E GVKIIGATAHYA  +LD GPIIEQDVVRV+H 
Sbjct: 185 FP-NIINIHHSFLPAFPGANPYHRAHERGVKIIGATAHYATAQLDEGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++D I  G+++E  VL +AV  H+Q R+ +   +T+VF
Sbjct: 244 DNVDDLIRKGRDLERVVLARAVRLHLQHRILVYDNRTVVF 283


>gi|313106838|ref|ZP_07793047.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
 gi|310879549|gb|EFQ38143.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa 39016]
          Length = 283

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 177/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     +     +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVSEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|159186072|ref|NP_356423.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|159141206|gb|AAK89208.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M++++LT+TC S   I + +   L+ +GCNI+D SQF+DL T + FMR+ F+       +
Sbjct: 1   MTNFVLTVTCKSTRGIVAALSGLLAEKGCNIVDSSQFDDLGTGRFFMRVGFISEEGATRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A   PI + F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALMAGLAPISKTFGMEVALHDQAERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E +++ I E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKENKPQAEARIMEIAESTGTELVVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD+VR+TH
Sbjct: 181 AMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDIVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI +RVF+N  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVEAQVLARAIHAHIHRRVFLNGSRTVVFPPSPGSY 288


>gi|119714394|ref|YP_921359.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
 gi|119535055|gb|ABL79672.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
          Length = 282

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 119/281 (42%), Positives = 187/281 (66%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCMK 58
           MS  +L ++CP    I   +  +L  +G NI +  QF D  + + FMRI+          
Sbjct: 1   MSELVLILSCPDRPGIVHAVTGFLVERGANITESQQFGDPLSGRFFMRIAVDVPGAVDAA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F P+ ++F +++ + +     +TLILVS+  HCLNDLL+R + G+L + +  +VS
Sbjct: 61  ALRAEFAPVAEEFEMRFDVHDAAAPYRTLILVSKDLHCLNDLLFRTSTGSLGIEVPAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     +  +Y +PF+++P+T   K ++E++L+ ++ + +++L++LARYMQILSD LC 
Sbjct: 121 NHPDAAAMAASYGVPFHHVPVTPDTKAQAEERLLELVRELDIDLVVLARYMQILSDGLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++G+ INIHHSFLPSFKGA PY QA++ GVK++GATAHY   +LD GPIIEQDV+RV H
Sbjct: 181 ELSGKAINIHHSFLPSFKGARPYHQAFDRGVKLVGATAHYVTSDLDEGPIIEQDVMRVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E  ++ G+++EA+VL++AV  H Q RV +N  +T+VF
Sbjct: 241 THHQEQLVSAGRDVEAQVLSRAVRWHAQSRVLLNGHRTVVF 281


>gi|254388399|ref|ZP_05003634.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
 gi|197702121|gb|EDY47933.1| formyltetrahydrofolate deformylase [Streptomyces clavuligerus ATCC
           27064]
          Length = 289

 Score =  302 bits (774), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 130/283 (45%), Positives = 187/283 (66%), Gaps = 3/283 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--M 57
           M+  Y+LT++CP  + I   +  YL   GCNI D  QF D DT   FMR+ F       +
Sbjct: 7   MTDQYVLTLSCPDKQGIVHAVSSYLFITGCNIEDSKQFGDQDTGLFFMRVQFSAEEPVTL 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F  +   F + + I    E  + +++VS+  HCLNDLL+R  IG L + I  VV
Sbjct: 67  EKLRASFAAVGDAFQMDWRINRADEPMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++L  +Y +PF+++P+T++NK E+E +L+ ++   NVEL++LARYMQ+LSD LC
Sbjct: 127 SNHREFEELAGSYHIPFHHIPVTKENKPEAEARLLELVRAENVELVVLARYMQVLSDDLC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 187 KELSGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVG 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  + E  +A+G+++E + L +AV  H + R+ +N R+T+VF 
Sbjct: 247 HGLSPEQLVAVGRDVECQALARAVKWHAEHRILLNGRRTVVFD 289


>gi|187922613|ref|YP_001894255.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
 gi|187713807|gb|ACD15031.1| formyltetrahydrofolate deformylase [Burkholderia phytofirmans PsJN]
          Length = 289

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 179/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++     F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLEALRTSFATLAEQFGMRWEMHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P    T   K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLLGATPDAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|295706152|ref|YP_003599227.1| formyltetrahydrofolate deformylase [Bacillus megaterium DSM 319]
 gi|294803811|gb|ADF40877.1| formyltetrahydrofolate deformylase [Bacillus megaterium DSM 319]
          Length = 300

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF--- 60
            L I+CP    I S +  +L   G NI++ SQ   + +    F+R  F     +      
Sbjct: 21  RLLISCPDKPGIVSAVSTFLHEHGANIVESSQHSTNHEGGMFFIRFEFECEDLLAKEAKL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+ I   FS+ +         KT I VS+  HCL +LL+ W  G L  +I  VVSNH
Sbjct: 81  EESFKKIANTFSMNWQFTYAHNLKKTAIFVSKEPHCLLELLWAWESGDLMTDIAVVVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++VE++ +PF ++P T+  + E+E K + +++  N++++ILARYMQIL+     + 
Sbjct: 141 EDAREVVESFGIPFKHIPATKDIRQEAEAKQLQVLKDYNIDVIILARYMQILTPTFVAEN 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GA PY++AY+ GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PYRIINIHHSFLPAFIGARPYERAYQRGVKLIGATSHYVTDDLDEGPIIEQDIERVNHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             +D    G+ IE  VL +AV  H++ R+ +++ +TIVF 
Sbjct: 261 DADDLKKKGRLIERTVLARAVKWHLEDRILVHENRTIVFN 300


>gi|221309171|ref|ZP_03591018.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313497|ref|ZP_03595302.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318419|ref|ZP_03599713.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322693|ref|ZP_03603987.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767307|ref|NP_389194.2| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321315062|ref|YP_004207349.1| formyltetrahydrofolate deformylase [Bacillus subtilis BSn5]
 gi|239938685|sp|O34990|PURU_BACSU RecName: Full=Formyltetrahydrofolate deformylase; AltName:
           Full=Formyl-FH(4) hydrolase
 gi|225184934|emb|CAB13168.2| formyltetrahydrofolate hydrolase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|320021336|gb|ADV96322.1| formyltetrahydrofolate deformylase [Bacillus subtilis BSn5]
          Length = 300

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 169/280 (60%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLF--- 60
            L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCAGIREKKSSL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH
Sbjct: 81  QAAFASVAEKFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+       
Sbjct: 141 EEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 NAEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|301632060|ref|XP_002945109.1| PREDICTED: formyltetrahydrofolate deformylase-like [Xenopus
           (Silurana) tropicalis]
          Length = 282

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 119/281 (42%), Positives = 177/281 (62%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+ +Y+LT++CP    +   +  +L   GCNI + +Q+ND  T   FMR+ F        
Sbjct: 1   MTPTYVLTLSCPDRLGLVHAVSGFLLEHGCNIEEAAQYNDQATGLFFMRVQFACGQHDGP 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                  P  +   +++S+ +  E  +T+++VS+  HCLNDLL+R   G L ++I  ++S
Sbjct: 61  ALKGQLAPFAEGLQMRWSLHSRAETMRTVLMVSREGHCLNDLLFRVKSGLLPIDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++ ++   K ++E +   IIE    EL++LARYMQ+LS+ LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIAVSRDTKAQAEARQYEIIEAEGAELVVLARYMQVLSNDLCV 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 RLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVTRADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  + G++ E+ VL +AV  H + RV +N  KT+VF
Sbjct: 241 TDTVEDLTSRGRDTESLVLARAVKWHSEHRVLLNGHKTVVF 281


>gi|326774120|ref|ZP_08233402.1| formyltetrahydrofolate deformylase [Actinomyces viscosus C505]
 gi|326636259|gb|EGE37163.1| formyltetrahydrofolate deformylase [Actinomyces viscosus C505]
          Length = 290

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 177/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +         
Sbjct: 12  AHLVLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELE 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D   +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH 
Sbjct: 72  KDLAELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHE 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + + E Y +PF+++P+T++ K  +E +L+ +++  NVEL++LARYMQILS  LC ++ 
Sbjct: 132 TLRDVAEFYGVPFHHIPVTKETKEAAEAELLGLVDSLNVELVVLARYMQILSPALCERLH 191

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  +
Sbjct: 192 GGVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDS 251

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 252 VSVLQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|332716561|ref|YP_004444027.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325063246|gb|ADY66936.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 149/288 (51%), Positives = 217/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M++++LT+TC S   I + +  +L+ +GCNI+D SQF+DL T + FMR+ F+        
Sbjct: 1   MTNFVLTVTCKSTRGIVAALSGFLAEKGCNIVDSSQFDDLGTGRFFMRVGFISEEGAKRD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +A   PI Q+F ++ ++ +  E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DLMAGLMPISQKFGMEVALHDQSERMKVLLMVSRFGHCLNDLLYRWRIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T++NK ++E ++++I E    EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIPVTKENKPQAEARIMDIAESTGTELIVLARYMQVLSDRMCE 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD VR+TH
Sbjct: 181 TMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA+VL +A++AHI  R FIN  +T+VFP  P +Y
Sbjct: 241 AQSAEDYVSLGRDVEAQVLARAIHAHIHHRTFINGNRTVVFPPSPGSY 288


>gi|2632031|emb|CAA05590.1| YkkE [Bacillus subtilis]
          Length = 300

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 169/280 (60%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLF--- 60
            L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCAGIREKKSSL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH
Sbjct: 81  QAAFASVAEKFDMTWSLTLASELKRVAIFVSKNLHCLHELIWEWQTGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+       
Sbjct: 141 EEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIKRVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 NAETLKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|325068203|ref|ZP_08126876.1| formyltetrahydrofolate deformylase [Actinomyces oris K20]
          Length = 290

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 177/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +         
Sbjct: 12  AHLVLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELE 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D   +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH 
Sbjct: 72  KDLAELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHE 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + + E Y +PF+++P+T++ K  +E +L+ +++  NVEL++LARYMQILS  LC ++ 
Sbjct: 132 TLRDVAEFYGVPFHHIPVTKETKEAAETELLRLVDSLNVELVVLARYMQILSPALCERLH 191

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H  +
Sbjct: 192 GGVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDS 251

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 252 VSVLQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|307728403|ref|YP_003905627.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
 gi|307582938|gb|ADN56336.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1003]
          Length = 289

 Score =  302 bits (773), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 181/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++   A F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLEALRASFATLAEQFGMSWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|58040501|ref|YP_192465.1| formyltetrahydrofolate deformylase [Gluconobacter oxydans 621H]
 gi|58002915|gb|AAW61809.1| Formyltetrahydrofolate deformylase [Gluconobacter oxydans 621H]
          Length = 292

 Score =  302 bits (773), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 125/284 (44%), Positives = 180/284 (63%), Gaps = 4/284 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++Y+LT++CP+   I + I   L+    NI +  QF+D D++  FMRI F      T M+
Sbjct: 9   TTYVLTLSCPNRPGIVAAISGRLAELNANITEAQQFDDRDSTVFFMRIVFEITDGQTSMQ 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   + + FS+ +++ +     K L++VS+ DHCL DLLYRW IG L +  VG+VS
Sbjct: 69  QLREALAVLGETFSMDWALHDRSVKPKVLLMVSRFDHCLVDLLYRWRIGELPIEPVGIVS 128

Query: 119 NHTTHKKLV-ENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        + Y +PF+YLP+T+  K   E +++++      EL+ILARYMQ+LS+ + 
Sbjct: 129 NHPREVFADLDFYGIPFHYLPVTKDTKPAQEAQILDLFAATGAELVILARYMQVLSNEMA 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             ++G  INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 189 ASLSGHCINIHHSFLPGFKGARPYHQAFARGVKLIGATAHYVTRDLDEGPIIEQDVERIS 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           HA T +D I  G++IE +VL +AV  HI++R  IN  +T+VF  
Sbjct: 249 HADTPDDLIRKGRDIERRVLARAVRYHIERRTIINGNRTVVFTP 292


>gi|254486193|ref|ZP_05099398.1| formyltetrahydrofolate deformylase [Roseobacter sp. GAI101]
 gi|214043062|gb|EEB83700.1| formyltetrahydrofolate deformylase [Roseobacter sp. GAI101]
          Length = 327

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 146/288 (50%), Positives = 206/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M +Y LT+TCPS   + + I +YL+   CNI D +QF+D +T   FMR+SF  +    + 
Sbjct: 34  MKNYALTVTCPSTRGVVAAIANYLADNACNITDSAQFDDKETGNFFMRVSFESDGTVDLA 93

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F      F + Y   +  E  K +I+VS+  HCLNDLLYRW IG L ++IV VVS
Sbjct: 94  ALAEGFVATASPFDMTYDFHDQTEKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVVS 153

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N  +PF+ + +T +NK E+E +++ ++E    +L++LARYMQILSD +C 
Sbjct: 154 NHMDYQKVVVNNDIPFHCIKVTAENKAEAEARIMAVVEDAGADLIVLARYMQILSDEMCQ 213

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGAT+HY   +LD GPIIEQD+V VTH
Sbjct: 214 KMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATSHYVTADLDEGPIIEQDIVGVTH 273

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI +RVF+N  KT+VFPA P +Y
Sbjct: 274 AQSANDYVSLGRDVESQVLARAIHAHIHRRVFLNGNKTVVFPASPGSY 321


>gi|294677927|ref|YP_003578542.1| formyltetrahydrofolate deformylase [Rhodobacter capsulatus SB 1003]
 gi|294476747|gb|ADE86135.1| formyltetrahydrofolate deformylase [Rhodobacter capsulatus SB 1003]
          Length = 294

 Score =  302 bits (773), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 156/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M++Y+LT+ C S   I + I +YL+  GCN+ D +Q++DL T + FMR++FV  T   + 
Sbjct: 1   MTTYVLTVNCHSTRGIVAAIANYLADSGCNLTDSNQYDDLLTGQFFMRVTFVSQTGATLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F+P+ Q+F ++++I + ++  K L++VS   HCLNDLLYRW IG L + IVGVVS
Sbjct: 61  SLKAGFEPVAQEFDMEWAIHDAEKKVKVLLMVSNFGHCLNDLLYRWRIGALPVEIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++K+V N+ +PF+++ +T++NK E+E  L++++E++  EL++LARYMQILSD LC 
Sbjct: 121 NHMTYQKVVVNHDIPFHHIKVTKENKPEAEAHLLDVVEESGAELVVLARYMQILSDKLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQ+ VR+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQETVRITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY+++G+++EA VL +A++AH+Q RVFIN  KT+VFPA P  Y
Sbjct: 241 AQSPEDYVSLGRDVEALVLARAIHAHVQHRVFINGNKTVVFPASPGGY 288


>gi|209521308|ref|ZP_03270025.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
 gi|209498254|gb|EDZ98392.1| formyltetrahydrofolate deformylase [Burkholderia sp. H160]
          Length = 314

 Score =  301 bits (772), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 183/288 (63%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 26  MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSGTGEFFMRVHFQQVGGD 85

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             +    A F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G + ++I 
Sbjct: 86  PGLDALRASFSTLAEQFGMRWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQINIDIP 145

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P+   T + K+  E +++ +I ++  +L++LARYMQI
Sbjct: 146 AIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKVAQEARVLEVINEHQADLVVLARYMQI 205

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS +LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 206 LSPNLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 265

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 266 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 313


>gi|323524693|ref|YP_004226846.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
 gi|323381695|gb|ADX53786.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1001]
          Length = 289

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 180/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++   A F  +  QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLEALRASFDTLAAQFGMSWEMHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|49083322|gb|AAT51001.1| PA4314 [synthetic construct]
          Length = 284

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 111/284 (39%), Positives = 177/284 (62%), Gaps = 3/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     +     +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPI+EQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIVEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF  
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVFDG 284


>gi|91781734|ref|YP_556940.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
 gi|91685688|gb|ABE28888.1| formyltetrahydrofolate deformylase [Burkholderia xenovorans LB400]
          Length = 289

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 181/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++   A F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLEALRASFATLAEQFGMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIA 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P    T + K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLMGATPEAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|152988898|ref|YP_001350218.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
 gi|150964056|gb|ABR86081.1| formyltetrahydrofolate deformylase [Pseudomonas aeruginosa PA7]
          Length = 283

 Score =  301 bits (772), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 176/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D D    FMR     +     +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEASHHSDNDNGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I +++   + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  DGFRQAFAPIAREFSMVWRITDSEVKKRVVLMASKESHCLADLLHRWHSGELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+  Q+K  +  ++  +I+++  + ++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPQDKQPAFDEVSRLIDEHGADCIVLARYMQILPPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLPSF GA PY QA + GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 RKYAHQVINIHHSFLPSFIGAKPYHQASKRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   +ED + +GK++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HRDNVEDMVRLGKDVEKLVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|226945872|ref|YP_002800945.1| formyltetrahydrofolate deformylase [Azotobacter vinelandii DJ]
 gi|226720799|gb|ACO79970.1| formyltetrahydrofolate deformylase [Azotobacter vinelandii DJ]
          Length = 283

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 176/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+++ + ++ E  + +++ S+  HCL DLL+RW+ G L   I  V+
Sbjct: 61  EEFRRAFAPIAREFSMKWRVSDSSELKRVVLMASRESHCLADLLHRWHSGELPCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+ ++P+  Q+K  +  ++  +I ++  + ++LARYMQIL   LC
Sbjct: 121 SNHDELRSMVEWHGIPYCHVPVDPQDKEPAFAEVSRLIREHAADTVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVR++
Sbjct: 181 REFAMQVINIHHSFLPSFVGARPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRIS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  ++ED + +GK++E  VL++ +  H++ RV ++  +T+VF
Sbjct: 241 HRDSVEDMVRLGKDVEKMVLSRGLRYHLEDRVLVHDNRTVVF 282


>gi|296329631|ref|ZP_06872116.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674028|ref|YP_003865700.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296153129|gb|EFG93993.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412272|gb|ADM37391.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 300

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI-- 61
            L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCEGIREKKETL 80

Query: 62  -ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  + + F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH
Sbjct: 81  QDAFASVAETFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE   +PF+Y+   +  + E E+K + ++E+  ++ ++LARYMQIL+       
Sbjct: 141 EEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYEIDTIVLARYMQILTPDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 NTEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|162146964|ref|YP_001601425.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785541|emb|CAP55112.1| putative formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 309

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 121/282 (42%), Positives = 178/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           +S+ +T++CP+   I + I   L     NI +  QF+D++T   FMR+ F   T  +   
Sbjct: 26  ASFTVTLSCPNRPGIVAAIATTLYEADGNITEAQQFDDVETGLFFMRVVFSIRTDGERLD 85

Query: 61  --IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    + ++F + +++ +     + L++VS+ DHCL DLLYRW IG L +    +V+
Sbjct: 86  WLRARLGAVAERFHMNWTLHDRAVRRRVLLMVSKFDHCLADLLYRWRIGELPMTPTAIVA 145

Query: 119 NHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PF++LP+T  NK E E++L  ++ + N EL++LARYMQ+LSD L 
Sbjct: 146 NHPRAAYGHIDMADIPFHHLPVTRDNKAEQEERLWTLVRQTNSELVVLARYMQVLSDSLT 205

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 206 ARLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQDVERVS 265

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 266 HFDTPADLVRKGRDIERRVLARAVRYHLDDRVILNGNKTVVF 307


>gi|332669642|ref|YP_004452650.1| formyltetrahydrofolate deformylase [Cellulomonas fimi ATCC 484]
 gi|332338680|gb|AEE45263.1| formyltetrahydrofolate deformylase [Cellulomonas fimi ATCC 484]
          Length = 291

 Score =  301 bits (771), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 181/278 (65%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + ++LT++CP    I   +   L+  G NI +  QF D  +   FMR+        ++  
Sbjct: 13  THWVLTLSCPDRPGIVRAVAGVLADHGGNITESQQFGDPLSGLFFMRVQVSAYAPREVLA 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + + F++ +S+       +TL++ S   HCLNDL +R     L +++V VVSNHT
Sbjct: 73  GAMSTVARTFAMTWSLDVVGRPVRTLVMGSTAAHCLNDLAFRQRSEKLPVDLVAVVSNHT 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           +   L E Y +PF+++P+T   K ++E +L+ ++E+ +VEL++LARYMQILSD LC ++ 
Sbjct: 133 SLAPLAEFYDIPFHHVPVTSATKAQAEARLLELVEELDVELVVLARYMQILSDDLCRRLA 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H ++
Sbjct: 193 GRVINIHHSFLPSFKGARPYAQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVERVDHTRS 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++D +A+G+++E + L +AV  H + RV ++  +TIVF
Sbjct: 253 VDDLVALGQDVERRALARAVRWHAEHRVLLDGHRTIVF 290


>gi|157691987|ref|YP_001486449.1| formyltetrahydrofolate deformylase [Bacillus pumilus SAFR-032]
 gi|157680745|gb|ABV61889.1| formyltetrahydrofolate deformylase [Bacillus pumilus SAFR-032]
          Length = 300

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 171/280 (61%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLF 60
            L ++CP    I S +  +L   G NI++ SQ+  D ++ + F+RI F +   +  M   
Sbjct: 21  RLLVSCPDQPGIVSAVSSFLFEHGANIIESSQYTTDHESGRFFLRIEFDWKDISANMDQL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI   F + +S+    E  K  I VS+  HCL++LL+ W  G L   I  V+SNH
Sbjct: 81  KQQFEPIASSFQMTWSMSRASELKKLAIFVSKELHCLHELLWEWQSGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T K  VE   +PF+++   +  + E+E++ + ++E+ +++ ++LARYMQIL+     + 
Sbjct: 141 ETAKDTVEALGIPFHFVKANKDIRKEAEKEQLALLEEYDIDAIVLARYMQILTPGFIEQH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNKIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ R+ +++ KTIVF 
Sbjct: 261 DAEALKNIGRTIERSVLARAVKWHLEDRIIVHENKTIVFN 300


>gi|170691483|ref|ZP_02882648.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
 gi|170143688|gb|EDT11851.1| formyltetrahydrofolate deformylase [Burkholderia graminis C4D1M]
          Length = 289

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 179/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             +      F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLDALRVSFATLAEQFGMNWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P+   T + K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|194014860|ref|ZP_03053477.1| formyltetrahydrofolate deformylase [Bacillus pumilus ATCC 7061]
 gi|194013886|gb|EDW23451.1| formyltetrahydrofolate deformylase [Bacillus pumilus ATCC 7061]
          Length = 300

 Score =  301 bits (771), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 171/280 (61%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCMKLF 60
            L ++CP    I S +  +L   G NI++ SQ+  D ++ + F+RI F +   +  M   
Sbjct: 21  RLLVSCPDQPGIVSAVSSFLFEHGANIIESSQYTTDHESGRFFLRIEFDWKDISANMDQL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI   F + +S+    E  K  I VS+  HCL++LL+ W  G L   I  V+SNH
Sbjct: 81  KQQFEPIAASFQMTWSMSRASELKKLAIFVSKELHCLHELLWEWQSGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T K  VE   +PF+++   +  + E+E++ + ++E+ +++ ++LARYMQIL+     + 
Sbjct: 141 ETAKDTVEALGIPFHFVKANKDIRKEAEKQQLTLLEEYDIDAIVLARYMQILTPGFIEQH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNKIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ R+ +++ KTIVF 
Sbjct: 261 DAEALKNIGRTIERSVLARAVKWHLEDRIIVHENKTIVFN 300


>gi|119964276|ref|YP_947011.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
 gi|119951135|gb|ABM10046.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
          Length = 311

 Score =  301 bits (771), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 116/279 (41%), Positives = 181/279 (64%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +++++T++CP    I   +   L   GCNI D  Q+    T   FMR+     +      
Sbjct: 33  TAFVVTLSCPDRPGIVHAVAGALLDAGCNIADSQQYGSPTTGNFFMRVEATTASSQDELA 92

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A  +P+ + F + + I    +  +T+IL S+  HCLNDLL++   GTL +++  +VSNH 
Sbjct: 93  AALRPVAESFGMTWQINPVGQKVRTIILCSKDAHCLNDLLFQQRTGTLPIDVPAIVSNHR 152

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L E Y +PF+++P+T + K ++E +L+ +I +++VEL +LARYMQ+LS+ LC ++ 
Sbjct: 153 DLESLAEFYGIPFHHIPVTPETKPQAEAELLKLIAEHDVELTVLARYMQVLSNDLCTELN 212

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ+V+RV HA+T
Sbjct: 213 GKAINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTADLDEGPIIEQEVIRVDHART 272

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              ++ +G+++E + L +AV  H + RV ++  +T+VF 
Sbjct: 273 AAQFVQMGRDVEGRTLAQAVQWHAEHRVLLDGTRTVVFN 311


>gi|150398028|ref|YP_001328495.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150029543|gb|ABR61660.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 294

 Score =  301 bits (770), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 157/288 (54%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M SY+LT+TC S   I + +  YL+  GCNI+D SQF+DL T   FMR++FV  T  K  
Sbjct: 1   MKSYVLTVTCKSTRGIIAAVSGYLAEAGCNIVDSSQFDDLQTGLFFMRLAFVSETGAKAA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P+ ++F +   IR+T+E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVAKRFGMTAEIRDTEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK  +E +L+ ++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFEYQKVVVNHDIPFHCIKVTKENKPRAEAQLMEVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|329945902|ref|ZP_08293589.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|328528350|gb|EGF55328.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 290

 Score =  301 bits (770), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 174/278 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +L+++CP    I   +   L+ +G NI +  QF D  T   FMR+  +         
Sbjct: 12  AHLVLSLSCPDRPGIVHAVTGTLARRGGNITESKQFGDSSTGLFFMRVQVLTTVPRVELE 71

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D   +  ++ +++S+     A +TLI+VS+  HCL DLL+R     L +++VGVV NH 
Sbjct: 72  KDLAELAGEYEMEWSLDEVGRAMRTLIMVSKEGHCLTDLLFRARSQGLPVDVVGVVGNHE 131

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
           T + + E Y +PF+++ +T+  K  +E +L+ +++  +VEL++LARYMQILS  LC ++ 
Sbjct: 132 TLRDVAEFYGVPFHHIAVTKDTKEAAEAELLGLVDSLDVELVVLARYMQILSPTLCERLH 191

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G +INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H   
Sbjct: 192 GGVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRAGHEDP 251

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    A G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 252 VATLQAKGQDVERRVLAQAVRWHTEHRVLLNGHRTVVF 289


>gi|317402315|gb|EFV82892.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans C54]
          Length = 284

 Score =  301 bits (770), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 179/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKL 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F          
Sbjct: 4   NDYILTLSCPDRTGIVFRVSGLLFESGCNILDSQQFGDEETGRFFLRVHFDLPAGAAPDA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +  ++ ++  + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDEMAAEYGMELQLHDARRKERLLIMVSKQGHCLNDLLFRVHSGQLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP+T   K E E++++ ++++  ++L++LARYMQILS  +C  
Sbjct: 124 HNDYASLAASYGIPFHHLPVTPDTKAEQERQVLALVDRYEIDLVVLARYMQILSADMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAH+   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHFVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAQDLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|296161549|ref|ZP_06844354.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
 gi|295888193|gb|EFG68006.1| formyltetrahydrofolate deformylase [Burkholderia sp. Ch1-1]
          Length = 289

 Score =  301 bits (770), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 179/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++     F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLEALRTSFATLAEQFGMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLGIEIA 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P    T   K   E +++ +I+++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLMGATPDAKAAQEARVLEVIDEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPKLCEALAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|209963484|ref|YP_002296399.1| formyltetrahydrofolate deformylase [Rhodospirillum centenum SW]
 gi|209956950|gb|ACI97586.1| formyltetrahydrofolate deformylase [Rhodospirillum centenum SW]
          Length = 281

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 179/280 (63%), Gaps = 1/280 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-KL 59
           M SY+LT++CP    I + +   L+    NILD +QF D  + + F+RISF         
Sbjct: 1   MQSYVLTLSCPDAVGIVATLSGLLAGHDANILDSAQFGDRISGRFFLRISFEVEDGRVDT 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                  + ++F +   + +     + +ILVS+  HCLNDLLYR+ IG LA++I  +VSN
Sbjct: 61  LRRALAEVAERFRMDLHLHDAGRRPRVMILVSRFGHCLNDLLYRYRIGALAMDIPAIVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H    +L   + +PF++LP+   NK   E++L+ IIE   ++L++LARYMQ+LS  LC +
Sbjct: 121 HRDFYQLAAWHDVPFHHLPVNGGNKERQEERLLEIIEGERIDLVVLARYMQVLSPTLCER 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ V RV H 
Sbjct: 181 LPGRCINIHHSFLPSFKGAKPYHQAFARGVKLIGATAHYVTTDLDEGPIIEQAVERVDHT 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +A+G++IE  VL +AV  H+++RV +N  KT+VF
Sbjct: 241 LGPDDLVAVGRDIECMVLARAVKYHLERRVLLNGSKTVVF 280


>gi|241207177|ref|YP_002978273.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861067|gb|ACS58734.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 294

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 150/288 (52%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M+SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT + F R+SF+      + 
Sbjct: 1   MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGRFFTRVSFISEEGVPLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F++   I +     K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELKEGFEPICKRFAMDAEIHDGSARMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK+++E ++++I+E+   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY+ GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYQRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +T+VFPA P  Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVFPASPGGY 288


>gi|146308332|ref|YP_001188797.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576533|gb|ABP86065.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 283

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 178/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + S  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+++ + ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  EGFKQAFAPIAREFSMEWRVTDSAQKKRVVLMASRESHCLADLLHRWHSNELDCDIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P++++P+  Q+K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYFHVPVNPQDKAPAFAEVERLVKEHGADVIVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT+HY   ELDAGPIIEQDVVR+T
Sbjct: 181 SEYAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATSHYVTEELDAGPIIEQDVVRIT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   IE+ + +GK++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HRDDIEEMVRLGKDVEKMVLARGLRYHLEDRVLVHDNKTVVFD 283


>gi|73541898|ref|YP_296418.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
 gi|72119311|gb|AAZ61574.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
          Length = 288

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 177/287 (61%), Gaps = 8/287 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MS+  +ILT++CP    I   +   L   GCNI+D  Q+ D  T + FMR+ F       
Sbjct: 1   MSNTGFILTLSCPDQPGIVHSVSGLLFQHGCNIVDSDQYGDEFTGRFFMRVHFTPSAGGP 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+  QF +Q+ + +     + +I+VS+  HCLNDLL+R  +G L + I  
Sbjct: 61  DLDALKAAFAPVGDQFGMQWELFDASAKPRVMIMVSKIGHCLNDLLFRAKVGGLPVEIAA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +VSNH    +L  +Y +PF +LP    + + K   E ++  ++   N++L++LARYMQ+L
Sbjct: 121 IVSNHRDFYQLAASYDVPFIHLPLMNASAEQKAAQEARVFEVVRDQNIDLVVLARYMQVL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD LC K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 181 SDDLCRKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQE 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + RV H+   +   ++G+++E   L +AV  H + R+ +N  KT+VF
Sbjct: 241 IARVDHSMDPDQLTSVGRDVECVALARAVKWHAEHRILLNGHKTVVF 287


>gi|33594158|ref|NP_881802.1| formyltetrahydrofolate deformylase [Bordetella pertussis Tohama I]
 gi|33598126|ref|NP_885769.1| formyltetrahydrofolate deformylase [Bordetella parapertussis 12822]
 gi|33603019|ref|NP_890579.1| formyltetrahydrofolate deformylase [Bordetella bronchiseptica RB50]
 gi|33564232|emb|CAE43521.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33566684|emb|CAE38894.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis]
 gi|33568650|emb|CAE34408.1| putative formyltetrahydrofolate deformylase [Bordetella
           bronchiseptica RB50]
 gi|332383573|gb|AEE68420.1| formyltetrahydrofolate deformylase [Bordetella pertussis CS]
          Length = 284

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 175/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMKL 59
           + YILT++CP    I   +   L   GCNI D  QF D +T + F+R+ F          
Sbjct: 4   NDYILTLSCPDRTGIVFRVSGLLFELGCNIRDSQQFGDEETGRFFLRVHFDLPRAAAESA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +   + +Q+ I +     + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LREQFAALANGYDMQWQIHDAHRKARLLIMVSKQGHCLNDLLFRVSSGQLRAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF+++P+T   K   E++++ ++E+  ++L++LARYMQILS  +C  
Sbjct: 124 HNDYASLAASYGIPFHHMPVTPDTKAAQERQVLELVEREQIDLVVLARYMQILSADMCQA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H 
Sbjct: 184 LAGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAADLTQVGSDIESLVLSRAVRSHVEHRILLNRSKTVVF 283


>gi|119484296|ref|ZP_01618913.1| formyltetrahydrofolate deformylase [Lyngbya sp. PCC 8106]
 gi|119457770|gb|EAW38893.1| formyltetrahydrofolate deformylase [Lyngbya sp. PCC 8106]
          Length = 284

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 113/284 (39%), Positives = 173/284 (60%), Gaps = 6/284 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           M+  +  + ++CP  + + + I +++ + G NI+   Q  D  +     RI +    FN 
Sbjct: 1   MNSPTATILLSCPDQQGLVAKIANFIYSNGGNIIHADQHTDFASGVFLTRIEWQLEGFNL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             ++    F  I +  +  + +  + +  +  I +++ DHCL DLL+RW    +A+ I  
Sbjct: 61  PREVINPAFGAIAKPLAANWQLHFSDKIPRIAIWITKQDHCLLDLLWRWQAKEMAVEIPV 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNHT  K L E + + FY++P+T+ NK E E K + I+++  ++L++LA+YMQILS  
Sbjct: 121 IISNHTDLKSLAEQFGIDFYHIPITKTNKKEQEIKQLEILKQYQIDLVVLAKYMQILSST 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +    IINIHHSFLP+F GANPY++AY  GVKIIGATAHY   +LD GPIIEQDVVR
Sbjct: 181 FVAQFP-NIINIHHSFLPAFPGANPYQRAYTRGVKIIGATAHYVTEDLDEGPIIEQDVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H   I D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 240 VSHRDAIADLIRKGKDLERLVLARAVRLHLQNRVLVYNNRTVVF 283


>gi|84494622|ref|ZP_00993741.1| formyltetrahydrofolate deformylase [Janibacter sp. HTCC2649]
 gi|84384115|gb|EAP99995.1| formyltetrahydrofolate deformylase [Janibacter sp. HTCC2649]
          Length = 296

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 122/278 (43%), Positives = 186/278 (66%), Gaps = 3/278 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
           +LT++CP    I + +  +L  +  NI +  QF+D  T + FMR+ F     N  ++ + 
Sbjct: 18  VLTLSCPDRPGIVARVTQHLFERQANIEESQQFSDHRTGRYFMRVRFDTGDANVDVERWR 77

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           ++F  +  +F + + +R    A +TL++VS+  H LNDLL+RW  G +  +IVG+VSNH 
Sbjct: 78  SEFASVAIEFEMVWELRRAVTAYRTLLMVSKFGHVLNDLLFRWKSGQVNADIVGIVSNHP 137

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + +  +Y +PF+++P+T   K E+E KL+ ++ +++VEL+ LARYMQ+LSD LC ++ 
Sbjct: 138 DLEPMARSYGIPFHHIPVTRDTKAEAEAKLLELVAEHDVELITLARYMQVLSDDLCRQLG 197

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQD+ RV H   
Sbjct: 198 GRVINIHHSFLPSFKGAKPYHQAYARGVKVIGATAHYVTADLDEGPIIEQDIHRVDHRMD 257

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED ++ G+ +E++V  +AV  H + RV +N+ +T+VF
Sbjct: 258 AEDLVSAGEEVESRVFARAVKWHCESRVILNEDRTVVF 295


>gi|218437025|ref|YP_002375354.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7424]
 gi|218169753|gb|ACK68486.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7424]
          Length = 284

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 109/281 (38%), Positives = 168/281 (59%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S+  L I+CP  + + + I +++ + G NI+   Q  D        R+ +    FN    
Sbjct: 4   STATLLISCPDQKGLVAKIANFIYSNGGNIIHADQHTDFSAGLFLTRLEWQLDGFNLPKP 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  I +     +S+  +    +  I V++ +HCL DLL+R     +A  I  ++S
Sbjct: 64  MIEPAFAAIAKPLDAVWSLHFSDVTPRIAIWVTKQNHCLLDLLWRQQAKEIAAEIPLMIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E + + F+++P+T++ K+E E K + ++   N++L++LA+YMQILS     
Sbjct: 124 NHKQLQPIAEQFGIDFHHIPITKETKLEQEAKQLELLRHYNIDLVVLAKYMQILSPEFVE 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K    +INIHHSFLP+F GANPY++AYE GVKIIGATAHY   +LD GPIIEQDV R++H
Sbjct: 184 KFPH-VINIHHSFLPAFPGANPYQRAYERGVKIIGATAHYVTADLDEGPIIEQDVERISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ D I  GK++E  VL +AV  H+Q RV + + KT+VF
Sbjct: 243 RDTVGDLIRKGKDLERMVLARAVRLHLQNRVLVYENKTVVF 283


>gi|218510147|ref|ZP_03508025.1| formyltetrahydrofolate deformylase [Rhizobium etli Brasil 5]
          Length = 294

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 152/288 (52%), Positives = 214/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-- 58
           M + +LT+TC S   I + I  YL+ + CNI+D SQF+DLDT K FMR+SF+    +   
Sbjct: 1   MKNVVLTVTCKSTRGIVAAISSYLAEKRCNIIDSSQFDDLDTGKFFMRVSFISEEGLAGS 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  +   F + Y   +++   K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  AISADFAAVAAPFEMDYDFHDSESRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L+ ++ +   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPQAEAQLVELVNQTGTELIVLARYMQVLSDQLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 QMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +A++AHI  R FIN  +T+VFPA P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAIHAHIHHRTFINGNRTVVFPASPGSY 288


>gi|220909397|ref|YP_002484708.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7425]
 gi|219866008|gb|ACL46347.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7425]
          Length = 287

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
             Y LT++CP    I + +  +++  G  I++     D D  + FMR           + 
Sbjct: 6   RHYTLTLSCPDRVGIVAAVSSFIAGNGGWIMEAQHHADWDEKRFFMRQVILAESLPFEIA 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI   F + ++I ++    + +ILVS+ DHCL DLL RW  G LA+ I  V+S
Sbjct: 66  ELRDRFSPIAASFQMSWNITDSAVKKRVVILVSKLDHCLYDLLARWRSGELAIEIPAVIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T + LVE + +P+ Y+P+T   K  +  K+ ++  + + + M+LARYMQILS  LC 
Sbjct: 126 NHETLRSLVEWHGIPYIYIPVTAATKAVAYAKIAHLFTELHGDTMVLARYMQILSSDLCD 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  G+I+NIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQDV+R+ H
Sbjct: 186 RYPGQILNIHHSFLPSFVGAKPYHQAYERGVKLIGATCHYVTTELDAGPIIEQDVIRIDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + ++ED +  G++IE  VL + +  H++ RV ++  KT+VF
Sbjct: 246 SDSVEDLVRYGRDIEKNVLARGLRYHVEDRVLLHGNKTVVF 286


>gi|325283327|ref|YP_004255868.1| formyltetrahydrofolate deformylase [Deinococcus proteolyticus MRP]
 gi|324315136|gb|ADY26251.1| formyltetrahydrofolate deformylase [Deinococcus proteolyticus MRP]
          Length = 287

 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 125/276 (45%), Positives = 173/276 (62%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT++C     I   +   +   G NI+   QF D DT   FMR+          F   
Sbjct: 11  FILTLSCMDRPGIVHAVSGAIMGAGGNIIQSQQFGDTDTGLFFMRVEADLPGGEDAFREQ 70

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
              + Q F + +++       +T+I+VS+  HCL+DLL+R     L L+IV VV NH   
Sbjct: 71  MAALAQTFGMTWTLDRQGRPIRTVIMVSKEGHCLSDLLFRQRSRHLPLDIVAVVGNHADL 130

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L E Y +PF +LP+T   K ++E  L+ ++E+ NVEL++LARYMQILSD LC +M+GR
Sbjct: 131 APLAEFYGVPFVHLPVTPDTKAQAEAALLELVERENVELVVLARYMQILSDTLCGRMSGR 190

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLPSFKGA PY QAY  GVK++GATAHY   +LD GPIIEQDV R+THA ++ 
Sbjct: 191 IINIHHSFLPSFKGARPYAQAYARGVKLMGATAHYVTADLDEGPIIEQDVTRITHADSVA 250

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +  G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 251 AMVQQGQDVERRVLAQAVTWHAEHRVLLNGHRTVVF 286


>gi|160896529|ref|YP_001562111.1| formyltetrahydrofolate deformylase [Delftia acidovorans SPH-1]
 gi|160362113|gb|ABX33726.1| formyltetrahydrofolate deformylase [Delftia acidovorans SPH-1]
          Length = 307

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 129/281 (45%), Positives = 181/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  YILT++CP    +   +  +L  QG NI + +Q+ND  T   FMR+ F  N     
Sbjct: 26  MTQAYILTLSCPDRLGLVHAVSGFLLEQGGNIEEAAQYNDPATGLFFMRVQFACNGCDPA 85

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    +  Q+ +++ +    EA KT+++VS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 86  ALRAALADLGGQYQMKWRLHTKAEAMKTVLMVSKEGHCLNDLLFRWKSGLLPVDIRAIIS 145

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K ++E K   IIE    EL++LARYMQ+LS+ LC 
Sbjct: 146 NHREFYQLAASYNIPFHHIPVTAATKAQAEAKQFEIIEAEGAELVVLARYMQVLSNDLCT 205

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 206 KLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 265

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED  A G++ E++VL +AV  H + RV +N  KT+VF
Sbjct: 266 TDTVEDLTARGRDTESQVLARAVKWHSEHRVILNGHKTVVF 306


>gi|15805611|ref|NP_294307.1| formyltetrahydrofolate deformylase [Deinococcus radiodurans R1]
 gi|6458282|gb|AAF10164.1|AE001917_1 formyltetrahydrofolate deformylase [Deinococcus radiodurans R1]
          Length = 298

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 106/283 (37%), Positives = 165/283 (58%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
            +  LTI+C     I + +  +L   G NI+   Q   D    + FMR+ F     +   
Sbjct: 16  QTATLTISCADQPGIVAAVSQFLHNHGANIIHSDQHSTDPAGGQFFMRMEFFLGGLDLTR 75

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + F   F+ +  +   + + +    +  K  +LVS+ DHC  DLL+R   G L + I  +
Sbjct: 76  EAFERAFEQVVARPLGMDWRLNLASQPKKMAVLVSRYDHCFLDLLWRRRRGELNVEIPLI 135

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++  E + +PF+ +P+T+ NK E+E + + ++ +   +  +LARYMQILS   
Sbjct: 136 LSNHEDLRRDAEMFGIPFHVIPVTKANKAEAEAEQVRLMHEAGADFAVLARYMQILSSDF 195

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                  +INIHHSFLP+F GANPY+ A+  GVK+IGAT+HY   ELDAGPII QDV+ V
Sbjct: 196 LRGFGRPVINIHHSFLPAFIGANPYRAAFNRGVKLIGATSHYVTEELDAGPIIAQDVIPV 255

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH +T +  + +G+++E +VL +AV AH++ RV +   KT+VF
Sbjct: 256 THRETPDTLMRMGRDVERQVLARAVKAHVEDRVLVYGNKTVVF 298


>gi|296533007|ref|ZP_06895657.1| formyltetrahydrofolate deformylase [Roseomonas cervicalis ATCC
           49957]
 gi|296266670|gb|EFH12645.1| formyltetrahydrofolate deformylase [Roseomonas cervicalis ATCC
           49957]
          Length = 317

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 117/279 (41%), Positives = 179/279 (64%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--LFI 61
           ++LT+ C +   I + +   L   G NI +  QF+D  T + FMR+ F     ++     
Sbjct: 37  FVLTLNCVNRPGIVAAVASALFEAGGNIREAQQFDDTGTGRFFMRVVFDVPAAVERAALE 96

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A    +  +F + +++R+     + ++LVS+ DHCL DLLYRW IG L + + G+VSNH 
Sbjct: 97  AALLTVATRFGMDWTLRDRAAKRRVMLLVSKFDHCLADLLYRWRIGELPMELTGIVSNHP 156

Query: 122 THKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                  ++  +PF++LP+T+  K+E E ++  + +++  +LM+LARYMQ+LSD L  K+
Sbjct: 157 LETYAHLDFTGVPFHHLPVTKATKMEQEAEIWRLFQESRSDLMVLARYMQVLSDGLSAKL 216

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQDV R++HA 
Sbjct: 217 PGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHFVTADLDEGPIIEQDVERISHAD 276

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T ED +  G++IE +VL +A++  ++ R+ +N  KT+VF
Sbjct: 277 TAEDLVRKGRDIERRVLARAISFFLEDRIILNGNKTVVF 315


>gi|295675425|ref|YP_003603949.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
 gi|295435268|gb|ADG14438.1| formyltetrahydrofolate deformylase [Burkholderia sp. CCGE1002]
          Length = 289

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 181/288 (62%), Gaps = 9/288 (3%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTDHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             +    A F  + +QF + + + +     + +I+VS+  HCLNDLL+R+  G L ++I 
Sbjct: 61  PGLDALRASFVALAEQFGMSWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIDIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            ++SNH    +L  +Y +PF++ P+   T + K   E +++ +I ++  +L++LARYMQI
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLLGGTPEAKTAQEARVLEVINEHQADLVVLARYMQI 180

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS +LC  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 181 LSPNLCKSLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 240

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T E   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 241 EVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRVVLNGSKTVVF 288


>gi|158423116|ref|YP_001524408.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
 gi|158330005|dbj|BAF87490.1| formyltetrahydrofolate deformylase [Azorhizobium caulinodans ORS
           571]
          Length = 289

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 185/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
            +++L  +CP    I + +  +L  QGCNIL+  QF+D ++++ FMR++F        + 
Sbjct: 6   QTFVLKFSCPDRAGIVAAVSTFLYEQGCNILEAQQFDDTESNRFFMRVAFNVIEGTADLP 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+   F L +S+R+  E  + L+LVS+ DHCL DLLYRW IG + + I G++S
Sbjct: 66  RIRTAFGPVADGFKLDWSMRDPAEKRRVLLLVSKFDHCLADLLYRWRIGEIPMEITGIIS 125

Query: 119 NHTTHKKLVENY-QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++  +PF++LP+++  K+E E ++  I +++  E+ +LARYMQ+LSD L 
Sbjct: 126 NHPIETYAHLDFDGIPFHHLPVSKATKMEQEAQVWRIFQESGSEMAVLARYMQVLSDGLS 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R+T
Sbjct: 186 AKLSGRCINIHHSFLPGFKGAKPYHQAHQRGVKLIGATAHYVTSDLDEGPIIEQDVERIT 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  + +D +  G++IE +VL +A+  H+Q RV  N  KTIVF
Sbjct: 246 HQDSPDDLVRKGRDIERRVLARALAWHLQDRVIPNGHKTIVF 287


>gi|224826673|ref|ZP_03699774.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
 gi|224601274|gb|EEG07456.1| formyltetrahydrofolate deformylase [Lutiella nitroferrum 2002]
          Length = 287

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           +S  L I+CP  + + + I ++L T   NI+   Q  D+  +   MRI +  +     M+
Sbjct: 6   NSATLLISCPDKKGLVAAIANFLMTYNANIMHADQHQDVSENLFLMRIEWSLDGFTLPME 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A FQPI  +  + + +  +    +  I VS+ +HCL DLL+RW IG L  +I  ++S
Sbjct: 66  SFAAAFQPIADKHGMTWRVSLSSRKPRMAIFVSKYEHCLVDLLHRWRIGELNCDIPLIIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E   +P++ +P+T+ NK E+E +   ++E+  V++++LARYMQ+LS     
Sbjct: 126 NHEDCRRMAEFNGIPYHVVPVTQTNKEEAEAEQWRLLEEAGVDVIVLARYMQVLSQRFVE 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY    LD GPIIEQ+V R++H
Sbjct: 186 RFPNRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEVLDDGPIIEQEVTRISH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED +  G+++E  VL++AV  H+  RV     KT+VF 
Sbjct: 246 RDDVEDLVQKGRDLEKVVLSRAVRWHLDDRVLSYSNKTVVFD 287


>gi|89899420|ref|YP_521891.1| formyltetrahydrofolate deformylase [Rhodoferax ferrireducens T118]
 gi|89344157|gb|ABD68360.1| formyltetrahydrofolate deformylase [Rhodoferax ferrireducens T118]
          Length = 282

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 125/277 (45%), Positives = 179/277 (64%), Gaps = 1/277 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMKLFIA 62
           YILT++CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F       +    
Sbjct: 5   YILTLSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDQDTGLFFMRVQFACAQLTHEDLTL 64

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
             +   Q F +Q+ +    +  +T+I+VS+  HCLNDLL+RW  G L ++I  ++SNH  
Sbjct: 65  QLKAFAQPFEMQWRLHARAQPIRTVIMVSKEGHCLNDLLFRWKSGLLPIDIRAIISNHRE 124

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
             +L  +Y +PF++LP+T   K + E +   II+    EL++LARYMQ+LSD LC K++G
Sbjct: 125 FYQLAASYNVPFHHLPITAATKPQVEARQYEIIQTEAAELVVLARYMQVLSDDLCRKLSG 184

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
             INIHHSFLPSFKGA PY QA++ GVK+IGATAHY    LD GPIIEQDV RV H++T+
Sbjct: 185 SAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTANLDEGPIIEQDVARVDHSKTV 244

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED   +G++ E++VL +AV  H + RV IN  KT++F
Sbjct: 245 EDLTTLGRDTESQVLARAVKWHSEHRVLINGHKTVIF 281


>gi|115397175|ref|XP_001214179.1| formyltetrahydrofolate deformylase [Aspergillus terreus NIH2624]
 gi|114192370|gb|EAU34070.1| formyltetrahydrofolate deformylase [Aspergillus terreus NIH2624]
          Length = 284

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 125/284 (44%), Positives = 178/284 (62%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TC 56
           M S+ILT++CP    I   +  +L     NI+D SQF D  + + FMR+ F         
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVQHNLNIIDSSQFGDPTSQRFFMRVHFKAESSEKPS 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++     F+      S+ + +    + T+ LI+VS+  HCLNDLL+R + G LA+ I  +
Sbjct: 61  VEDLRKAFESTATDLSMDFQVVPAAQKTRVLIMVSKIGHCLNDLLFRQSTGQLAIEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     L   Y +PF +LP+T   K + E +++ +I ++N++L++LARYMQ+LS  L
Sbjct: 121 VSNHPEFAALAATYNIPFVHLPVTADTKPQQEAQVLELIREHNIDLVVLARYMQVLSPTL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVRV
Sbjct: 181 CEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            H+ + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 241 NHSMSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVFN 284


>gi|315606024|ref|ZP_07881055.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|315312306|gb|EFU60392.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 180
           str. F0310]
          Length = 311

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 174/278 (62%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 32  AQLVVTLSCPDRPGIVHAVTGVIGESGGNVVQSQQFGDSDTGTFFMRVEVDSPKGRAPID 91

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F   Y + +     +T+I+VS+  HCL DLLYR     L ++++ VV NH 
Sbjct: 92  EGLAAVAEEFDATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGLPIDVIAVVGNHP 151

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K  +E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 152 DLAPVAQFYGVPFLNIPVTKDAKAHAERQLLDLIASENVELVVLARYMQILSDEVCRAME 211

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 212 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 271

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 272 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 309


>gi|253576555|ref|ZP_04853883.1| formyltetrahydrofolate deformylase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843969|gb|EES71989.1| formyltetrahydrofolate deformylase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 299

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 123/283 (43%), Positives = 171/283 (60%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNT---CM 57
           +   + I+CP    I + +  +L   G NI+   Q+  D +    FMRI F  +     +
Sbjct: 18  NRARMLISCPDGPGIVAAVSRFLYEHGANIVQSDQYTMDPEGGMFFMRIEFDLDGLDGRI 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               +DF+ I  QF +Q++I       K  I VS+ DHCL +LL++W  G L   I  VV
Sbjct: 78  DALKSDFEAIASQFRMQWNIYQLSRKKKLAIFVSKEDHCLVELLWQWQAGDLDAEISMVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P+Y++P+T + K E+EQK + I+    V+L++LARYMQILS  L 
Sbjct: 138 SNHPDMKEYVESFGIPYYHIPVTPETKHEAEQKQLEIVSG-KVDLIVLARYMQILSPALI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                R+INIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 EPYRNRLINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   + +   IG+ IE  VL +AV  HI+ R+ +++ KT+VF 
Sbjct: 257 HRDDVSELKRIGRTIERVVLARAVKWHIEDRILVHQNKTVVFN 299


>gi|154685725|ref|YP_001420886.1| formyltetrahydrofolate deformylase [Bacillus amyloliquefaciens
           FZB42]
 gi|154351576|gb|ABS73655.1| YkkE [Bacillus amyloliquefaciens FZB42]
          Length = 300

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 166/280 (59%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI-- 61
            L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCKGIREKKEDL 80

Query: 62  -ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I Q F + +S+    E  +  I VS+  HCL++L++ W  G +   I  V+SNH
Sbjct: 81  QQAFASIAQTFGMTWSLSLASELKRVAIFVSKELHCLHELIWEWQSGNMMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K++VE   +PF+Y+   +  + E E++ + ++E+  +++++LARYMQIL+       
Sbjct: 141 EEAKEVVEPLNIPFHYMKANKDIRAEVERRQLELLERYKIDVIVLARYMQILTSDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTDDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             ED   IG+ IE  VL +AV  H++ RV ++  KTIVF 
Sbjct: 261 HAEDLKNIGRTIERSVLARAVKWHLEDRVIVHGNKTIVFN 300


>gi|116250000|ref|YP_765838.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115254648|emb|CAK05722.1| putative formyltetrahydrofolate deformylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 294

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M+SY+LT++C S   I + I  YL+ +GCNI+D SQF+DLDT K F R+SF+      + 
Sbjct: 1   MTSYVLTVSCKSTRGIVAAISSYLADKGCNIVDSSQFDDLDTGKFFTRVSFISEEGVPLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+PI ++F++   I +     K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELKEGFEPICKRFAMDAEIHDGNARMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK+++E ++++I+E+   EL++LARYMQ+LSD +C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKLQAEGQIMDIVEQTGTELIVLARYMQVLSDAMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAY  GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYGRGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +T+VFPA P  Y
Sbjct: 241 AQSPDDYVSIGRDVESQVLARAIHAHIHHRTFLNGNRTVVFPASPGGY 288


>gi|291483836|dbj|BAI84911.1| formyltetrahydrofolate deformylase [Bacillus subtilis subsp. natto
           BEST195]
          Length = 300

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 168/280 (60%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLF--- 60
            L ++CP    I S +  +L     NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHDANIIESNQYTTDPEGGRFFLRIEFDCAGIREKKASL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  + ++F + +S+    E  +  I VS+  HCL++L++ W  G L   I  V+SNH
Sbjct: 81  QAAFASVAEKFDMTWSLTLASELKRVAIFVSKELHCLHELIWEWQTGNLMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE   +PF+Y+   +  + E E+K + ++E+ +V++++LARYMQIL+       
Sbjct: 141 EEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDVDVIVLARYMQILTPDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTNDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             E    IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 NAEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|306818362|ref|ZP_07452088.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35239]
 gi|304648871|gb|EFM46170.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35239]
          Length = 319

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 125/278 (44%), Positives = 174/278 (62%), Gaps = 1/278 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
              +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S       +   
Sbjct: 42  QRLVLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDV-PSRETVE 100

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              Q + Q + + +S+       +T+I+VS+  HCL+DLLYR     L +++  VV NH 
Sbjct: 101 TRVQELAQTYDMNWSLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHP 160

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM 
Sbjct: 161 DLSPIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMG 220

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T
Sbjct: 221 GRIINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLT 280

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 281 TAAMQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 318


>gi|26988101|ref|NP_743526.1| formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148549561|ref|YP_001269663.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|24982828|gb|AAN66990.1|AE016327_5 formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|148513619|gb|ABQ80479.1| formyltetrahydrofolate deformylase [Pseudomonas putida F1]
 gi|313500407|gb|ADR61773.1| PurU_2 [Pseudomonas putida BIRD-1]
          Length = 283

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 109/283 (38%), Positives = 173/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR           +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 RDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|104780363|ref|YP_606861.1| formyltetrahydrofolate deformylase [Pseudomonas entomophila L48]
 gi|95109350|emb|CAK14050.1| putative formyltetrahydrofolate deformylase PurU-2 [Pseudomonas
           entomophila L48]
          Length = 283

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 109/283 (38%), Positives = 172/283 (60%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR           +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMTWRITDSAQKKRVVLMASRESHCLADLLHRWHTNELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  ++++   + ++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFHHVPVDPKDKQPAFAEVSRLVQEYAADAVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 QEYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVFN 283


>gi|87200875|ref|YP_498132.1| formyltetrahydrofolate deformylase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136556|gb|ABD27298.1| formyltetrahydrofolate deformylase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 284

 Score =  299 bits (767), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 117/282 (41%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMK 58
           MS S ILT++C     I + +   L   G NI +  QF+D  + + FMR+ F      ++
Sbjct: 1   MSASLILTLSCEDKPGIVARVTGNLFEAGGNIREAQQFDDPLSGRFFMRVVFDPAEGSVE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            + A F  +   +++++++R+T    K +++VS+ DHCL DLLYR  IG L +++V ++ 
Sbjct: 61  HYRAAFAAVADHYAMEWNLRDTTVKRKVILMVSKFDHCLGDLLYRTRIGELPMDVVAILG 120

Query: 119 NHTTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH      +     +P+++LP+T+  K + E ++  I+ +   EL++LARYMQILSD L 
Sbjct: 121 NHPKEALNISLIGDIPYHHLPITKDTKPQQEAEVKRIVTETGAELVVLARYMQILSDDLA 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             ++GR INIHHSFLPSFKGA PY QA+  GVK+IGAT HY   +LD GPII QDV  VT
Sbjct: 181 AFLSGRCINIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTADLDEGPIIHQDVETVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + +D +  G+++E +VL +AV  H++ R  +N  KT+VF
Sbjct: 241 HADSPDDLVRKGRDVERRVLAEAVRLHLEDRALVNGNKTVVF 282


>gi|296130345|ref|YP_003637595.1| formyltetrahydrofolate deformylase [Cellulomonas flavigena DSM
           20109]
 gi|296022160|gb|ADG75396.1| formyltetrahydrofolate deformylase [Cellulomonas flavigena DSM
           20109]
          Length = 288

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 120/278 (43%), Positives = 179/278 (64%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +LT++CP    I + +   L+  G NI +  QF D  +   FMR+    +       
Sbjct: 10  THLVLTLSCPDRPGIVAAVAGLLAQHGGNITESQQFGDPLSGLFFMRVQVTTDAGADALR 69

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            D Q +  +F + + +       +TL++VS   HCLNDL +R     L +++V VVSNH 
Sbjct: 70  EDLQALAVRFEMTWRLDVVGRPLRTLVMVSTAAHCLNDLAFRQRSENLPVDLVAVVSNHD 129

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + + + Y +PF+++P+T   K  +E +L+ ++E+ +VEL++LARYMQILSD LC ++ 
Sbjct: 130 VLRPMADFYDIPFHHVPVTAATKAAAEARLLELVEELDVELVVLARYMQILSDELCRRLE 189

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV HA  
Sbjct: 190 GRVINIHHSFLPSFKGARPYAQAHDRGVKLIGATAHYVTGDLDEGPIIEQDVERVDHAHA 249

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +ED +A+G+++E + L +AV  H + RV ++ R+TIVF
Sbjct: 250 VEDLVALGQDVERRALARAVRWHAEHRVLMDGRRTIVF 287


>gi|121607699|ref|YP_995506.1| formyltetrahydrofolate deformylase [Verminephrobacter eiseniae
           EF01-2]
 gi|121552339|gb|ABM56488.1| formyltetrahydrofolate deformylase [Verminephrobacter eiseniae
           EF01-2]
          Length = 282

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 178/281 (63%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           M+  Y+LT++CP    +   +  +L   G NI + +Q+ND  T   FMR+ F        
Sbjct: 1   MTHAYVLTLSCPDRLGLVHAVSGFLLEHGGNIEEAAQYNDHATGLFFMRVRFACALHDQA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F            +++S+    E  KT++LVS+  HCLNDLL+RW  G L ++I  ++S
Sbjct: 61  GFKDRLGRFAALHQMRWSLHLAAEPVKTVLLVSKEGHCLNDLLFRWQSGLLPVDIRAIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L  +Y +PF++LP++   K ++E +L+ IIE    EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFCPLAASYAVPFHHLPVSAATKAQAEARLLEIIEAEGAELVVLARYMQVLSDALCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 QLAGRVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQDVARAEH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+E  IA G++ E++VL +AV  H + RV ++  KT+VF
Sbjct: 241 TDTVETLIARGRDTESQVLARAVKWHSEHRVLLDGHKTVVF 281


>gi|227875095|ref|ZP_03993240.1| Formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35243]
 gi|307701463|ref|ZP_07638482.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris FB024-16]
 gi|227844373|gb|EEJ54537.1| Formyltetrahydrofolate deformylase [Mobiluncus mulieris ATCC 35243]
 gi|307613373|gb|EFN92623.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris FB024-16]
          Length = 319

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 125/278 (44%), Positives = 174/278 (62%), Gaps = 1/278 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
              +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S       +   
Sbjct: 42  QRLVLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDV-PSRETVE 100

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              Q + Q + + +S+       +T+I+VS+  HCL+DLLYR     L +++  VV NH 
Sbjct: 101 TRVQELAQTYDMNWSLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHP 160

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM 
Sbjct: 161 DLSPIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMG 220

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T
Sbjct: 221 GRIINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLT 280

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 281 TAAMQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 318


>gi|167035440|ref|YP_001670671.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
 gi|166861928|gb|ABZ00336.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
          Length = 283

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 109/283 (38%), Positives = 173/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR           +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFAPIAEEFSMAWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 RDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|330504552|ref|YP_004381421.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
 gi|328918838|gb|AEB59669.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina NK-01]
          Length = 283

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 176/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I+CP    I + + ++L+T    I + S  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVISCPDRVGIVAKVSNFLATYNGWITEASHHSDTQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  DGFKQAFSPIAREFSMEWRITDSAQKKRVVLMASRESHCLADLLHRWHSNELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           +NH   + +VE + +P++++P+   +K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 ANHDDLRSMVEWHGIPYFHVPVDPADKAPAFAEVERLVKEHRADVIVLARYMQILPPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT+HY   ELDAGPIIEQDVVRVT
Sbjct: 181 AEFAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATSHYVTEELDAGPIIEQDVVRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   IE+ + +GK++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HRDDIEEMVRLGKDVEKMVLARGLRYHLEDRVLVHDNKTVVFD 283


>gi|209544029|ref|YP_002276258.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531706|gb|ACI51643.1| formyltetrahydrofolate deformylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 291

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 121/282 (42%), Positives = 178/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           +S+ +T++CP+   I + I   L     NI +  QF+D++T   FMR+ F   T  +   
Sbjct: 8   ASFTVTLSCPNRPGIVAAIATTLYEADGNITEAQQFDDVETGLFFMRVVFSIRTDGERLD 67

Query: 61  --IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A    + ++F + +++ +     + L++VS+ DHCL DLLYRW IG L +    +V+
Sbjct: 68  WLRARLGAVAERFHMNWTLHDRAVRRRVLLMVSKFDHCLADLLYRWRIGELPMTPTAIVA 127

Query: 119 NHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PF++LP+T  NK E E++L  ++ + N EL++LARYMQ+LSD L 
Sbjct: 128 NHPRAAYGHIDMADIPFHHLPVTRDNKAEQEERLWTLVRQTNSELVVLARYMQVLSDSLT 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 188 ARLSGRCINIHHSFLPGFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQDVERVS 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 248 HFDTPADLVRKGRDIERRVLARAVRYHLDDRVILNGNKTVVF 289


>gi|218249081|ref|YP_002374452.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 8801]
 gi|257062168|ref|YP_003140056.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 8802]
 gi|218169559|gb|ACK68296.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 8801]
 gi|256592334|gb|ACV03221.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 8802]
          Length = 284

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 107/284 (37%), Positives = 164/284 (57%), Gaps = 6/284 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNT 55
           MS  +  L I+CP  + + +   +++ + G NI+   Q  D +      RI +    F  
Sbjct: 1   MSEPTATLLISCPDQKGLVATFANFIYSNGGNIIHADQHTDFEAGLFLTRIEWQLKDFQL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
              +    F  I +     + I  +    +  I V++ +HCL DLL+RW    L  +I  
Sbjct: 61  SRDMIAPAFAAIAKPMQAVWQIHFSDTIPRLAIWVTKQEHCLLDLLWRWQGKELHADIPI 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   + + E + L F ++P+ + NKI+ E + + ++    ++L++LA+YMQIL+  
Sbjct: 121 LMSNHNDLQSVAEQFGLDFCHIPINKNNKIQQEARQLEVLRNYRIDLVVLAKYMQILTPE 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   ++INIHHSFLP+F GA PY +AYE GVKIIGATAHY   +LD GPIIEQDVVR
Sbjct: 181 FISQFP-KVINIHHSFLPAFAGAKPYHRAYERGVKIIGATAHYVTADLDEGPIIEQDVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  T+ D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 240 VSHRDTVADLIRKGKDLERVVLARAVRLHLQNRVLVYGNRTVVF 283


>gi|295401857|ref|ZP_06811821.1| formyltetrahydrofolate deformylase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111001|ref|YP_003989317.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y4.1MC1]
 gi|294976111|gb|EFG51725.1| formyltetrahydrofolate deformylase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216102|gb|ADP74706.1| formyltetrahydrofolate deformylase [Geobacillus sp. Y4.1MC1]
          Length = 300

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 177/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCMK 58
              L I+CP    I + +  +L  QG NI++ SQ+  D +    F+RI F         +
Sbjct: 19  RARLLISCPDKPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRIEFDCPNIAARKQ 78

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F+PI + F + + +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+S
Sbjct: 79  EIESAFRPIAESFHMNWRLRLHNDVKRIAIFVSKAEHCLLELLWQWQAGELIADIALVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K  VE+  +P++Y+P+T++ K E+EQK I ++++ NV+ ++LARYMQILS     
Sbjct: 139 NHEYLKSTVESVGIPYFYIPVTKETKAEAEQKQIQLLKQYNVDTIVLARYMQILSPSFVA 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV H
Sbjct: 199 EFPGRIINIHHSFLPAFVGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVDH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   +G+ IE  VL +A+  H++ RV I++ KTIVF
Sbjct: 259 RHHPDDLKRMGRIIEKTVLARALKWHLEDRVIIHENKTIVF 299


>gi|170720193|ref|YP_001747881.1| formyltetrahydrofolate deformylase [Pseudomonas putida W619]
 gi|169758196|gb|ACA71512.1| formyltetrahydrofolate deformylase [Pseudomonas putida W619]
          Length = 283

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 109/283 (38%), Positives = 173/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +Y L I CP    I + + ++L+     I + S  +D  +   FMR           +
Sbjct: 1   MRTYRLVIACPDRVGIVAKVSNFLALYNGWINEASHHSDEQSGWFFMRHEIRAESLPFGI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L   I  V+
Sbjct: 61  EAFREAFSPIAEEFSMAWRITDSAQKKRVVLMASRESHCLADLLHRWHTDELDCEIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +PF+++P+  ++K  +  ++  +++++  ++++LARYMQIL   LC
Sbjct: 121 SNHNDLRSMVEWHGIPFFHVPVDPKDKAPAFAEVSRLVQEHAADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 QDYAEKVINIHHSFLPSFVGAKPYHQAALRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA +IED +  G+++E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 HADSIEDMVRFGRDVEKMVLARGLRYHLEDRVLVHGNKTVVFD 283


>gi|75910432|ref|YP_324728.1| formyltetrahydrofolate deformylase [Anabaena variabilis ATCC 29413]
 gi|75704157|gb|ABA23833.1| formyltetrahydrofolate deformylase [Anabaena variabilis ATCC 29413]
          Length = 284

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 170/280 (60%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP    + + I +++   G NI+   Q  D        RI +    FN   ++
Sbjct: 5   TATLLISCPDQRGLVAKIANFIYANGGNIIHADQHTDFAAGLFLTRIEWQLEGFNLPREI 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I Q    ++ +  +    +  I VS+ DHCL DL++R     +A++I  ++SN
Sbjct: 65  IGAAFNAIAQPLGAKWELHFSDTIPRIAIWVSRQDHCLYDLIWRQRAKEIAVDIPLIISN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + E + + FY++P+ + NK E E + + +++K  ++L++LA+YMQI+S     K
Sbjct: 125 HPHLKVVAEQFGIDFYHIPINKDNKTEQEDQQLELLQKYKIDLVVLAKYMQIVSADFITK 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +IINIHHSFLP+F GANPY +A+E GVK+IGATAHYA  ELDAGPIIEQDVVRV+H 
Sbjct: 185 FP-QIINIHHSFLPAFVGANPYHRAFERGVKVIGATAHYATPELDAGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +ED I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 244 DEVEDLIRKGKDLERVVLARAVRLHLQNRVLVYGNRTVVF 283


>gi|291302650|ref|YP_003513928.1| formyltetrahydrofolate deformylase [Stackebrandtia nassauensis DSM
           44728]
 gi|290571870|gb|ADD44835.1| formyltetrahydrofolate deformylase [Stackebrandtia nassauensis DSM
           44728]
          Length = 281

 Score =  299 bits (765), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 181/280 (64%), Gaps = 1/280 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           MS  ++LT++CP    I   +  +L+ +  NI D  QF+D  + + FMR+ F  +T +  
Sbjct: 1   MSREFVLTLSCPDKVGIVYAVAGFLADRDGNISDSQQFSDPGSGRFFMRVQFHAHTTVDQ 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             ADF P    +++ + + +     + LIL S+  HCLNDLLYR+  G L   +  V SN
Sbjct: 61  LRADFGPTAAPYNMDWQLHDLAVKPRVLILASKQGHCLNDLLYRFRSGALRGELTAVASN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H    +L E+ ++PF++LP+T   +   EQ+L+++I  + +++++LARYMQIL+D  C K
Sbjct: 121 HLDWAELTESSKVPFHHLPLTPDTRANQEQRLLDLIAADRIDVVVLARYMQILTDDFCAK 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+IINIHHSFLPSFKGA PY QAYE GVK+IGATAHY   ELD GPIIEQ+  RV HA
Sbjct: 181 LPGQIINIHHSFLPSFKGAQPYHQAYERGVKLIGATAHYVTAELDEGPIIEQETARVDHA 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 IA G+++E+ VL +A++ H+  RV +N  +T+VF
Sbjct: 241 MAPSRLIATGRDLESTVLARALSWHLDHRVLLNGHRTVVF 280


>gi|84686506|ref|ZP_01014399.1| formyltetrahydrofolate deformylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665419|gb|EAQ11896.1| formyltetrahydrofolate deformylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 294

 Score =  299 bits (765), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 152/288 (52%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M++++LT+ C S   I + I  YL  +GCNI D +QF+D +T + F RI+    T   ++
Sbjct: 1   MTAFVLTVRCASRRGIVAAISGYLFEKGCNITDSAQFDDAETGRFFARITCAPETGTELE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++F +++ + +T E  K +I+VS   HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  DLKEGFAPIAEEFGMEWGMHDTSERMKVIIMVSNFGHCLNDLLYRWRIGALPVDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T++KLV N+ LPF+++ +T++NK E+E +L++++ ++  +L++LARYMQILSD LC 
Sbjct: 121 NHMTYQKLVVNHDLPFHHIKVTKENKPEAEARLMDVVTESGADLVVLARYMQILSDRLCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA++ GVK+IGATAHY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFQRGVKLIGATAHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +AV+AHI +R F+N  KT+VFPA P++Y
Sbjct: 241 AQSPGDYVSLGRDVESQVLARAVHAHINRRSFLNDDKTVVFPASPDSY 288


>gi|209525208|ref|ZP_03273751.1| formyltetrahydrofolate deformylase [Arthrospira maxima CS-328]
 gi|209494393|gb|EDZ94705.1| formyltetrahydrofolate deformylase [Arthrospira maxima CS-328]
          Length = 284

 Score =  298 bits (764), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 107/284 (37%), Positives = 162/284 (57%), Gaps = 6/284 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           M   +  L + CP    + + I +++ + G NI+   Q  D        RI +    FN 
Sbjct: 1   MKSPTATLLVFCPDRRGLVAKIANFIYSNGGNIIHADQHTDASAQLFLTRIEWELKDFNL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
              +    F  I +     + +  +    +  I V++ DHCL DLL+RW    +   I  
Sbjct: 61  PRDVIAPAFSAIAKPLEANWQLHFSDTIPRIAIWVTKQDHCLLDLLWRWQAKEMPAEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   K + +   + F+++P+T  NK E E + + ++ ++ ++L++LA+YMQILS  
Sbjct: 121 IISNHPDLKPIADQLAIAFHHIPITPDNKNEQETQQLELLRQHKIDLVVLAKYMQILSPQ 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
                   IINIHHSFLP+F GANPY++AY+ GVKIIGATAHY   +LD GPIIEQDVVR
Sbjct: 181 FVSSFP-SIINIHHSFLPAFPGANPYQRAYDRGVKIIGATAHYVTADLDEGPIIEQDVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  T+ D +  GK++E  VL++AV  H+Q RV     +T+VF
Sbjct: 240 VSHRDTVADLVRKGKDLERLVLSRAVRLHLQHRVLAYGNRTVVF 283


>gi|239827062|ref|YP_002949686.1| formyltetrahydrofolate deformylase [Geobacillus sp. WCH70]
 gi|239807355|gb|ACS24420.1| formyltetrahydrofolate deformylase [Geobacillus sp. WCH70]
          Length = 300

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 119/282 (42%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNT---CM 57
           +   L I+CP    I + +  +L  QG NI++ SQ+  D +    F+RI F         
Sbjct: 18  NRARLLISCPDKPGIVASVTSFLYEQGANIVESSQYSTDPEGGTFFLRIEFDCPNIALRK 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   + FQPI + F + + +R   +  +  I VS+ +HCL +LL++W  G L  +I  V+
Sbjct: 78  QEIESAFQPIAESFHMDWRLRLHNDVKRIAIFVSKAEHCLLELLWQWQAGELIADIALVI 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +  VE+  +P++++P+T++ K E+EQK I +++K  V+ ++LARYMQILS    
Sbjct: 138 SNHEHLRSTVESVGIPYFHIPVTKETKAEAEQKQIELLKKYEVDTIVLARYMQILSPAFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA PY++AYE GVK+IGAT+HY   +LD GPIIEQDV RV 
Sbjct: 198 AEFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGATSHYVTDDLDEGPIIEQDVARVD 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D   +G+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 258 HRHHPDDLKRMGRIIEKTVLARALKWHLEDRVIIHGNKTIVF 299


>gi|319785684|ref|YP_004145159.1| formyltetrahydrofolate deformylase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464196|gb|ADV25928.1| formyltetrahydrofolate deformylase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 283

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 129/282 (45%), Positives = 180/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--M 57
           M   YIL ++CP    I   +   L  QGCNILD  QF D +T + F+R+ F       +
Sbjct: 1   MRHDYILALSCPDRTGIVYRVSGLLFGQGCNILDAQQFGDEETGRFFLRVHFELPEPQAL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  +  +F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V 
Sbjct: 61  EGVRERFANLAGEFDMDWQLHDARRRARLLVLVSRQGHCLNDLLFRAHSGQLRVDIAAVA 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y +PF++LP+   N+ E EQ +I+++E+  V+L++LARYMQILS  LC
Sbjct: 121 SNHQDFAALSASYGVPFHHLPVDASNRGEQEQAIIDLVEREQVDLVVLARYMQILSPRLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 EALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTPDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G +IE++VL +AV  H++ R+ +N  KT+VF
Sbjct: 241 HAMTPRDLVRVGSDIESQVLARAVRRHVEHRILLNGHKTVVF 282


>gi|67516427|ref|XP_658099.1| hypothetical protein AN0495.2 [Aspergillus nidulans FGSC A4]
 gi|40747438|gb|EAA66594.1| hypothetical protein AN0495.2 [Aspergillus nidulans FGSC A4]
 gi|259489252|tpe|CBF89369.1| TPA: formyltetrahydrofolate deformylase, putative (AFU_orthologue;
           AFUA_6G11620) [Aspergillus nidulans FGSC A4]
          Length = 289

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 123/288 (42%), Positives = 180/288 (62%), Gaps = 10/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------- 54
           S+ILT++CP    I S +  +L     NI+D SQF D  + + FMR+ F  +        
Sbjct: 2   SFILTLSCPDRPGIVSAVTGFLVQHNLNIIDSSQFGDPTSHRFFMRMHFGPDTTGASDGA 61

Query: 55  --TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
               ++     F PI    S+ + +       + LI+VS+  HCLNDLL+R + G LA+ 
Sbjct: 62  AAPSLEALREAFTPIATAHSMSFQLLPAAHKPRVLIMVSKIGHCLNDLLFRQSTGQLAIE 121

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +  +VSNH   + L   Y++PF +LP+T   K + E +++ +I++ ++EL++LARYMQ+L
Sbjct: 122 VPLIVSNHPDFETLAATYKVPFMHLPVTADTKQQQETRILELIKEYDIELVVLARYMQVL 181

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC  M+G+IINIHHSFLPSFKGA PY QAY+ GVK++GATAH+   +LD GPIIEQ+
Sbjct: 182 SPTLCDAMSGKIINIHHSFLPSFKGAKPYHQAYDRGVKLVGATAHFVTSDLDEGPIIEQN 241

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 242 VVRVNHALSPKELTHAGSNVESNVLAAAVKYFAERRVLLNGHKTVVFN 289


>gi|167585445|ref|ZP_02377833.1| formyltetrahydrofolate deformylase [Burkholderia ubonensis Bu]
          Length = 294

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 182/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC------ 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F  N        
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFDQNGSGADVAA 65

Query: 57  -MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  TLDALRAQFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKDFYQLAASYDIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  +C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSQDMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|313202259|ref|YP_004040917.1| formyltetrahydrofolate deformylase [Methylovorus sp. MP688]
 gi|312441575|gb|ADQ85681.1| formyltetrahydrofolate deformylase [Methylovorus sp. MP688]
          Length = 311

 Score =  298 bits (764), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---K 58
           ++  L +TCP  + I + I D+L     NIL   Q  D +     MR+ +  +       
Sbjct: 30  NTATLLVTCPDQKGIVAGIADFLYRHNANILHADQHQDAENGLFLMRVEWDLSDSAINAD 89

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI ++FS+ + ++  ++ T+  I+VSQ DHCL DLL+R   G LA  I  +VS
Sbjct: 90  NFSEHFTPIAERFSMTWQLKLGQKRTRMAIMVSQYDHCLVDLLHRHQSGELACEIPLIVS 149

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L E + +PF+Y+ +   NK E+E K   + ++  V+L++LARYMQILS     
Sbjct: 150 NHRHTERLAEYHGIPFHYVEVNRDNKAEAEAKQFALFDQYGVDLIVLARYMQILSPAFVQ 209

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H
Sbjct: 210 RYPQRIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDIARISH 269

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED I  G+++E  VL++AV  HI+ R+ +   KT++F 
Sbjct: 270 RDQVEDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIFD 311


>gi|327479724|gb|AEA83034.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri DSM 4166]
          Length = 283

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 177/283 (62%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M ++ L I CP    I + + ++L+T    I + +  +D  +   FMR     +     +
Sbjct: 1   MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEANHHSDHQSGWFFMRHEIRADSLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L  +I  V+
Sbjct: 61  DGFRQAFAPIAREFSMEWRITDSERRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P++++P+   NK E+  ++  ++ +   ++++LARYMQIL   LC
Sbjct: 121 SNHDDLRSMVEWHGIPYFHVPVDPANKQEAFAEVTRLVREQRADVIVLARYMQILPAELC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   R+INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 DEFAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IED + +GK++E  VL++ +  H++ RV ++  KT+VF 
Sbjct: 241 HRDSIEDMVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTLVFN 283


>gi|170077627|ref|YP_001734265.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7002]
 gi|169885296|gb|ACA99009.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7002]
          Length = 282

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 169/282 (59%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M +  L ++CP  + + + I +++   G NI+   Q  DL       RI +    FN   
Sbjct: 1   MPTATLLVSCPDQQGLVAKIANFIYANGGNIIHADQHTDLSAGLFLTRIEWELDGFNLPR 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           ++    F  I +     YS+  + +  +  I V++ DHCL DLL+R     L   I  ++
Sbjct: 61  EVIEPAFGAIAKPLGATYSLHFSDQVPRLAIWVTKQDHCLLDLLWRQQAKELKAEIPLII 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + + +++ F+++P+T+  K E E K + ++++ N++L+ILA+YMQ+LS    
Sbjct: 121 SNHQELEAIAQQFKIDFHHIPITKATKAEQEAKQLALLQEYNIDLVILAKYMQVLSPDFL 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   ++INIHHSFLP+F GA PY +AY+ GVKIIGATAHY   +LD GPIIEQDVVRV+
Sbjct: 181 GKFN-QVINIHHSFLPAFAGAKPYHRAYDRGVKIIGATAHYVTQDLDEGPIIEQDVVRVS 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   ++D I  GK++E  VL++AV  H+Q RV +   +T VF
Sbjct: 240 HRDDVKDLIRKGKDLERIVLSRAVRLHLQHRVLVYGNRTAVF 281


>gi|153008789|ref|YP_001370004.1| formyltetrahydrofolate deformylase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560677|gb|ABS14175.1| formyltetrahydrofolate deformylase [Ochrobactrum anthropi ATCC
           49188]
          Length = 294

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 155/288 (53%), Positives = 219/288 (76%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MHNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVALD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F P+   F +++   +  + TKTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  VLREGFAPVAAPFEMEFEFHDNAQRTKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+EQ+L++I++    EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAEQRLLDIVDDTGTELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQSAADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|17229115|ref|NP_485663.1| formyltetrahydrofolate deformylase [Nostoc sp. PCC 7120]
 gi|17135443|dbj|BAB77989.1| formyltetrahydrofolate deformylase [Nostoc sp. PCC 7120]
          Length = 284

 Score =  298 bits (763), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 168/280 (60%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP    + + I +++   G NI+   Q  D        RI +    FN   ++
Sbjct: 5   TATLLISCPDQRGLVAKIANFIYANGGNIIHADQHTDFAAGLFLTRIEWQLEGFNLPREI 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  I Q    ++ +  +    +  I VS+ DHCL DL++R     +A+ I  ++SN
Sbjct: 65  IGAAFNAIAQPLGAKWELHFSDTIPRIAIWVSRQDHCLYDLIWRQRAKEIAVEIPLIISN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + + + + F ++P+ + NK E E + + ++++  ++L++LA+YMQI+S     K
Sbjct: 125 HPHLKVVADQFGIDFRHIPINKDNKAEQEAQQLELLQQYEIDLVVLAKYMQIVSADFITK 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +IINIHHSFLP+F GANPY +A+E GVK+IGATAHYA  ELDAGPIIEQDVVRV+H 
Sbjct: 185 FP-QIINIHHSFLPAFVGANPYHRAFERGVKVIGATAHYATPELDAGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +ED I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 244 DEVEDLIRKGKDLERVVLARAVRLHLQNRVLVYGNRTVVF 283


>gi|138895289|ref|YP_001125742.1| formyltetrahydrofolate deformylase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266802|gb|ABO66997.1| Formyltetrahydrofolate deformylase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 300

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 169/282 (59%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
               L I+CP    I + +  +L  QG NI++ SQ+  D +    F+R+ F         
Sbjct: 18  QRARLLISCPDRPGIVAAVTSFLYEQGANIVESSQYSTDPEGGTFFLRLEFDCPNIAGRK 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F PI ++FS+ + +R   E  +  I VS+ +HCL +LL++W  G L  +I  V+
Sbjct: 78  EEIETAFAPIAEEFSMTWQLRLHNEIRRIAIFVSKAEHCLLELLWQWQAGELIADIALVI 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     +VE   +P+ ++P+T++ K ++E + I ++    ++ ++LARYMQILS    
Sbjct: 138 SNHPDLCDVVEPLGIPYVHIPVTKETKADAEAEQIRLLHDYRIDTIVLARYMQILSPAFV 197

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA PY++AYE GVK+IGA +HY   +LD GPIIEQDV RV 
Sbjct: 198 AEFPGRIINIHHSFLPAFIGARPYERAYERGVKLIGAPSHYVTDDLDKGPIIEQDVARVD 257

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    ++   IG+ IE  VL +A+  H++ RV I+  KTIVF
Sbjct: 258 HRHHPDNLKRIGRLIEKTVLARALRWHLEDRVIIHGNKTIVF 299


>gi|152967926|ref|YP_001363710.1| formyltetrahydrofolate deformylase [Kineococcus radiotolerans
           SRS30216]
 gi|151362443|gb|ABS05446.1| formyltetrahydrofolate deformylase [Kineococcus radiotolerans
           SRS30216]
          Length = 285

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 121/284 (42%), Positives = 178/284 (62%), Gaps = 5/284 (1%)

Query: 1   MSSY--ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK 58
           MS+   +LT++CP    I   +   L     NI +  QF D D+    MR++F      +
Sbjct: 1   MSTRPRVLTLSCPDRPGIVHAVTGALVALDANITESQQFGDPDSGLFSMRVAFDAAASEE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+ + +  +F L +++    E  +TL++ S+  HCLNDLL+R   G L + I  VVS
Sbjct: 61  ALRANLEVVAARFGLTWTLSAADEPMRTLVMCSKQGHCLNDLLFRHRSGGLPIEIAAVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMT---EQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           NHT    L + Y +PF ++P+T     +K   E +L+ ++++ +VEL++LARYMQILSD 
Sbjct: 121 NHTDLAPLAQFYGIPFVHVPVTTGDAASKAAGEARLLELVDELDVELVVLARYMQILSDD 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  ++GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ++ R
Sbjct: 181 LCRSLSGRAINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTADLDEGPIIEQEIER 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  T  + + +G+++EA+ L +AV  H +QRV ++  +T+VF
Sbjct: 241 VDHRHTPPELVRLGQDVEARTLARAVRWHAEQRVLLDGNRTVVF 284


>gi|194337220|ref|YP_002019014.1| formyltetrahydrofolate deformylase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309697|gb|ACF44397.1| formyltetrahydrofolate deformylase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 288

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 114/287 (39%), Positives = 181/287 (63%), Gaps = 7/287 (2%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---F 53
           M       IL ++C     + S I  ++  +G NILD+ +  D      F+R+S+    F
Sbjct: 2   MKKSDTVAILLLSCADRPGLVSRISHFIYERGGNILDLDEHVDPVEKTFFIRVSWSTENF 61

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
           +      +  F P+ ++F+  + IR T   T+  I VS+ DHCL ++L+R +IG  A++I
Sbjct: 62  SIPPSELVEAFMPLAKEFNAIWKIRFTGRKTRIAIFVSRYDHCLQEILWRNSIGEFAIDI 121

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             ++SNH     L E++ +P++  P++  +K E E +   ++EK++++ ++LARYMQILS
Sbjct: 122 ALIISNHPDLAPLAEHHGIPYHCFPVSSASKQEIELQERELLEKHSIDTIVLARYMQILS 181

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
                +  G+IINIHHSFLP+F G++PY+QAYE GVKIIGAT+HY   ELD GPIIEQD+
Sbjct: 182 SQFVDRYPGQIINIHHSFLPAFVGSSPYRQAYERGVKIIGATSHYVTEELDQGPIIEQDI 241

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           VRV+H  T++D +  G+++E  VL +A+  H + R+ +N +KT+VF 
Sbjct: 242 VRVSHKDTLDDLVRKGRDLERLVLAQALRLHSEHRILVNGKKTVVFD 288


>gi|284052183|ref|ZP_06382393.1| formyltetrahydrofolate deformylase [Arthrospira platensis str.
           Paraca]
 gi|291568947|dbj|BAI91219.1| formyltetrahydrofolate deformylase [Arthrospira platensis NIES-39]
          Length = 284

 Score =  298 bits (762), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 106/284 (37%), Positives = 161/284 (56%), Gaps = 6/284 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           M   +  L + CP    + + I +++ + G NI+   Q  D        RI +    FN 
Sbjct: 1   MKSPTATLLVFCPDRRGLVAKIANFIYSNGGNIIHADQHTDASAQLFLTRIEWELKDFNL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
              +    F  I +     + +  +    +  I V++ DHCL DLL+RW    +   I  
Sbjct: 61  PRDVIGPAFSAIAKPLEANWQLHFSDTIPRIAIWVTKQDHCLLDLLWRWQAQEIPAEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   K + +   + F+++PMT   K   E + + ++ ++ ++L++LA+YMQILS  
Sbjct: 121 IISNHPDLKPIADQLAIAFHHIPMTPDTKNAQEAQQLELLRQHKIDLVVLAKYMQILSPQ 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
                   IINIHHSFLP+F GANPY++AY+ GVKIIGATAHY   +LD GPIIEQDVVR
Sbjct: 181 FVSSFP-SIINIHHSFLPAFPGANPYQRAYDRGVKIIGATAHYVTADLDEGPIIEQDVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H  T+ D +  GK++E  VL++AV  H+Q RV +   +T+VF
Sbjct: 240 VSHRDTVADLVRKGKDLERLVLSRAVRFHLQHRVLVYGNRTVVF 283


>gi|254251400|ref|ZP_04944718.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
 gi|124894009|gb|EAY67889.1| Formyltetrahydrofolate hydrolase [Burkholderia dolosa AUO158]
          Length = 325

 Score =  298 bits (762), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 119/293 (40%), Positives = 185/293 (63%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--- 54
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +   
Sbjct: 32  MSTDHSFILKLSCPDRHGIVHAVSGFLFERNHNILDSAQFGDSRTGEFFMRVHFEQDGNG 91

Query: 55  ----TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
               + +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 92  ADAASALDTLRREFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 151

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LA
Sbjct: 152 IEIPAIVSNHKDFYQLAASYNIPFHHFPLAGGSSDAAKAAQEARVLEVIDEHQADLVVLA 211

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS +LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 212 RYMQILSPNLCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 271

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 272 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 324


>gi|260429850|ref|ZP_05783826.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
 gi|260419333|gb|EEX12587.1| formyltetrahydrofolate deformylase [Citreicella sp. SE45]
          Length = 294

 Score =  298 bits (762), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 148/288 (51%), Positives = 206/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M   ILT +CP    I + I  +L+ QGCNI D SQF+D+   + FMR+SF   +     
Sbjct: 1   MPQTILTASCPVRPGIVAAISIFLAEQGCNIHDSSQFSDIVNDRFFMRLSFESESGVTRA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F      F + Y+  +  E  K +I+VS+  HCLNDLLYRW IG L ++IV V+S
Sbjct: 61  ALNEGFAETAASFGMDYAFHDPSEKMKVVIMVSRFGHCLNDLLYRWRIGALPIDIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ LPF+ + +T+QNK E+E + + I+ ++  +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKVVVNHDLPFHCIKVTKQNKPEAEAEQMRIVRESGADLIVLARYMQILSDEMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI +RVF+N+ KT+VFPA P  Y
Sbjct: 241 AQSPSDYVSLGRDVESQVLARAIHAHIHRRVFMNRDKTVVFPASPGEY 288


>gi|294629923|ref|ZP_06708483.1| formyltetrahydrofolate deformylase [Streptomyces sp. e14]
 gi|292833256|gb|EFF91605.1| formyltetrahydrofolate deformylase [Streptomyces sp. e14]
          Length = 294

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 129/279 (46%), Positives = 185/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            Y+LT++CP  + I   +  YL   GCNI+D  QF D D+   FMR+ F   + +     
Sbjct: 15  QYVLTLSCPDKQGIVHAVSSYLFMTGCNIVDSQQFGDQDSGLFFMRVHFSAESPVTVDKL 74

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F  I   F +++ I    E  + +++VS+  HCLNDLL+R  IG L + I  VVSNH
Sbjct: 75  RASFAAIGDSFGMEWQIHRADEKMRIVLMVSKFGHCLNDLLFRARIGALPVEIAAVVSNH 134

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T   +LV +Y +PF+++P+T   K E+E +L+ ++ +  VEL++LARYMQ+LSD LC ++
Sbjct: 135 TDFAELVASYDIPFHHIPVTRDTKAEAEARLLELVREEEVELVVLARYMQVLSDDLCKQL 194

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H  
Sbjct: 195 SGRIINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVERVGHDV 254

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +  +A+G+++E + L +AV  H + R+ +N R+T+VF
Sbjct: 255 TPDQLVALGRDVECQALARAVKWHAEHRILLNGRRTVVF 293


>gi|92114195|ref|YP_574123.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
 gi|91797285|gb|ABE59424.1| formyltetrahydrofolate deformylase [Chromohalobacter salexigens DSM
           3043]
          Length = 288

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 122/283 (43%), Positives = 181/283 (63%), Gaps = 4/283 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---C 56
           MS SY L ++CP    I S +  Y++  G  I + +Q +DL T + FMR      +    
Sbjct: 5   MSHSYRLIVSCPDRVGIVSRVSSYIAGHGGWITEANQHSDLVTGRFFMRYEIKAESLALD 64

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++    DF  I  +FS+++++ +T    + +++ S+  HCL DLLYRWN G L  +I  V
Sbjct: 65  IEALRDDFAAIADEFSMEWALSDTARRKRVVLMASRASHCLVDLLYRWNAGELDCDIPCV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH + + LVE + +PFY++P+   +K  +  ++  ++E+   + ++LARYMQIL  +L
Sbjct: 125 ISNHESLRPLVEWHGIPFYHVPVEPHDKAAAFARVEALVEEARADAVVLARYMQILPPNL 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +  GR+INIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQD+ RV
Sbjct: 185 CQRYAGRVINIHHSFLPSFAGAKPYHQAYERGVKLIGATCHYVTEELDAGPIIEQDIQRV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  T +D + +G+++E  VL + +  H+Q RV I+  KT+VF
Sbjct: 245 THCHTADDLVRLGRDVEKAVLARGLRWHLQDRVLIHGNKTVVF 287


>gi|145230533|ref|XP_001389575.1| formyltetrahydrofolate deformylase [Aspergillus niger CBS 513.88]
 gi|134055693|emb|CAK44067.1| unnamed protein product [Aspergillus niger]
          Length = 283

 Score =  298 bits (762), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 123/282 (43%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCMK 58
           SYILT++CP    I   +  YL  Q  NI+D SQ+ D  + + FMR+ F         + 
Sbjct: 2   SYILTLSCPDRPGIVHAVTAYLVQQNLNIIDSSQYGDPTSQRFFMRVHFKDESSPAKSLD 61

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP  +  ++ + +       + LI+VS+  HCLNDLL+R + G L + I  +VS
Sbjct: 62  DLRTAFQPTAESLTMTFQLVPASSKPRVLIMVSKIGHCLNDLLFRASTGQLPIEIPLIVS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L   Y +PF +LP+T   K + E +++ +I ++N++L++LARYMQ+LS  LC 
Sbjct: 122 NHPDFATLAATYNIPFLHLPVTADTKPQQEGRILELIREHNIDLVVLARYMQVLSPMLCE 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+G+IINIHHSFLPSFKGA PY QA++ GVKI+GATAH+   +LD GPIIEQ+VVRV H
Sbjct: 182 AMSGKIINIHHSFLPSFKGAKPYHQAFDRGVKIVGATAHFVTSDLDEGPIIEQNVVRVNH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           A + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 242 AMSPKELTHAGSNVESNVLATAVKYFAERRVLLNGHKTVVFN 283


>gi|171056865|ref|YP_001789214.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170774310|gb|ACB32449.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 287

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 175/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             Y L+++CP    I + + ++L+     I + S   + ++   FMR   + ++    + 
Sbjct: 6   RRYTLSLSCPDRVGIVAAVSNFLAQNNGWITEASHHAETESQTFFMRQEILADSLQLSID 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F  +F  +   F + + I ++    + +ILVS+ +HCL DLL RW  G L ++I  V+S
Sbjct: 66  EFRTEFAKVAAPFEMNWRISDSARKKRVVILVSKQEHCLYDLLGRWQSGELDVDIPCVIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T + LVE + +PF+++P+T   K+E+  ++  +  +N  ++M+LARYMQIL+  LC 
Sbjct: 126 NHETFRGLVEWHGIPFHHVPVTPATKVEAYAEVERLYRENEGDVMVLARYMQILAPDLCE 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K  G+IINIHHSFLPSF GA PY QA++ GVK+IGAT H+   ELD GPIIEQDV+R+ H
Sbjct: 186 KFPGQIINIHHSFLPSFVGAKPYHQAFKRGVKLIGATCHFVTSELDEGPIIEQDVIRIDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E+ +  GK++E  VL + +  H++ RV I+  KT+VF
Sbjct: 246 SDVPEELVRSGKDVEKAVLARGLRYHLEDRVLIHGNKTVVF 286


>gi|15966689|ref|NP_387042.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
 gi|307300275|ref|ZP_07580055.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|15075961|emb|CAC47515.1| Putative formyltetrahydrofolate deformylase [Sinorhizobium meliloti
           1021]
 gi|306904441|gb|EFN35025.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 294

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M SY+LT++C S   I + I  YL+ +GC I D SQF+D  T   FMR++F+      ++
Sbjct: 1   MKSYVLTVSCKSTRGIVAAITGYLAEKGCYISDSSQFDDFQTGLFFMRLTFISQDGAKLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P++++F +   IR+++E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVIKRFEMMMEIRDSEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|331018016|gb|EGH98072.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 283

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 175/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  ++E+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSVENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|103487321|ref|YP_616882.1| formyltetrahydrofolate deformylase [Sphingopyxis alaskensis RB2256]
 gi|98977398|gb|ABF53549.1| formyltetrahydrofolate deformylase [Sphingopyxis alaskensis RB2256]
          Length = 290

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 183/281 (65%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-----FNTCMK 58
           Y+LT +C     I + +   L+ +   ILD  Q+ DLD+ + FMR+ F      F   + 
Sbjct: 9   YVLTFSCADAVGIVAAVTGLLADRDGFILDSQQYADLDSGRFFMRVEFRGEGSRFPGNLA 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI ++F +   I +     + +I VSQ  HCLNDLL+RW+ G LA++IVGVVS
Sbjct: 69  GVQDAFAPIARRFQMDARISDRAAKPRFVIAVSQGSHCLNDLLHRWSTGNLAIDIVGVVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L E + +PF+YLP+++ N+ E E  +++++ +   E ++LARYMQ+LS+ L  
Sbjct: 129 NHEHLRRLTEWHGVPFHYLPVSDANRAEQESAILDVMARGGAEYLVLARYMQVLSEDLSA 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 RLAGRCINIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTSDLDEGPIIEQAVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ++D I IG+++EA+VL +AV    +QRV I+ RKT+VF
Sbjct: 249 RDGVDDLIRIGRDVEAQVLARAVRWVAEQRVLIDGRKTVVF 289


>gi|222081891|ref|YP_002541256.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221726570|gb|ACM29659.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 156/288 (54%), Positives = 223/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M  ++LT++C S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+    +  +
Sbjct: 1   MEKFVLTVSCQSTRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAVKFEMEAEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E ++++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMDVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|289664439|ref|ZP_06486020.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668087|ref|ZP_06489162.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 289

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 7   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTEI 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 67  AALEQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y +PF++LP++   +   E +L+ +++   ++L++LARYMQILS  LC
Sbjct: 127 SNHTDFAALAASYGIPFHHLPVSADTRAAQEAQLLTLVDDLQIDLVVLARYMQILSPELC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 187 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D I +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 247 HAMTPRDLIRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|330888489|gb|EGH21150.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 283

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 175/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHGIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|186475105|ref|YP_001856575.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
 gi|184191564|gb|ACC69529.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
          Length = 287

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 118/286 (41%), Positives = 179/286 (62%), Gaps = 7/286 (2%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FN 54
           MS+   +IL ++C     I   +  +L  +G NILD +QF D  T + FMR+ F     +
Sbjct: 1   MSTEHSFILKLSCADRPGIVHAVSGFLFERGSNILDSAQFGDSHTGEFFMRVHFQQVGGD 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             +      F  + +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L + I 
Sbjct: 61  PGLDALREAFATLAEQFGMRWELHDANVKPRVVIMVSKIGHCLNDLLFRYRTGQLNIEIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMILARYMQILS 173
            ++SNH    +L  +Y +PF++ P+T    K   E +++ +I++   +L++LARYMQILS
Sbjct: 121 AIISNHKEFYQLAASYDIPFHHFPLTSSDTKAHQEARVLEVIDECKADLVVLARYMQILS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V
Sbjct: 181 PQLCARLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 ERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGSKTVVF 286


>gi|222084490|ref|YP_002543019.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221721938|gb|ACM25094.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 157/288 (54%), Positives = 224/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M+ Y+LT++C S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+    +  +
Sbjct: 1   MTHYVLTVSCHSTRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAGKFEMEVEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E ++++++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMDVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|269977870|ref|ZP_06184826.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris 28-1]
 gi|269933950|gb|EEZ90528.1| formyltetrahydrofolate deformylase [Mobiluncus mulieris 28-1]
          Length = 291

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 124/278 (44%), Positives = 174/278 (62%), Gaps = 1/278 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
              +LT++CP    I   +   +S  G NIL  +QF D DT   FMR+S       +   
Sbjct: 14  QRLVLTLSCPDKPGIVHAVSGLVSEAGGNILQSAQFGDPDTGLFFMRVSMDV-PSRETVE 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              Q + Q + + +++       +T+I+VS+  HCL+DLLYR     L +++  VV NH 
Sbjct: 73  TRVQELAQTYDMNWNLDEIGRPLRTVIMVSKEGHCLSDLLYRVRDNALPIDVRAVVGNHP 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               +   YQ+PF  +P+T+ NK ++EQ+L++++E   +EL++LARYMQILSD LC KM 
Sbjct: 133 DLSPIATFYQVPFILVPVTKDNKPQAEQRLLDLVEAEKIELVVLARYMQILSDKLCQKMG 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H  T
Sbjct: 193 GRIINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVARVDHTLT 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                  G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 253 TAAMQKQGQDVERRVLAQAVKWHAEHRVLLNGTRTVIF 290


>gi|288960694|ref|YP_003451034.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
 gi|288913002|dbj|BAI74490.1| formyltetrahydrofolate deformylase [Azospirillum sp. B510]
          Length = 287

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 120/282 (42%), Positives = 180/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           +  +LT++CP+   I + +  YL  QGCNI +  Q++D++T + FMR+ F          
Sbjct: 4   TQAVLTLSCPNQPGIVARVSTYLFEQGCNIGEAHQYDDVETGRFFMRLVFNQVNETCLFP 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   + + +++R   E  + ++LVS+ DHCL DLLYR  IG + ++I  +VS
Sbjct: 64  AIREGFAAIAATYGMDWTMRPAGEHRRVMLLVSKFDHCLADLLYRRRIGEIPMDITAIVS 123

Query: 119 NHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        ++  +PF++LP+T+ +K+E E ++  ++ +   EL++LARYMQ+LSD L 
Sbjct: 124 NHPRETYADHDFGDIPFHHLPVTKDSKLEQEAQIWRLVRETGTELIVLARYMQVLSDDLS 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ G  INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLAGHCINIHHSFLPGFKGAKPYHQAHKRGVKLIGATAHYVTADLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  + ED +  G++IE +VL +A+  H+Q RV  N  KT+VF
Sbjct: 244 HHDSAEDLVRKGRDIERRVLARAIAWHLQDRVIPNGHKTVVF 285


>gi|91976062|ref|YP_568721.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB5]
 gi|91682518|gb|ABE38820.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           BisB5]
          Length = 287

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 174/281 (61%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
            Y+LT++CP    I + +  +L   G NILD  Q+ND ++   FMR+ F        +  
Sbjct: 5   QYVLTLSCPDRAGIVAAVTTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAERVAPLAE 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VSN
Sbjct: 65  LRTGFGAVAVKFAMGWHMRDRATRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVSN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY++P+ ++ + + E  +  ++ +   +L++LARYMQILSD +  
Sbjct: 125 HPRETFSGFDFGEIPFYHMPVNKETRRQQEAAITALVAQTKTDLVVLARYMQILSDEMAG 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 185 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 245 RDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 285


>gi|46579951|ref|YP_010759.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602635|ref|YP_967035.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris DP4]
 gi|46449367|gb|AAS96018.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562864|gb|ABM28608.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris DP4]
 gi|311234051|gb|ADP86905.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris RCH1]
          Length = 284

 Score =  297 bits (760), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 124/281 (44%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           S+YILTI CP    I + +  +L+ Q CNI+D +QF D DT + F+RI F          
Sbjct: 3   SAYILTIACPDRIGIVATVSTFLAVQQCNIIDSAQFGDPDTRRFFLRIHFEMPDDGPGRP 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F +Q+ + +    ++ +I+VS+  HCLNDLL+R + GTL   I  +VS
Sbjct: 63  ELERLFAGVAATFDMQWELHDAGRKSRLMIMVSRFGHCLNDLLFRCSTGTLQAEITAIVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E + +PF++LP+T+  K E E  +  +IE    ++++LARYMQ+LS   C 
Sbjct: 123 NHADFERIAEMHGIPFHHLPVTKDTKREQEAAVAQVIEDTRSDVVVLARYMQVLSAEFCS 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLPSFKGA+PY QAY  GVK+IGATAHY    LD GPIIEQ+V RV H
Sbjct: 183 RYPGRIINIHHSFLPSFKGASPYHQAYARGVKLIGATAHYVTENLDEGPIIEQEVSRVDH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   +  + +G+++E+ VL++AV  H++ RV +N  +T+VF
Sbjct: 243 AHLPDALVNVGRDVESLVLSRAVRYHVEHRVLLNGHRTVVF 283


>gi|307321152|ref|ZP_07600556.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|306893227|gb|EFN24009.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
          Length = 294

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 150/288 (52%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M SY+LT++C S   I + I  YL+ +GC I D SQF+D  T   FMR++F+      ++
Sbjct: 1   MKSYVLTVSCKSTRGIVAAITGYLAEKGCYISDSSQFDDFQTGLFFMRLTFISQDGAKLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P++++F +   IR+++E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFEPVIKRFEMMMEIRDSEERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++N+ ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENRPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|308173286|ref|YP_003919991.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|307606150|emb|CBI42521.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens DSM 7]
 gi|328553793|gb|AEB24285.1| formyltetrahydrofolate deformylase [Bacillus amyloliquefaciens
           TA208]
 gi|328911355|gb|AEB62951.1| formyltetrahydrofolate hydrolase [Bacillus amyloliquefaciens LL3]
          Length = 300

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 167/280 (59%), Gaps = 4/280 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLFI-- 61
            L ++CP    I S +  +L   G NI++ +Q+  D +  + F+RI F      +     
Sbjct: 21  RLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGGRFFLRIEFDCKGIREKKEDL 80

Query: 62  -ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I Q F + +S+    E  +  I VS+  HCL++L++ W  G +   I  V+SNH
Sbjct: 81  KQAFALIAQTFGMTWSLSLASELKRVAIFVSKELHCLHELIWEWQSGNMMAEIAVVISNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K++VE   +PF+Y+   +  + E E++ + ++E+  +++++LARYMQIL+       
Sbjct: 141 EEAKEVVEPLNIPFHYMKANKDIRAEVERRQLELLEQYEIDVIVLARYMQILTSDFVSAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F GANPYK+AYE GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVTDDLDEGPIIEQDIERVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             ED   IG+ IE  VL +AV  H++ RV +++ KTIVF 
Sbjct: 261 HAEDLKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN 300


>gi|66047245|ref|YP_237086.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63257952|gb|AAY39048.1| Formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330973533|gb|EGH73599.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 283

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|290955281|ref|YP_003486463.1| formyltetrahydrofolate deformylase [Streptomyces scabiei 87.22]
 gi|260644807|emb|CBG67892.1| putative formyltetrahydrofolate deformylase [Streptomyces scabiei
           87.22]
          Length = 293

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 124/281 (44%), Positives = 183/281 (65%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
             Y+LT++CP +  +   +  YL     NIL+  QF+D    + FMR+ F     N  ++
Sbjct: 12  REYVLTLSCPDSAGLVHAVSGYLVRNSGNILESQQFDDRLQGRFFMRVHFDVSDPNVDLE 71

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ Q + + +S+ +    T+TLI+VS+  HCLNDLL+R   G L + I  +VS
Sbjct: 72  GLRYRFGPVAQAYGISWSLSDASTPTRTLIMVSKFGHCLNDLLFRQRAGALNIEIPAIVS 131

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +KL E Y +PF+++P+T + K E+E +L+ ++   +++L++LARYMQILSD LC 
Sbjct: 132 NHRDFEKLAETYDVPFHHVPVTRETKPEAEARLLELVRDLDIDLVVLARYMQILSDDLCK 191

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QAY+ GVK++GATAHY   +LD G IIEQDVVRV H
Sbjct: 192 ELDGRAINIHHSFLPSFKGARPYDQAYDRGVKLVGATAHYVTSDLDEGQIIEQDVVRVDH 251

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    + + +G+++EA+VL  AV  H + RV +   +T+VF
Sbjct: 252 SLDPGELVTVGRDVEAQVLAHAVKWHSENRVMVEGNRTVVF 292


>gi|254000302|ref|YP_003052365.1| formyltetrahydrofolate deformylase [Methylovorus sp. SIP3-4]
 gi|253986981|gb|ACT51838.1| formyltetrahydrofolate deformylase [Methylovorus sp. SIP3-4]
          Length = 285

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---K 58
           ++  L +TCP  + I + I D+L     NIL   Q  D +     MR+ +  +       
Sbjct: 4   NTATLLVTCPDQKGIVAGIADFLYRHNANILHADQHQDAENGLFLMRVEWDLSDSAINAD 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI ++FS+ + ++  ++ T+  I+VSQ DHCL DLL+R   G LA  I  +VS
Sbjct: 64  NFSEHFTPIAERFSMTWQLKLGQKRTRMAIMVSQYDHCLVDLLHRHQSGELACEIPLIVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L E + +PF+Y+ +   NK E+E K   + ++  V+L++LARYMQILS     
Sbjct: 124 NHRHTERLAEYHGIPFHYVEVNRDNKAEAEAKQFALFDQYGVDLIVLARYMQILSPAFVQ 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H
Sbjct: 184 RYPQRIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDIARISH 243

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED I  G+++E  VL++AV  HI+ R+ +   KT++F 
Sbjct: 244 RDQVEDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIFD 285


>gi|289677838|ref|ZP_06498728.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae FF5]
 gi|330898432|gb|EGH29851.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330937749|gb|EGH41633.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 283

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHNIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|222082165|ref|YP_002541530.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
 gi|221726844|gb|ACM29933.1| formyltetrahydrofolate deformylase [Agrobacterium radiobacter K84]
          Length = 294

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 157/288 (54%), Positives = 222/288 (77%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M+ Y+L +TC S   I + I +YL+ QGCNI+D SQF+DLDT K FMR+SF+    +  +
Sbjct: 1   MTHYVLRVTCTSRRGIVAAIANYLADQGCNIVDSSQFDDLDTGKFFMRVSFISEQGVGQE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F+PI  +F ++  I +T++  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALVEGFKPIAGKFEMEAEIHDTQKRMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++P+T+ NK ++E +++ ++E+   EL++LARYMQILSD +C 
Sbjct: 121 NHFEYQKVVVNHDIPFHHIPVTKANKPQAEARIMEVVEQTGTELIVLARYMQILSDSMCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD  R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDTARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY++IG+++E++VL +A++AHI  R F+N  +TIVFPA P +Y
Sbjct: 241 AQSADDYVSIGRDVESQVLARAIHAHIHYRTFLNGNRTIVFPASPGSY 288


>gi|297197992|ref|ZP_06915389.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
 gi|197715005|gb|EDY59039.1| formyltetrahydrofolate deformylase [Streptomyces sviceus ATCC
           29083]
          Length = 290

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 122/281 (43%), Positives = 188/281 (66%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
             ++LT++CP    +   +  +L     NI +  QF+D    + FMR+ F  +     ++
Sbjct: 9   REFVLTLSCPDRSGLVHAVTGFLVRHSGNIQESQQFDDRLQDRFFMRVHFDVSDPGTTLE 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ + + + + +RN    T+TLI+VS+  HCLNDLL+R   G L + +  +VS
Sbjct: 69  DLRSGFAPVAEAYRITWQLRNAATPTRTLIMVSKFGHCLNDLLFRQRTGALGIEVPAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     L E+Y +PF+++P+T + K ++E +L+ ++++ +++L++LARYMQILS+ LC 
Sbjct: 129 NHRDFAPLAESYGIPFHHVPVTPETKADAEARLLELVDRLDIDLVVLARYMQILSNDLCK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDV+RV H
Sbjct: 189 QLEGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTPDLDEGPIIEQDVIRVNH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           AQ+ E  + +G+++EA+VL +AV  H Q RV IN  +T+VF
Sbjct: 249 AQSAESLVTLGRDVEAQVLARAVEWHSQSRVMINGHRTVVF 289


>gi|188989731|ref|YP_001901741.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167731491|emb|CAP49666.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris]
          Length = 283

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 127/282 (45%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPPRTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +   F + + + + +   + L+LVS+  HCLNDLL+R +   L ++IV VV
Sbjct: 61  AQLEQQFSQLAASFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIVAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP+T   + E E +L+ ++E+  V+L++LARYMQILS  LC
Sbjct: 121 SNHTDFAPLAASYGIAFHHLPVTADTRAEQETQLLALVERLQVDLVVLARYMQILSPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLVRLGSDTESLVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|156054848|ref|XP_001593350.1| formyltetrahydrofolate deformylase [Sclerotinia sclerotiorum 1980]
 gi|154704052|gb|EDO03791.1| formyltetrahydrofolate deformylase [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 294

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 123/289 (42%), Positives = 181/289 (62%), Gaps = 11/289 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC------ 56
            YILT++CP    I   +  +L+    NI+D  QF D  + + FMR+ F  +        
Sbjct: 6   EYILTLSCPDRPGIVHAVTGFLTKHNLNIVDSQQFGDATSLRFFMRVHFAPSVSSSPETE 65

Query: 57  -----MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLAL 111
                ++     F+ I Q  S+ + + +  +  + LI+VS+  HCLNDLL+R +I  L +
Sbjct: 66  TKKLNVEELKGAFETIAQDMSMDFQLDSLAKKPRVLIMVSKIGHCLNDLLFRQSISQLGI 125

Query: 112 NIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
            +  +VSNH   + L   Y++PF++LP+T   K E E K++ ++++NN++L++LARYMQ+
Sbjct: 126 EVPLIVSNHPDFEPLANTYKIPFHHLPVTAATKAEQESKILELVKENNIDLIVLARYMQV 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS  LC  M+G+IINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ
Sbjct: 186 LSPTLCTAMSGKIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +VVRV H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 246 NVVRVGHGLSPKELTVEGSNVESNVLATAVKWVTERRVLLNGHKTVVFN 294


>gi|320449602|ref|YP_004201698.1| formyltetrahydrofolate deformylase [Thermus scotoductus SA-01]
 gi|320149771|gb|ADW21149.1| formyltetrahydrofolate deformylase [Thermus scotoductus SA-01]
          Length = 285

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 115/284 (40%), Positives = 180/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFV---FNTC 56
           M    L ITCP    I + +  +L   G NI D+ Q+  D +    FMR++F     +  
Sbjct: 1   MEEARLLITCPDRPGIVAAVSGFLYAHGANITDLQQYSTDPEGGTFFMRLAFTTPHLDLS 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  FQ +   +F +++ +    E  +  ILVS+P H L +LL+R+ +G L++++  
Sbjct: 61  RPALERAFQDVVASRFHMEWRLAYASERKRVAILVSKPAHALLELLWRYRVGELSMDLRM 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH  H++ VE + +P++++P+ +  K E+E++++ ++E+  VEL++LARYMQILS  
Sbjct: 121 VISNHPHHQEEVERFGIPYHHVPVEKGRKEEAEERILALLEEERVELVVLARYMQILSPG 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
              +   RIINIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELD GPIIEQDVVR
Sbjct: 181 FVARYPMRIINIHHSFLPAFAGADPYRQAHERGVKLIGATAHYVTEELDQGPIIEQDVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V+H   + +   +G+ +E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 241 VSHRHPVAEMRRLGQELERTVLARAVRWHLEDRILVHGNKTVVF 284


>gi|311104133|ref|YP_003976986.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans A8]
 gi|310758822|gb|ADP14271.1| formyltetrahydrofolate deformylase [Achromobacter xylosoxidans A8]
          Length = 284

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 180/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F          
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDEETGRFFLRVHFDVPAAVSADD 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +  ++ ++  + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDGMSAEYGMELKLHDARRKERLLIMVSKQGHCLNDLLFRVHSGHLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF++LP+T   K + EQ+++ ++EK  ++L++LARYMQILS+ +C  
Sbjct: 124 HNDYASLAASYGIPFHHLPVTADTKAQQEQQVLALVEKEGIDLVVLARYMQILSEDMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAQDLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|161523714|ref|YP_001578726.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189351522|ref|YP_001947150.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221200007|ref|ZP_03573050.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
 gi|221206838|ref|ZP_03579850.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|221211214|ref|ZP_03584193.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|160341143|gb|ABX14229.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|189335544|dbj|BAG44614.1| formyltetrahydrofolate deformylase [Burkholderia multivorans ATCC
           17616]
 gi|221168575|gb|EEE01043.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD1]
 gi|221173493|gb|EEE05928.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2]
 gi|221180246|gb|EEE12650.1| formyltetrahydrofolate deformylase [Burkholderia multivorans CGD2M]
          Length = 294

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 119/293 (40%), Positives = 186/293 (63%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--- 54
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +   
Sbjct: 1   MSTDHSFILKLSCPDRHGIVHAVSGFLFERNSNILDSAQFGDSRTGEFFMRVHFEQDGAG 60

Query: 55  ----TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
               + +     DF P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 61  RDAASALDTLRDDFAPLAEQFAMRWELHDASVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 120

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++++I+++  +L++LA
Sbjct: 121 IEIPAIVSNHKDFYQLAASYDIPFHHFPLVGGSSDAAKAAQEARVLDVIDEHQADLVVLA 180

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 181 RYMQILSPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 240

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|28871451|ref|NP_794070.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71738013|ref|YP_276154.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213970278|ref|ZP_03398408.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|257486441|ref|ZP_05640482.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289628500|ref|ZP_06461454.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648242|ref|ZP_06479585.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|301382936|ref|ZP_07231354.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063789|ref|ZP_07255330.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302133523|ref|ZP_07259513.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28854702|gb|AAO57765.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|71558566|gb|AAZ37777.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213924950|gb|EEB58515.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|320327219|gb|EFW83233.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330868770|gb|EGH03479.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330877833|gb|EGH11982.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330880767|gb|EGH14916.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330950130|gb|EGH50390.1| formyltetrahydrofolate deformylase [Pseudomonas syringae Cit 7]
 gi|330957881|gb|EGH58141.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330966614|gb|EGH66874.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330987781|gb|EGH85884.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009928|gb|EGH89984.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 283

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 175/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|189346175|ref|YP_001942704.1| formyltetrahydrofolate deformylase [Chlorobium limicola DSM 245]
 gi|189340322|gb|ACD89725.1| formyltetrahydrofolate deformylase [Chlorobium limicola DSM 245]
          Length = 287

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 173/280 (61%), Gaps = 3/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLF 60
            IL ++CP    + S I  ++  +G NILD+ +  D      F+R+S+    F+      
Sbjct: 8   AILLLSCPDRAGLVSRISHFIYERGGNILDLDEHVDTVEKMFFIRVSWSTDHFSIPPTEL 67

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+ ++F   + IR      +  + VS+ DHCL +LL+R +IG   ++I  +VSNH
Sbjct: 68  DEAFSPLAKEFGASWKIRLGDRKMRVALFVSRYDHCLQELLWRHSIGEFRIDIPLIVSNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L   Y +PF+  P+T  +K E EQ+ + ++  ++++ ++LARYMQ+LS       
Sbjct: 128 PDLEPLALRYGIPFHVFPVTAASKQEIEQQELGLLRDHDIDTVVLARYMQVLSPQFVESY 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F G++PY+QAYE GVKIIGAT+HY   +LD GPIIEQD+VR++H  
Sbjct: 188 PSRIINIHHSFLPAFVGSSPYRQAYERGVKIIGATSHYVTEDLDQGPIIEQDIVRMSHKD 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           T++D I  G+++E  VL +A+  H + R+ +N +KT+VF 
Sbjct: 248 TLDDLIRKGRDLERLVLARALRLHSEHRILVNGKKTVVFD 287


>gi|239832558|ref|ZP_04680887.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
 gi|239824825|gb|EEQ96393.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
          Length = 294

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 156/288 (54%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MHNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVALD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  +   F + +   +    TKTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  VLREGFASVAAPFDMNFEFHDNAHRTKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+EQ+L++I+E    EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAEQRLLDIVEDTGTELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQSAADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|227823517|ref|YP_002827490.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227342519|gb|ACP26737.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 218/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M SY+LT+TC S   I + +  YL+ +GC I D SQF+DL+T   FMR++F+      ++
Sbjct: 1   MKSYVLTVTCKSTRGIVAAVTGYLAEKGCYISDSSQFDDLETGLFFMRLTFISQEGAKLE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P++++F +   +R+T+E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREGFAPVIKRFDMAMDVRDTEERTKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|21229788|ref|NP_635705.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766665|ref|YP_241427.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21111282|gb|AAM39629.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66571997|gb|AAY47407.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 289

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 7   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPPRTDI 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +   F + + + + +   + L+LVS+  HCLNDLL+R +   L ++IV VV
Sbjct: 67  AQLEQQFSQLAAGFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIVAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   + E E +L+ ++E+  V+L++LARYMQILS  LC
Sbjct: 127 SNHTDFAPLAASYGIAFHHLPVSADTRAEQETQLLALVERLQVDLVVLARYMQILSPALC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 187 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 247 HAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|302188461|ref|ZP_07265134.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae 642]
          Length = 283

 Score =  296 bits (758), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 174/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI + FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEAFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|209884455|ref|YP_002288312.1| formyltetrahydrofolate deformylase [Oligotropha carboxidovorans
           OM5]
 gi|209872651|gb|ACI92447.1| formyltetrahydrofolate deformylase [Oligotropha carboxidovorans
           OM5]
          Length = 287

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 119/282 (42%), Positives = 174/282 (61%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
             ++LT++C +   I S +  +L   G NILD  QF+D +T K FMR++F     ++ + 
Sbjct: 4   QQFVLTLSCDNRPGIVSAVSTFLFASGQNILDAQQFDDTETGKFFMRVTFNTVDGSSDLA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F + + +R   +  + ++LVS+  HCL DLLYRW    L +    +VS
Sbjct: 64  TLRGGFGAIAVPFGMVWQLRERGQHQRVMLLVSKSTHCLADLLYRWRYTDLPMVPTAIVS 123

Query: 119 NHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH         +  +PF+YLP+T + K E E ++  ++++   +L++LARYMQ+LSD L 
Sbjct: 124 NHPRETYEGIEFGDIPFHYLPITRETKAEQEAQIWQLVQETKTDLVVLARYMQVLSDDLA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTGDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    E  +  G +IE +VL +A+  H++ RV +N RKT+VF
Sbjct: 244 HRDPPEILVRKGADIERQVLARALRYHLEDRVILNGRKTVVF 285


>gi|39937092|ref|NP_949368.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           CGA009]
 gi|192292926|ref|YP_001993531.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           TIE-1]
 gi|39650950|emb|CAE29473.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           CGA009]
 gi|192286675|gb|ACF03056.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           TIE-1]
          Length = 287

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 176/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    I S +  +L   G NILD  Q+ND ++   FMR+ F        +  
Sbjct: 5   QYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLAS 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F++ + +R+ +   K ++LVSQ DHCL D+LYRW +G L +    +VSN
Sbjct: 65  LRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY+ P+ +  + + E  +  +I + + +L++LARYMQILSD +  
Sbjct: 125 HPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 185 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 245 RDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 285


>gi|227819940|ref|YP_002823911.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227338939|gb|ACP23158.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 294

 Score =  296 bits (758), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 155/288 (53%), Positives = 214/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +Y+LT+TC S   I + +  YL+ QGCNI+D SQF+DL T   FMRISF+        
Sbjct: 1   MHTYVLTVTCKSTRGIVAALSGYLAEQGCNIIDSSQFDDLQTGLFFMRISFISEQGVGRA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI   F+++ ++ +  E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALEEGLKPIAATFAMETALHDQSERTKALLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|163782775|ref|ZP_02177771.1| formyltetrahydrofolate deformylase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881896|gb|EDP75404.1| formyltetrahydrofolate deformylase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 283

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 120/283 (42%), Positives = 175/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M S IL I+CP  + I   I  +++  G NIL   Q  D      F R+ +    F    
Sbjct: 1   MDSAILLISCPDRKGIVKEIASFIADNGGNILHFDQHIDSQKGIFFARVEWDITDFRFRG 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F+PI ++FS+ YS+    E  +  + VS+ +HC  DL+ R+  G L  ++  VV
Sbjct: 61  GDIEEAFKPIAERFSMNYSLHFGGELQRVAVFVSRQEHCFYDLMQRFRSGELKGDVKLVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K + + + +P+YY+P T++NK E+E+K + ++E+  ++ +ILARYMQILS    
Sbjct: 121 SNHPDLKPIADFFGVPYYYIPKTKENKREAEEKELALLEEYGIDTIILARYMQILSREFV 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   RIINIHHSFLP+F GA PY +AYE GVKIIGAT+HY    LD GPIIEQD++RV+
Sbjct: 181 DRFRNRIINIHHSFLPAFPGAKPYHRAYERGVKIIGATSHYVTEILDEGPIIEQDIIRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  ++ED+I  GK+IE  VL +AV  H++++V +   KT+VF 
Sbjct: 241 HRDSLEDFIRKGKDIERIVLARAVKWHLERKVLVYDNKTVVFD 283


>gi|150398500|ref|YP_001328967.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150030015|gb|ABR62132.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 294

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 153/288 (53%), Positives = 212/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M +++LT+TC S   I + I  YL+ QGCNI+D SQF+DL+T   FMRISF+      + 
Sbjct: 1   MQNFVLTVTCKSTRGIVAAISGYLAGQGCNIVDSSQFDDLETGLFFMRISFISEERLGLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI  +F +  ++    E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ALEEGLKPIASKFEMVTALHEQSERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK  +E +L+ ++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFEYQKVVVNHDIPFHCIKVTKENKPRAEAQLMEVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|302383240|ref|YP_003819063.1| formyltetrahydrofolate deformylase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193868|gb|ADL01440.1| formyltetrahydrofolate deformylase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 286

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 128/284 (45%), Positives = 181/284 (63%), Gaps = 5/284 (1%)

Query: 1   MSSY-ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--- 56
           MS   ++T++C     + + +   L  +G NI++  QFND D  + FMR+ F  +     
Sbjct: 1   MSDICVVTLSCDDQPGLVAKVAGLLFERGANIIEAQQFNDQDAGRFFMRVLFALDDDGIE 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A F P+ +  ++ +S+R+T E  K L+LVS+ DHCL DLLYR   G L +++VG+
Sbjct: 61  LPALKAAFTPLAESHAMTWSMRSTTERRKVLLLVSKFDHCLGDLLYRNRTGELPMDVVGI 120

Query: 117 VSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           VSNH     L+      PF++LP+T++ K E E ++  I+E+   EL++LARYMQ+LSD 
Sbjct: 121 VSNHPREALLISLIGDAPFHHLPVTKETKSEQEARIKQIVEETGAELVVLARYMQVLSDD 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           L   ++GR INIHHSFLP FKGA PY QA+  GVK IGATAHY   +LD GPII QDV  
Sbjct: 181 LSAYLSGRCINIHHSFLPGFKGAKPYHQAHARGVKSIGATAHYVTADLDEGPIIAQDVEA 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           VTHA   +D +  G++IE +VL +AV  H+Q RV +N  KT+VF
Sbjct: 241 VTHADRPDDLVRKGRDIERRVLARAVAFHLQDRVLLNGSKTVVF 284


>gi|195970220|ref|NP_384204.3| formyltetrahydrofolate deformylase [Sinorhizobium meliloti 1021]
 gi|307309552|ref|ZP_07589207.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|307320384|ref|ZP_07599801.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|15073026|emb|CAC41485.1| Probable formyltetrahydrofolate deformylase [Sinorhizobium meliloti
           1021]
 gi|306893950|gb|EFN24719.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti AK83]
 gi|306900012|gb|EFN30633.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 296

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 151/288 (52%), Positives = 215/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M +++LT++C S   + + +  YL+ QGCNI D SQF+DLDT K FMR SF+      + 
Sbjct: 3   MQNFVLTVSCKSTRGVVAALSGYLAEQGCNIADSSQFDDLDTGKFFMRTSFISEERVGLA 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI  +F ++ ++    E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 63  ALEEGLKPIASKFEMETALHEQSERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 123 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 183 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 243 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 290


>gi|325914432|ref|ZP_08176779.1| formyltetrahydrofolate deformylase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325539440|gb|EGD11089.1| formyltetrahydrofolate deformylase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 289

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 173/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 7   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPPATDI 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +   F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 67  ASLEQQFSVLANTFQMDWQLHDARRRARLLVLVSKHGHCLNDLLFRTHSRQLPVEIAAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y + F++LP+T   + E E KL+ +I+   ++L++LARYMQILS  LC
Sbjct: 127 SNHADFAPLAASYGIDFHHLPVTADTRAEQEAKLLALIDDLRIDLVVLARYMQILSPGLC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 187 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 247 HAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 288


>gi|312797333|ref|YP_004030255.1| Formyltetrahydrofolate deformylase [Burkholderia rhizoxinica HKI
           454]
 gi|312169108|emb|CBW76111.1| Formyltetrahydrofolate deformylase (EC 3.5.1.10) [Burkholderia
           rhizoxinica HKI 454]
          Length = 289

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 124/283 (43%), Positives = 183/283 (64%), Gaps = 6/283 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S+IL + C     I   +  +L  +G NILD +QF D  T + FMR+ F     +  +  
Sbjct: 6   SFILKLACADRPGIVHAVSGFLFERGSNILDSAQFGDSRTGEFFMRVHFQQVGGDPGLHA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  + +QF +++ + +    ++ +I+VS+  HCLNDLL+R+  G LA+ I  +VSN
Sbjct: 66  LRASFATLAEQFGMRWELHDANAKSRVMIMVSKIGHCLNDLLFRYRTGQLAIEIPAIVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           H    +L  +Y +PF+YLP+   T Q K   E +++ ++E + V+L++LARYMQILS  L
Sbjct: 126 HQDFYQLAASYNIPFHYLPLADGTPQAKAAQEARVLELVEHHGVDLVVLARYMQILSGEL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C K+ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CEKLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQEVERV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 DHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNDTKTVVF 288


>gi|299131861|ref|ZP_07025056.1| formyltetrahydrofolate deformylase [Afipia sp. 1NLS2]
 gi|298591998|gb|EFI52198.1| formyltetrahydrofolate deformylase [Afipia sp. 1NLS2]
          Length = 287

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 118/282 (41%), Positives = 173/282 (61%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
             ++LT++C +   I S +  +L   G NILD  QF+D +T K FMR++F     ++ + 
Sbjct: 4   QQFVLTLSCDNRPGIVSAVSTFLFASGQNILDAQQFDDTETGKFFMRVTFNTVDGSSDLA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   F + + +R+  E  + +++VS+  HCL DLLYRW    L +    +VS
Sbjct: 64  TLRGGFGAIAVPFGMTWQLRSRSEHQRVMLMVSKSTHCLADLLYRWRYTDLPMVPTAIVS 123

Query: 119 NHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH         +  +PF+YLP+T   K E E ++  ++++   +L++LARYMQ+LSD L 
Sbjct: 124 NHPRETYEGIEFGDIPFHYLPVTRDTKAEQEAQIWKLVQETQTDLVVLARYMQVLSDDLA 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTGDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    E  +  G +IE +VL + +  H++ RV +N RKT+VF
Sbjct: 244 HRDPPEILVRKGADIERQVLARGLRYHLEDRVILNGRKTVVF 285


>gi|307154230|ref|YP_003889614.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7822]
 gi|306984458|gb|ADN16339.1| formyltetrahydrofolate deformylase [Cyanothece sp. PCC 7822]
          Length = 284

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 110/281 (39%), Positives = 169/281 (60%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S+  L I+CP  + + +   +++   G NI+      D        RI +    FN   +
Sbjct: 4   STATLLISCPDQKGLVAKFANFIYANGGNIIHADHHTDFSAGLFLTRIEWQLEGFNLPPE 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  I +    ++ +  ++   +  I V++ DHCL DLL+R   G L  +I  ++S
Sbjct: 64  MINPAFAAIAKPLDARWRLHFSEVIPRIAIWVTKQDHCLLDLLWRQQAGELPASIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH+  K + E + + F+++P+T++ K+E E K + ++ +  ++L++LA+YMQILS     
Sbjct: 124 NHSQLKSIAEQFGIDFHHIPITKETKLEQEAKQLALLREYGIDLVVLAKYMQILSADFVQ 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K    IINIHHSFLP+F GANPY++AYE GVKIIGATAHYA  +LD GPIIEQDV R++H
Sbjct: 184 KFP-NIINIHHSFLPAFAGANPYQRAYERGVKIIGATAHYATADLDEGPIIEQDVERISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ D I  GK++E  VL +AV  H+Q R+ +   KT+VF
Sbjct: 243 RDTVADLIRKGKDLERVVLARAVRLHLQNRILVYSNKTVVF 283


>gi|294627533|ref|ZP_06706116.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667832|ref|ZP_06733042.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598164|gb|EFF42318.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602458|gb|EFF45899.1| formyltetrahydrofolate deformylase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 283

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 123/282 (43%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPAKTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 61  AALEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   +   E +L+ +++   ++L++LARYMQILS  LC
Sbjct: 121 SNHTDFAALAGSYGIAFHHLPVSADTRAAQEAQLLALVDALQIDLVVLARYMQILSPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G +IE+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLVRLGSDIESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|218885296|ref|YP_002434617.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756250|gb|ACL07149.1| formyltetrahydrofolate deformylase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 284

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 125/283 (44%), Positives = 185/283 (65%), Gaps = 4/283 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--- 56
           M+S YILTI+CP    I + +  +L+ Q CNILD +QF D ++ + F+RI F        
Sbjct: 1   MASPYILTISCPDRIGIVATVSTFLAVQRCNILDSAQFGDRESKRFFLRIHFEMPDDGPG 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                  F  +   F +++ + +     + L+LVS+  HCLND+++R   G L   I  +
Sbjct: 61  RPELERLFAGVAATFDMEWQLIDAGSTARILVLVSRFGHCLNDIMFRCETGALNATIPAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   +++ E + +PF+YLP++++NK E E+++  IIE+ +++L++LARYMQILS   
Sbjct: 121 VSNHQDFQRIAEMHDIPFHYLPISKENKAEQEERIARIIEEQSIDLVVLARYMQILSPGF 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +  GR+INIHHSFLPSFKGA+PY QA+  GVK+IGATAHY    LD GPIIEQ+V RV
Sbjct: 181 CARFKGRVINIHHSFLPSFKGASPYHQAFARGVKLIGATAHYVTENLDEGPIIEQEVARV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+   +D +A+G+++E   L +AV  HI+ RV +N  KT+VF
Sbjct: 241 DHSHMPDDLVAVGRDVECLALARAVRFHIEHRVLLNGSKTVVF 283


>gi|91776784|ref|YP_546540.1| formyltetrahydrofolate deformylase [Methylobacillus flagellatus KT]
 gi|91710771|gb|ABE50699.1| formyltetrahydrofolate deformylase [Methylobacillus flagellatus KT]
          Length = 296

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 112/282 (39%), Positives = 170/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           ++  L +TCP  + I + I D+L     NIL   Q  D + +   MR+ F        + 
Sbjct: 15  NTATLLVTCPDRKGIVASIADFLYRHDANILHADQHQDAENNLFLMRVEFDLEGAKVTLD 74

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I  QFS+ + ++ ++   +  I+VSQ DHCL DLL+R   G L  +I  ++S
Sbjct: 75  NFPGHFSSIADQFSMNWELKGSQRRARMAIMVSQYDHCLVDLLHRHQSGELDCDIPLIIS 134

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   Y +PF+++ ++  NK E+E +   + +++ V+L++LARYMQILS     
Sbjct: 135 NHRDTEHLARFYGIPFFHIEVSRDNKAEAEARQFALFDEHQVDLIVLARYMQILSPDFVK 194

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQD+ R++H
Sbjct: 195 RYPHRIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQDITRISH 254

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED I  G+++E  VL++AV  HI+ R+ +   KT++F 
Sbjct: 255 RDQVEDLIQKGRDLERVVLSRAVRWHIENRILLYANKTVIFD 296


>gi|83591895|ref|YP_425647.1| formyltetrahydrofolate deformylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83574809|gb|ABC21360.1| formyltetrahydrofolate deformylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 297

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 119/281 (42%), Positives = 179/281 (63%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCM 57
            + ILTITCP    + + +  +L++QG  I++ + ++D DT + FMR  F  +      +
Sbjct: 15  KAIILTITCPDGFGLVAAVSGFLNSQGAFIIEAAYYSDPDTGRFFMRTVFRSDTAGLPSL 74

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F P+ ++F + + + + +   K +I VS+  HCL DLL+RW  G L + I  +V
Sbjct: 75  GALRECFAPVAERFEMTWDLVSAERKPKVVIAVSRFGHCLYDLLHRWQAGQLHVEIPAIV 134

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    +L E + +PF++LP+T   K   E+ ++ +I+ ++ +L++LARYMQILS  + 
Sbjct: 135 SNHKDLARLAEWHGIPFHHLPVTTGGKEAQEEAILKVIDDSSADLVVLARYMQILSPAMS 194

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             ++GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY    LD GPIIEQ+V RV 
Sbjct: 195 SALSGRCINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTDALDEGPIIEQEVARVD 254

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           H   ++D +A G+++E  VL +AV  H+++RV IN  KT+V
Sbjct: 255 HKYRVDDLVAAGRDLETVVLARAVRWHVERRVMINGTKTVV 295


>gi|36958692|gb|AAQ87160.1| Formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 295

 Score =  296 bits (757), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 155/288 (53%), Positives = 214/288 (74%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +Y+LT+TC S   I + +  YL+ QGCNI+D SQF+DL T   FMRISF+        
Sbjct: 2   MHTYVLTVTCKSTRGIVAALSGYLAEQGCNIIDSSQFDDLQTGLFFMRISFISEQGVGRA 61

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 +PI   F+++ ++ +  E TK L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 62  ALEEGLKPIAATFAMETALHDQSERTKALLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+ + +T++NK ++E +L++ +E+   EL++LARYMQ+LSD LC 
Sbjct: 122 NHFDYQKVVVNHDIPFHCIKVTKENKPKAEAQLLDFVEQTGAELIVLARYMQVLSDALCK 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 182 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 242 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 289


>gi|293603576|ref|ZP_06685997.1| formyltetrahydrofolate deformylase [Achromobacter piechaudii ATCC
           43553]
 gi|292818012|gb|EFF77072.1| formyltetrahydrofolate deformylase [Achromobacter piechaudii ATCC
           43553]
          Length = 284

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 177/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           + YILT++CP    I   +   L   GCNILD  QF D +T + F+R+ F     +    
Sbjct: 4   NDYILTLSCPDRTGIVYRVSGLLFELGCNILDSQQFGDEETGQFFLRVHFDLPAAVAPDD 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A    +   + +   + + +   + LI+VS+  HCLNDLL+R + G L   +  +VSN
Sbjct: 64  LRARLDTLSADYGMDLKLHDARRKQRLLIMVSKQGHCLNDLLFRVHSGHLHAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L  +Y +PF+YLP+T   K E E++++ I E++N +L++LARYMQILS  +C  
Sbjct: 124 HNDYASLAASYGIPFHYLPVTADTKAEQEKQVLRIAEQSNTDLVVLARYMQILSADMCRA 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPII+QD+ RV H 
Sbjct: 184 LNGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTSDLDEGPIIDQDIERVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T  D   +G +IE+ VL++AV +H++ R+ +N+ KT+VF
Sbjct: 244 MTAADLTQVGSDIESLVLSRAVRSHVEHRILLNRNKTVVF 283


>gi|316935593|ref|YP_004110575.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           DX-1]
 gi|315603307|gb|ADU45842.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           DX-1]
          Length = 287

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 117/281 (41%), Positives = 176/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    I S +  +L   G NILD  Q+ND ++   FMR+ F        +  
Sbjct: 5   QYVLTLSCPDRAGIVSAVSTFLYENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLAS 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F++ + +R+ +   K ++LVSQ DHCL D+LYRW +G L +    +VSN
Sbjct: 65  LRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PF++ P+ +  + + E  +  +I + + +L++LARYMQILSD +  
Sbjct: 125 HPRETFSGFDFGDIPFFHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 185 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 245 RDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 285


>gi|293189946|ref|ZP_06608626.1| formyltetrahydrofolate deformylase [Actinomyces odontolyticus
           F0309]
 gi|292821165|gb|EFF80112.1| formyltetrahydrofolate deformylase [Actinomyces odontolyticus
           F0309]
          Length = 294

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 176/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 15  AQLVVTLSCPDRPGIVHAVTGVIGGSGGNVIQSQQFGDSDTGTFFMRVEVDSPKGRAPID 74

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F+  Y + +     +T+I+VS+  HCL DLLYR     + ++++ VV NH 
Sbjct: 75  EGLARVAEEFAATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGMPIDVIAVVGNHP 134

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K ++E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 135 DLAPVAQFYGVPFLNIPVTKDTKAQAERQLLDLIASENVELVVLARYMQILSDEVCRAMQ 194

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 195 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 254

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 255 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 292


>gi|154507743|ref|ZP_02043385.1| hypothetical protein ACTODO_00225 [Actinomyces odontolyticus ATCC
           17982]
 gi|153797377|gb|EDN79797.1| hypothetical protein ACTODO_00225 [Actinomyces odontolyticus ATCC
           17982]
          Length = 292

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 176/278 (63%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  ++T++CP    I   +   +   G N++   QF D DT   FMR+            
Sbjct: 13  AQLVVTLSCPDRPGIVHAVTGVIGGSGGNVIQSQQFGDSDTGTFFMRVEVDSPKGRAPID 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + ++F+  Y + +     +T+I+VS+  HCL DLLYR     + ++++ VV NH 
Sbjct: 73  EGLARVAEEFAATYRVDDLGRKLRTIIMVSREGHCLTDLLYRQQTQGMPIDVIAVVGNHP 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K ++E++L+++I   NVEL++LARYMQILSD +C  M 
Sbjct: 133 DLAPVAQFYGVPFLNIPVTKDTKAQAERQLLDLIATENVELVVLARYMQILSDEVCRAMQ 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 193 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H ++RV +N  +T+VF
Sbjct: 253 TPDMVALGQDVERRVLAQAVRFHAERRVLMNGNRTVVF 290


>gi|75676567|ref|YP_318988.1| formyltetrahydrofolate deformylase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421437|gb|ABA05636.1| formyltetrahydrofolate deformylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 285

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 120/285 (42%), Positives = 179/285 (62%), Gaps = 8/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNT 55
           MS   Y+LT++CP    I S +  +L+  G NI+D  QF+D +T + FMR+ F       
Sbjct: 1   MSHHQYVLTLSCPDRPGIVSAVSTFLAHNGQNIIDAQQFDDAETGRFFMRVVFNAADLAV 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F  I ++F + + +R+     K ++LVS+ DHCL D+LYRW  G L +    
Sbjct: 61  RLPALQTGFDAIAERFRMTWHMRDRAAQRKVMLLVSKSDHCLVDILYRWRTGELKMIPTA 120

Query: 116 VVSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           +VSNH        ++  +PF+Y P+T  +K   E +++ ++E+   +L++LARYMQILS+
Sbjct: 121 IVSNHPRETYAHLDFGEIPFHYFPVT--SKASQEAQVLKLVEETGTDLVVLARYMQILSN 178

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +  +++GR INIHHSFLP FKGA  Y QA+E GVK+IGATAHY   +LD GPII+QDV 
Sbjct: 179 DMSARLSGRCINIHHSFLPGFKGAKAYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVE 238

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R++H  T E  +  G++IE +VL +A+  H+  RV +N RKT+VF
Sbjct: 239 RISHRDTPEALVRKGRDIERRVLARAIRHHLDDRVILNGRKTVVF 283


>gi|297559391|ref|YP_003678365.1| formyltetrahydrofolate deformylase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843839|gb|ADH65859.1| formyltetrahydrofolate deformylase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 295

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 124/291 (42%), Positives = 183/291 (62%), Gaps = 13/291 (4%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN------T 55
             Y+LT++CP +  I + + + LS  GCNI +  Q+ D  T + F+R+ FV         
Sbjct: 4   REYVLTLSCPDSRGIVAAVANLLSDHGCNITESQQYGDHYTGRFFLRMQFVAERGGDGVV 63

Query: 56  CMKLFIADFQPIVQQF-------SLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGT 108
              +    F  +   F        +++++       + +++VS+  HCLNDLLYR   G 
Sbjct: 64  GEDVLRGAFAALAGDFGGRGGDAFVEWTLNPRDVRPRMIVMVSKFGHCLNDLLYRQRSGL 123

Query: 109 LALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARY 168
           L  +I  VVSNH   + L ++Y + F++LP+T  +K E E +L+ +++  +V+L++LARY
Sbjct: 124 LDADIAAVVSNHPDLEFLADSYGVDFHHLPVTAGSKKEQEARLLELVDSYDVDLVVLARY 183

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQ+LS+ LC KM+GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPI
Sbjct: 184 MQVLSEQLCAKMSGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPI 243

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQ+V RV H  + E   AIG+++E+  L +AVN H Q+RV +N  KT++F
Sbjct: 244 IEQEVSRVDHTHSPEQLTAIGRDLESVALARAVNWHAQRRVLLNGDKTVIF 294


>gi|34497381|ref|NP_901596.1| formyltetrahydrofolate deformylase [Chromobacterium violaceum ATCC
           12472]
 gi|34103237|gb|AAQ59600.1| formyltetrahydrofolate deformylase [Chromobacterium violaceum ATCC
           12472]
          Length = 289

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 170/281 (60%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
           S  L I+ P  + + + I ++L T   NI+   Q  D   +   MR+ +  +     M  
Sbjct: 9   SATLLISAPDKKGLVAAIANFLMTYNANIMHADQHQDTSENLFLMRVQWDLDGFTLPMDS 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A FQPI  +  + + +  +    +  I VSQ +HCL DL++RW IG L  +I  V+SN
Sbjct: 69  FAAAFQPIADEHGMNWKVSLSARKPRMAIFVSQYEHCLVDLMHRWRIGELDCDIPLVISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T ++LVE   +PF+ + +T+ NK E+E +   ++E+  V+ ++LARYMQILS     +
Sbjct: 129 HETCRRLVEFNGIPFHVIKVTKDNKAEAEAEQFRLLEEAGVDFIVLARYMQILSGEFVER 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R+INIHHSFLP+F GA PY +A+  GVK+IGAT+HY   +LD GPIIEQ+V R++H 
Sbjct: 189 YPDRVINIHHSFLPAFDGAKPYHRAFARGVKLIGATSHYVTEDLDEGPIIEQEVTRISHR 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T+ED +  G+++E  VL++AV  H+  RV     KT+VF 
Sbjct: 249 DTVEDLVEKGRDLEKVVLSRAVRWHLDNRVLSYSNKTVVFD 289


>gi|261408999|ref|YP_003245240.1| formyltetrahydrofolate deformylase [Paenibacillus sp. Y412MC10]
 gi|261285462|gb|ACX67433.1| formyltetrahydrofolate deformylase [Paenibacillus sp. Y412MC10]
          Length = 312

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 114/282 (40%), Positives = 169/282 (59%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCM 57
           +   + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +
Sbjct: 31  NRARMLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKL 90

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F+ +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 91  PQLEESFREVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIALVV 150

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P++++P+T   K ++EQ+ + +I   +++++ILARYMQI+S    
Sbjct: 151 SNHLDMKEYVESFGIPYHHIPVTADTKPQAEQRQLEVIGD-DIDVIILARYMQIISPTFI 209

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 210 DHYRNRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 269

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 270 HRDDVNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVF 311


>gi|320333501|ref|YP_004170212.1| formyltetrahydrofolate deformylase [Deinococcus maricopensis DSM
           21211]
 gi|319754790|gb|ADV66547.1| formyltetrahydrofolate deformylase [Deinococcus maricopensis DSM
           21211]
          Length = 298

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 169/283 (59%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NTCM 57
           ++  LTI+C   + I + +  +L   G NI+   Q   D      FMR+ F     +   
Sbjct: 17  NTARLTISCADRKGIVAAVSQFLHNHGANIIHSDQHSTDPSGGTFFMRMEFHLEGLDLAR 76

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F   FQ +    F + + +    E  +  ILVS+ DHC  DLL+R   G L ++I  +
Sbjct: 77  GPFERAFQDVVATPFGMDWHVWYNTEPKRMAILVSKYDHCFLDLLWRHRRGELDVDIPMI 136

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++  E + +P++ +P+T+ NK E+E + I ++     + ++LARYMQILS   
Sbjct: 137 ISNHEDLRRDAEGFGIPYHVIPVTKANKAEAEAEQIALLRD-RCDFVVLARYMQILSGDF 195

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
              +   +INIHHSFLP+F GANPY+ A+  GVK++GATAHY   ELDAGPIIEQDV RV
Sbjct: 196 LRGVGVPVINIHHSFLPAFIGANPYRAAWTRGVKLVGATAHYVTEELDAGPIIEQDVARV 255

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH +T E  + +G+++E +VL +AV AH++ RV ++  KT+VF
Sbjct: 256 THRETPETLMRLGRDVERQVLARAVKAHVEDRVLVHGNKTVVF 298


>gi|312114038|ref|YP_004011634.1| formyltetrahydrofolate deformylase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219167|gb|ADP70535.1| formyltetrahydrofolate deformylase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 286

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 126/278 (45%), Positives = 181/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF--I 61
           ++LT++C     I + I   L+  GCNI D +QF D+ +++ FMR+SF     M      
Sbjct: 8   FVLTLSCADQSGIVASIAGILAEHGCNITDSAQFGDVKSNRFFMRVSFSAPDTMDEAGAE 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +P+V +F +   +    E  + LILVS+  HCLNDLLYR  +G L + I  +VSNH 
Sbjct: 68  RMLKPVVDRFKMTTRLHPVAERMRVLILVSKFGHCLNDLLYRHRVGALPVEIPAIVSNHR 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
              +L  ++ +PF++LPM    K + E KL  IIE   ++L++LARYMQ+LS+ LC  + 
Sbjct: 128 DFYRLAASHDIPFHHLPMAADTKEKQEHKLAEIIEDEKIDLVVLARYMQVLSEDLCRTLE 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY    LD GPIIEQ+V RV H+ +
Sbjct: 188 GRAINIHHSFLPSFKGAKPYHQAHMRGVKLIGATAHYVTPALDEGPIIEQEVARVDHSMS 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IED + +G+++E+ VL++AV  H++ R+ +N  +T+VF
Sbjct: 248 IEDLVNMGRDVESLVLSRAVKWHVEHRILVNGNRTVVF 285


>gi|320325493|gb|EFW81555.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 283

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 175/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTPIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPTFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|302555897|ref|ZP_07308239.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
 gi|302473515|gb|EFL36608.1| formyltetrahydrofolate deformylase [Streptomyces viridochromogenes
           DSM 40736]
          Length = 287

 Score =  295 bits (755), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 118/279 (42%), Positives = 188/279 (67%), Gaps = 3/279 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             ++LT++CP    +   +  +L     NI +  QF+D    + FMR+ F  +     ++
Sbjct: 9   REFVLTLSCPDRSGLVHAVTGFLVRHSGNIQESQQFDDRLQDRFFMRVHFDVSDPGTSIE 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F P+ + + + + + +    T+TLI+VS+  HCLNDLL+R + G+L + +  +VS
Sbjct: 69  DLKSGFAPVAEAYRISWQLFDASTPTRTLIMVSKFGHCLNDLLFRRSTGSLNIEVPAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L E+Y +PF+++P+T + K E+E +L+ ++++ +++L++LARYMQILS+ LC 
Sbjct: 129 NHRDFEPLAESYGIPFHHVPVTRETKPEAEARLLQLVDELDIDLVVLARYMQILSNDLCK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDV+RV H
Sbjct: 189 QLEGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTPDLDEGPIIEQDVIRVNH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTI 277
           AQ  +  +A+G+++EA+VL +AV  H Q RV +N  +T+
Sbjct: 249 AQRPDSLVALGRDVEAQVLARAVEWHSQSRVMVNGNRTV 287


>gi|172035320|ref|YP_001801821.1| formyltetrahydrofolate deformylase [Cyanothece sp. ATCC 51142]
 gi|171696774|gb|ACB49755.1| formyltetrahydrofolate deformylase [Cyanothece sp. ATCC 51142]
          Length = 286

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 105/281 (37%), Positives = 162/281 (57%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           S+  L I+CP  + + +   +++   G NI+   Q  D +      RI +  N       
Sbjct: 6   STATLLISCPDQQGLVAKFANFIYDNGGNIIHADQHTDFEAGLFLTRIEWQLNGFKLSRD 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +  + F  + +     + I  +    +  + V++ DHCL DLL+RW    +  +I  ++S
Sbjct: 66  MMASSFASVAKPLQAVWEIHFSDTIPRLALFVTKQDHCLLDLLWRWQAKEIRADIPLIIS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K + + + + FY+  +T++NK   E + + ++ ++ + L+ILA+YMQIL+    +
Sbjct: 126 NHEKLKAIAKQFDIDFYHFNLTKENKNRQEARQLELLREHRINLVILAKYMQILTPEFIN 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
                IINIHHSFLP+F GA PY +A+E GVKIIGATAHY   +LD GPIIEQDVVRV+H
Sbjct: 186 HFPH-IINIHHSFLPAFAGAKPYHRAHERGVKIIGATAHYVTADLDEGPIIEQDVVRVSH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             TI D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 245 RDTIPDLIRKGKDLERVVLARAVRLHLQHRVLVYGNRTVVF 285


>gi|194334473|ref|YP_002016333.1| formyltetrahydrofolate deformylase [Prosthecochloris aestuarii DSM
           271]
 gi|194312291|gb|ACF46686.1| formyltetrahydrofolate deformylase [Prosthecochloris aestuarii DSM
           271]
          Length = 292

 Score =  294 bits (754), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 111/280 (39%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL + CP    + S +  ++   G NILD+ +  D  +   F+R+S+    F+     
Sbjct: 12  SAILLLACPDRRGLVSRLAHFIFEHGGNILDLDEHVDAGSGMFFIRVSWSMDGFSIPASD 71

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+P+ ++F  ++SI   +   +  + VS+ DHCL ++L+R   G   ++I  ++SN
Sbjct: 72  LEEVFRPLGREFQARWSIHTAETRERVALFVSKYDHCLQEILWRHRTGEFQIDIPLIISN 131

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     L  +Y + F+  P+T +NK++ EQ+ + ++  + ++ ++LARYMQ+LSD     
Sbjct: 132 HPDLGPLARHYGIAFHVYPITSENKLDQEQRELELLRAHRIDTVVLARYMQVLSDRFVDA 191

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M  R+INIHHSFLP+F G NPY+QA+E GVKIIGAT+HY   ELD GPIIEQD+VR++H 
Sbjct: 192 MPERVINIHHSFLPAFSGGNPYRQAFERGVKIIGATSHYVTAELDEGPIIEQDIVRISHK 251

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ D +  G+++E  VL +A++ H++ RV +N RKTIVF
Sbjct: 252 DTLPDLVRKGRDLERLVLARALSRHVEHRVLVNGRKTIVF 291


>gi|298488612|ref|ZP_07006642.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156953|gb|EFH98043.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 283

 Score =  294 bits (754), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 174/283 (61%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F  I ++FS+ + I ++ +  + +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFTLIAEEFSMDWRITDSAQKKRVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVFD 283


>gi|330992207|ref|ZP_08316155.1| Formyltetrahydrofolate deformylase [Gluconacetobacter sp. SXCC-1]
 gi|329760406|gb|EGG76902.1| Formyltetrahydrofolate deformylase [Gluconacetobacter sp. SXCC-1]
          Length = 292

 Score =  294 bits (754), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 127/284 (44%), Positives = 185/284 (65%), Gaps = 4/284 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           +++ILT++CP+   I + I  +L  +G NI +  QF+D  + + FMRI F        + 
Sbjct: 9   ATFILTLSCPNRPGIVAAISQHLYERGANITEAQQFDDTGSRQFFMRIVFELARKEGLLH 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  I   FS+ +++ +T+   + L+LVS+ DHCL DLLYRW IG L +  VG+VS
Sbjct: 69  TLRTQFTDIASSFSMSWTLTDTRHRPRVLLLVSRFDHCLVDLLYRWRIGELRIEPVGIVS 128

Query: 119 NHTTHKKLV-ENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        + Y +PF+YLP+T+  K E E+++ ++   ++ EL +LARYMQ+LS+ + 
Sbjct: 129 NHPREIFADVDFYGIPFHYLPVTKDTKAEQEERIWSLFTHSDAELAVLARYMQVLSNAMA 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 189 ARLSGRCINIHHSFLPGFKGARPYHQAFSRGVKLIGATAHYVTSDLDEGPIIEQDVERIS 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           HA + +D I  G++IE +VL +AV  HI++R  +N  KTIVF  
Sbjct: 249 HADSPDDLIRKGRDIERRVLARAVRFHIERRAIMNANKTIVFTP 292


>gi|300868272|ref|ZP_07112901.1| formyltetrahydrofolate deformylase [Oscillatoria sp. PCC 6506]
 gi|300333707|emb|CBN58085.1| formyltetrahydrofolate deformylase [Oscillatoria sp. PCC 6506]
          Length = 284

 Score =  294 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 105/280 (37%), Positives = 158/280 (56%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP    + +   +++     NI+   Q  D        RI +    F+   + 
Sbjct: 5   TATLLISCPDRRGLVAKFANFIYGHNGNIIHADQHTDFAAGLFLTRIEWQLEGFDLSREE 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I Q     + +  +    +  I VS+ DHCL DL++R     L   I  ++SN
Sbjct: 65  IAPAFSAIAQPLEANWQLHFSDTIRRMAIWVSRQDHCLLDLIWRQQSQELLAEIPLIISN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + +     FY++P+++ +K E E + + ++ + N++L++LA+YMQILS      
Sbjct: 125 HPNLKPIADRCGADFYHIPISKDSKSEQEAQHLKLLNQYNIDLVVLAKYMQILSAEFIAN 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +IINIHHSFLP+F GA PY++AYE GVKIIGATAHY   +LDAGPIIEQDV RV+H 
Sbjct: 185 FP-QIINIHHSFLPAFVGAKPYERAYERGVKIIGATAHYVTSDLDAGPIIEQDVERVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + D I  GK++E  VL +AV +H++ RV +   KT+VF
Sbjct: 244 DEVSDLIRKGKDLERIVLARAVRSHLRNRVLVYGNKTVVF 283


>gi|302539696|ref|ZP_07292038.1| formyltetrahydrofolate deformylase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302457314|gb|EFL20407.1| formyltetrahydrofolate deformylase [Streptomyces himastatinicus
           ATCC 53653]
          Length = 290

 Score =  294 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 189/281 (67%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
             ++LT++CP    +   +  YL +   NIL+  QF+D    + FMR+ F     +  + 
Sbjct: 9   REFVLTLSCPDRAGLVHAVATYLVSHSGNILESQQFDDRRQDRFFMRVHFDVLDPDVSLA 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ +   + + + +    T+TLI+VS+  HCLNDLL+R + G L ++I  +VS
Sbjct: 69  ELRTGFGPVAESHRITWQLHDASTPTRTLIMVSKFGHCLNDLLFRRSTGALKVDIPAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T + L  NY +PF+++P+T + K E+E +L+ ++++ +V+L++LARYMQILSD LC 
Sbjct: 129 NHRTFEPLARNYGIPFHHIPVTPETKHEAEARLLRLVDELDVDLVVLARYMQILSDDLCK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSFKGA PY QA+E GVK++GATAHY   +LD GPIIEQDVVRV H
Sbjct: 189 QLDGRAINIHHSFLPSFKGARPYVQAHERGVKLVGATAHYVTSDLDEGPIIEQDVVRVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++  ++ + +G+++EA+VL +AV  H + RV +N  +T+VF
Sbjct: 249 SRAPDELVTMGRDVEAQVLARAVEWHSESRVLVNGNRTVVF 289


>gi|86571730|gb|ABD06287.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 305

 Score =  294 bits (753), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    IT+ +  +L   G N+LD  Q+ND ++   FMR+ F        +  
Sbjct: 23  QYVLTLSCPDRVGITAAVTTFLFENGQNVLDAQQYNDTESGHFFMRVVFNAADRVVPLAE 82

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VSN
Sbjct: 83  LRTGFSAIALKFTMGWHMRDRSTRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVSN 142

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY+LP+T+  + + E  +  +I +   +L++LARYMQILSD +  
Sbjct: 143 HPRDTFSGFDFGEIPFYHLPVTKDTRRQQEAAITALIAQTKTDLVVLARYMQILSDEMAG 202

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 203 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERISH 262

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 263 RDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 303


>gi|315649116|ref|ZP_07902209.1| formyltetrahydrofolate deformylase [Paenibacillus vortex V453]
 gi|315275551|gb|EFU38906.1| formyltetrahydrofolate deformylase [Paenibacillus vortex V453]
          Length = 299

 Score =  294 bits (753), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 169/283 (59%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCM 57
           +   + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +
Sbjct: 18  NRARMLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKL 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 78  PQLEESFLEVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIALVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P++++P+T   K E+E++ +++I   +++++ILARYMQI+S    
Sbjct: 138 SNHLDMKEYVESFGIPYHHIPVTADTKPEAEKRQLDVIGD-DIDVIILARYMQIISPTFI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 EHYRNRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF 
Sbjct: 257 HRDDVNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVFN 299


>gi|320094409|ref|ZP_08026192.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|319978655|gb|EFW10215.1| formyltetrahydrofolate deformylase [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 284

 Score =  294 bits (753), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 169/278 (60%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           +  +LT++CP    I   +   +   G N++   QF D  T   FMR+            
Sbjct: 5   AQLVLTLSCPDRPGIVHAVTGVIGAAGGNVIQSQQFGDPGTGTFFMRVEVDSPAGRAPVE 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                  +QFS  Y +       +T+I+VS+  HCL DLLYR     L + +V VV NH 
Sbjct: 65  EGLADAARQFSADYRVDELGRRLRTIIMVSREGHCLTDLLYRQRTQGLPIEVVAVVGNHP 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               + + Y +PF  +P+T+  K  +E++L++++    VEL++LARYMQILSD +C  M 
Sbjct: 125 DLAPVAQFYGVPFLNIPITKDTKARAEEQLLDLVASEKVELVVLARYMQILSDGVCRAME 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV+HA +
Sbjct: 185 GRVINIHHSFLPSFKGARPYAQAHERGVKLIGATAHYVTADLDEGPIIEQDVTRVSHADS 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D +A+G+++E +VL +AV  H + RV +N  +T+VF
Sbjct: 245 TADMVALGQDVERRVLAQAVRFHAEHRVLMNGTRTVVF 282


>gi|94501188|ref|ZP_01307710.1| formyltetrahydrofolate deformylase [Oceanobacter sp. RED65]
 gi|94426615|gb|EAT11601.1| formyltetrahydrofolate deformylase [Oceanobacter sp. RED65]
          Length = 283

 Score =  294 bits (753), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 179/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           SY L I+CP    I + +  ++S+ G  I++ + + D  +   FMR           +  
Sbjct: 4   SYRLIISCPDRVGIVAKVGQFVSSYGGWIVEANHYADPTSGWFFMRHCIKAESLPFGLDE 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F PI ++F + ++I  ++   K ++L S+  HCL D+L+RW+ G L  +I  V+SN
Sbjct: 64  FREKFAPIAEEFEMDWAIAASEAPKKMVLLASKESHCLVDVLHRWHSGELHCDIPCVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + LVE + +PF+++P+ ++NK E   ++  IIE++  ++++LARYMQIL   +C K
Sbjct: 124 HDDLRSLVEWHGIPFFHVPVDKENKQEHFDRVSAIIEEHQADVIVLARYMQILPADVCAK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G+IINIHHSFLPSF GA PY QA E GVK+IGAT HY   +LDAGPII+QDVVR++H 
Sbjct: 184 YEGQIINIHHSFLPSFVGAKPYHQAAERGVKLIGATCHYVTQDLDAGPIIDQDVVRISHK 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T+ED + +GK++E  VL++ V  H++ RV  +  KTIVF
Sbjct: 244 DTVEDMVRLGKDVEKMVLSRGVRLHLEDRVLRHGNKTIVF 283


>gi|255019407|ref|ZP_05291515.1| Formyltetrahydrofolate deformylase [Acidithiobacillus caldus ATCC
           51756]
 gi|254971145|gb|EET28599.1| Formyltetrahydrofolate deformylase [Acidithiobacillus caldus ATCC
           51756]
          Length = 286

 Score =  294 bits (753), Expect = 9e-78,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 170/281 (60%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           + Y LT++CP    I + +  +L+  G  I + S   D  T + F+R     +     ++
Sbjct: 5   AHYTLTLSCPDRVGIVARVAGFLAEHGGWITEASHHADAGTGRFFLRQQIQADSLPFDLE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I   F +Q+SI +++   + +++VSQ  HCL DLL RW  G LA++I  V+S
Sbjct: 65  GFRGKFSEIAHTFDMQWSITDSRRRKRMVLMVSQQGHCLYDLLGRWRSGELAVDIPAVIS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T +  VE + +PF+++P+T + K  +  ++  I ++   ++++LARYMQ+L    C 
Sbjct: 125 NHETFRDFVEWHGIPFHHIPVTPETKSAAFAEVSAIFDRVGGDVLVLARYMQVLDAETCA 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  GRIINIHHSFLP F GA PY QAY  GVK++GAT HY   +LD GPIIEQDV+RV H
Sbjct: 185 RYPGRIINIHHSFLPGFVGARPYHQAYARGVKLVGATCHYVTEDLDQGPIIEQDVLRVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                D I  G+++E  VL + +  H++ RV +N ++T+VF
Sbjct: 245 GDMPTDLIRSGRDVEKTVLARGLRYHLEDRVLLNGQRTVVF 285


>gi|332717058|ref|YP_004444524.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
 gi|325063743|gb|ADY67433.1| formyltetrahydrofolate deformylase [Agrobacterium sp. H13-3]
          Length = 294

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 147/288 (51%), Positives = 207/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+SY++ ++CP+   I + +  YL+  GCNI D SQF DL+T + FMR+SFV    M+  
Sbjct: 1   MTSYVMKVSCPARSGIVAAVSGYLARSGCNINDSSQFTDLETGRFFMRLSFVSEEGMEPA 60

Query: 61  I--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  +   F ++Y I +    TK +I+VS+  HCLNDLLYR +IG L + IV V+S
Sbjct: 61  ALVAGFASVAADFDMEYDIHDLSRKTKVVIMVSRFGHCLNDLLYRSHIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+++ +T + K E+E  ++ ++     EL++LARYMQ+LS+ LC 
Sbjct: 121 NHLEYQKQVVNEDIPFHHIRVTPETKPEAEAAILQVVRDAGAELVVLARYMQVLSERLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GV++IGATAHY   +LD GPIIEQD +RVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVRLIGATAHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI  RVF+N  KT+VFPA P  Y
Sbjct: 241 AQSGMDYVSLGRDVESQVLARAIHAHIHHRVFLNGNKTVVFPASPGEY 288


>gi|119962169|ref|YP_949510.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
 gi|119949028|gb|ABM07939.1| formyltetrahydrofolate deformylase [Arthrobacter aurescens TC1]
          Length = 299

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 124/279 (44%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT+ CP    I   +  +L   GC+I+D  QF D      FMR+ F  +     +  
Sbjct: 19  EHVLTLDCPEGPGIVHAVSGFLLDHGCDIIDNKQFGDRAEGHFFMRVHFASDGDDSTVDQ 78

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ +++ + + +       + LI+VS+  HCLNDLL+R  IG L +++VGVVSN
Sbjct: 79  LRNAFAPVAEKYGMNWQLERQGYKRRVLIMVSKFGHCLNDLLFRARIGELPIDVVGVVSN 138

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT H+ L E + +PF+++P+T   K  +E +L+ II++ +VEL++LARYMQ+LSD L  K
Sbjct: 139 HTDHQGLAEWHGIPFFHVPVTAATKPAAEGRLLEIIDELDVELIVLARYMQVLSDDLARK 198

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 199 LDGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNGELDEGPIIAQQVVEVDHT 258

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              +D +A G++ E K L+ AV  H + R+ +N  +TIV
Sbjct: 259 FGPDDLVAAGRDTECKALSNAVRWHCEGRIILNGNRTIV 297


>gi|78045889|ref|YP_362064.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325927349|ref|ZP_08188602.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|325928591|ref|ZP_08189776.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|78034319|emb|CAJ21964.1| formyltetrahydrofolate deformylase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325541024|gb|EGD12581.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
 gi|325542272|gb|EGD13761.1| formyltetrahydrofolate deformylase [Xanthomonas perforans 91-118]
          Length = 283

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  QF + + + + +   + L+LVS+  HCLNDLL+R +   L ++I  VV
Sbjct: 61  AALEQRFAVLADQFQMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIAAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   +   E +L+ +++   ++L++LARYMQILS  LC
Sbjct: 121 SNHTDFAPLAASYGIAFHHLPVSADTRAAQEAQLLALVDDLQIDLVVLARYMQILSPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D I +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLIRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|145219330|ref|YP_001130039.1| formyltetrahydrofolate deformylase [Prosthecochloris vibrioformis
           DSM 265]
 gi|145205494|gb|ABP36537.1| formyltetrahydrofolate deformylase [Chlorobium phaeovibrioides DSM
           265]
          Length = 292

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 108/281 (38%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           + +L ++CP    + S +  ++  +G NI+D+ +  D    + F+RI +    F+   + 
Sbjct: 12  NAVLLLSCPDRRGLVSRLSLFIFERGGNIIDLDEHVDPVEGRFFIRILWSLEEFSIPEEE 71

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F+P+ ++    +++R T   ++  + VS+ DHCL +LL+R  IG   + I  +VSN
Sbjct: 72  LEEEFRPLAEELGAAWALRFTGRKSRVAVFVSRYDHCLQELLWRHGIGEFQIEIPLIVSN 131

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L ++  +PF+ +P++ +N++  E++   ++E ++V+ ++LARYMQ+LS     +
Sbjct: 132 HPDLQPLADHCGIPFHVIPVSSENRMAVEKQTTALLEAHDVDWVVLARYMQVLSPAFVER 191

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR+INIHHSFLP+F G NPY+QAYE GVKIIGAT+H+   ELD GPIIEQD VRVTH 
Sbjct: 192 WRGRVINIHHSFLPAFVGGNPYRQAYERGVKIIGATSHFITEELDQGPIIEQDTVRVTHR 251

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            ++ D I  G+++E  VL +AV  H + R+ +N  KT+VF 
Sbjct: 252 DSLADLIRRGRDLERLVLARAVRLHSEHRILLNGTKTVVFD 292


>gi|86158434|ref|YP_465219.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774945|gb|ABC81782.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 299

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 173/282 (61%), Gaps = 6/282 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSK-LFMRISFVFN----TCM 57
             IL + CP    I + I  +L   G NILD  Q   +D     F R+ F  +       
Sbjct: 18  RAILLVQCPDRPGIVAAISSFLYRHGANILDFDQHTSVDNGGAYFTRLEFQTDRLDLPVE 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            L  A    + + F++ + +  + +  K  ILVS+ DH L +LL+ W+ G L  ++  V+
Sbjct: 78  DLQRAFALDVARPFAMDWRLTLSSQRKKVAILVSKHDHALLELLWNWDRGDLHADVSTVI 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VE++ +PF ++P T   + ++E +++ +++    +L++LARYMQI+S  L 
Sbjct: 138 SNHPDLREAVESFGVPFVHVPNTRDTRAQAEARMLELLDG-KADLVVLARYMQIVSPELV 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  GRIINIHHSFLP+F GA+PY+QAYE GVKI+GATAHY   ELDAGPII+QDV RV+
Sbjct: 197 ARWPGRIINIHHSFLPAFVGADPYRQAYERGVKIVGATAHYVTAELDAGPIIDQDVGRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED   +G+++E +VL +AV  H + RV +N  KT+VF
Sbjct: 257 HRDAVEDLKRLGRDLERRVLARAVRWHCEDRVIVNGNKTVVF 298


>gi|17988732|ref|NP_541365.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           16M]
 gi|23500636|ref|NP_700076.1| formyltetrahydrofolate deformylase [Brucella suis 1330]
 gi|148558473|ref|YP_001257833.1| formyltetrahydrofolate deformylase [Brucella ovis ATCC 25840]
 gi|163845026|ref|YP_001622681.1| formyltetrahydrofolate deformylase [Brucella suis ATCC 23445]
 gi|225629367|ref|ZP_03787400.1| formyltetrahydrofolate deformylase [Brucella ceti str. Cudo]
 gi|225686668|ref|YP_002734640.1| formyltetrahydrofolate deformylase [Brucella melitensis ATCC 23457]
 gi|254703229|ref|ZP_05165057.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|254705627|ref|ZP_05167455.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|254710856|ref|ZP_05172667.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|254720226|ref|ZP_05182037.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|256015670|ref|YP_003105679.1| formyltetrahydrofolate deformylase [Brucella microti CCM 4915]
 gi|256029239|ref|ZP_05442853.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|256043776|ref|ZP_05446698.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256058924|ref|ZP_05449138.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|256111179|ref|ZP_05452215.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256157434|ref|ZP_05455352.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|256253588|ref|ZP_05459124.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|256262198|ref|ZP_05464730.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260167669|ref|ZP_05754480.1| formyltetrahydrofolate deformylase [Brucella sp. F5/99]
 gi|260564961|ref|ZP_05835446.1| formyl transferase [Brucella melitensis bv. 1 str. 16M]
 gi|261220724|ref|ZP_05935005.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|261313037|ref|ZP_05952234.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|261318430|ref|ZP_05957627.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|261322864|ref|ZP_05962061.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|261753859|ref|ZP_05997568.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|261757102|ref|ZP_06000811.1| formyl transferase [Brucella sp. F5/99]
 gi|265985238|ref|ZP_06097973.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|265986228|ref|ZP_06098785.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|265990202|ref|ZP_06102759.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992691|ref|ZP_06105248.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995924|ref|ZP_06108481.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|306838632|ref|ZP_07471468.1| formyltetrahydrofolate deformylase [Brucella sp. NF 2653]
 gi|306841531|ref|ZP_07474229.1| formyltetrahydrofolate deformylase [Brucella sp. BO2]
 gi|17984545|gb|AAL53629.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           16M]
 gi|23464279|gb|AAN34081.1| formyltetrahydrofolate deformylase [Brucella suis 1330]
 gi|148369758|gb|ABQ62630.1| formyltetrahydrofolate deformylase [Brucella ovis ATCC 25840]
 gi|163675749|gb|ABY39859.1| formyltetrahydrofolate deformylase [Brucella suis ATCC 23445]
 gi|225615863|gb|EEH12912.1| formyltetrahydrofolate deformylase [Brucella ceti str. Cudo]
 gi|225642773|gb|ACO02686.1| formyltetrahydrofolate deformylase [Brucella melitensis ATCC 23457]
 gi|255998330|gb|ACU50017.1| formyltetrahydrofolate deformylase [Brucella microti CCM 4915]
 gi|260152604|gb|EEW87697.1| formyl transferase [Brucella melitensis bv. 1 str. 16M]
 gi|260919308|gb|EEX85961.1| formyltetrahydrofolate deformylase [Brucella ceti B1/94]
 gi|261297653|gb|EEY01150.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis B2/94]
 gi|261298844|gb|EEY02341.1| formyltetrahydrofolate deformylase [Brucella neotomae 5K33]
 gi|261302063|gb|EEY05560.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M163/99/10]
 gi|261737086|gb|EEY25082.1| formyl transferase [Brucella sp. F5/99]
 gi|261743612|gb|EEY31538.1| formyltetrahydrofolate deformylase [Brucella suis bv. 3 str. 686]
 gi|262550221|gb|EEZ06382.1| formyltetrahydrofolate deformylase [Brucella ceti M490/95/1]
 gi|262763561|gb|EEZ09593.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000871|gb|EEZ13561.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091894|gb|EEZ16216.1| formyltetrahydrofolate deformylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264658425|gb|EEZ28686.1| formyltetrahydrofolate deformylase [Brucella pinnipedialis
           M292/94/1]
 gi|264663830|gb|EEZ34091.1| formyltetrahydrofolate deformylase [Brucella sp. 83/13]
 gi|306288368|gb|EFM59727.1| formyltetrahydrofolate deformylase [Brucella sp. BO2]
 gi|306406275|gb|EFM62518.1| formyltetrahydrofolate deformylase [Brucella sp. NF 2653]
 gi|326411059|gb|ADZ68123.1| formyltetrahydrofolate deformylase [Brucella melitensis M28]
 gi|326554351|gb|ADZ88990.1| formyltetrahydrofolate deformylase [Brucella melitensis M5-90]
          Length = 294

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|121699986|ref|XP_001268258.1| formyltetrahydrofolate deformylase, putative [Aspergillus clavatus
           NRRL 1]
 gi|119396400|gb|EAW06832.1| formyltetrahydrofolate deformylase, putative [Aspergillus clavatus
           NRRL 1]
          Length = 285

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 127/285 (44%), Positives = 180/285 (63%), Gaps = 5/285 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----- 55
           M S+ILTI+CP +  I   +  +L  +  NI+D SQF D  + + FMR+ F         
Sbjct: 1   MDSFILTISCPDHPGIVHAVTAFLVQRNLNIIDSSQFGDPTSKRFFMRMHFAPTEQNPAL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +    A F P  Q   + + I    +  + LI+VS+  HCLNDLL+R + G LA+ +  
Sbjct: 61  TVDELRAAFAPTAQSLEMAFEIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQLAIEVPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF +LP+T   K E E ++++++ ++N++L++LARYMQ+LS  
Sbjct: 121 IVSNHPDFAPLAATYNVPFLHLPVTAATKQEQETRILDLVREHNIDLVVLARYMQVLSPM 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 181 LCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V H+ + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 241 VNHSLSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVFN 285


>gi|149377386|ref|ZP_01895130.1| formyltetrahydrofolate deformylase [Marinobacter algicola DG893]
 gi|149358310|gb|EDM46788.1| formyltetrahydrofolate deformylase [Marinobacter algicola DG893]
          Length = 284

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 181/281 (64%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D  T   FMR     N     +  
Sbjct: 4   TYRLVISCPDRVGIVAKVSNFLSTYNGWITEASHHSDTQTGWFFMRHEIKANSIPFGLGQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F+PI ++F++ + I ++ +  K +++ S+  HC+ DLL+RW+   +   IV V+SN
Sbjct: 64  FRTAFEPIAREFNMNWHIADSAQPKKVILMCSKESHCVADLLHRWHSREINAEIVAVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE +++P++++P+ + N+ E+  ++  +IE    ++++LARYMQIL   LC K
Sbjct: 124 HEDLRRMVEWHEIPYHHIPVNQNNRDEAFGEVDALIEGYEADVVVLARYMQILPGSLCEK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDVVR++H+
Sbjct: 184 YPGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQDVVRISHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +IED + +GK++E  VL++ + AHI+ RV   + KT+VF 
Sbjct: 244 DSIEDMVRLGKDVEKNVLSRGLRAHIEDRVITYENKTVVFD 284


>gi|325923741|ref|ZP_08185359.1| formyltetrahydrofolate deformylase [Xanthomonas gardneri ATCC
           19865]
 gi|325545779|gb|EGD17015.1| formyltetrahydrofolate deformylase [Xanthomonas gardneri ATCC
           19865]
          Length = 304

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 174/282 (61%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F      ++
Sbjct: 22  MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFNKPQATEI 81

Query: 60  F--IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F +Q+ + + +   + L+LVS+  HCLNDLL+R +   L ++I  VV
Sbjct: 82  AGLERRFALLADEFQMQWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVDIAAVV 141

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y + F++LP++   +   E +L+ ++E   ++L++LARYMQILS  LC
Sbjct: 142 SNHADFAPLAASYGIAFHHLPVSADTRAAQEAQLLALVETLQIDLVVLARYMQILSPELC 201

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 202 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 261

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA    D + +G + E+ VL +AV  H++ RV +N  +T+VF
Sbjct: 262 HAMPPRDLVRLGSDTESLVLARAVRRHVEHRVVLNGHRTVVF 303


>gi|21241098|ref|NP_640680.1| formyltetrahydrofolate deformylase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|21106396|gb|AAM35216.1| formyltetrahydrofolate deformylase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 283

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDKPAKTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L ++I  V 
Sbjct: 61  AALEQRFAVLADEFQMAWQLHDARRRARLLVLVSKQGHCLNDLLFRAHSRQLRVDIAAVA 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   + E E +L+ +++   ++L++LARYMQILS  LC
Sbjct: 121 SNHTDFAALAGSYGIAFHHLPVSADTRAEQEAQLLALVDALQIDLVVLARYMQILSPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVF 282


>gi|329928949|ref|ZP_08282759.1| formyltetrahydrofolate deformylase [Paenibacillus sp. HGF5]
 gi|328937201|gb|EGG33628.1| formyltetrahydrofolate deformylase [Paenibacillus sp. HGF5]
          Length = 299

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 114/282 (40%), Positives = 170/282 (60%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCM 57
           +   + I+CP    I + +  +L   G NI+   Q+  D      FMR+ F     NT +
Sbjct: 18  NRARMLISCPDGPGIVAAVSQFLYQHGANIVQSDQYTMDPAGGMFFMRVEFDLEDLNTKL 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F+ +  QF ++++I +     +  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 78  PQLEESFREVADQFRMEWNIYHAARKKRLAIFVSKEDHCLVELLWQWQAGDLDADIGLVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P++++P+T   K ++EQ+ +++I   +++++ILARYMQI+S    
Sbjct: 138 SNHLDMKEYVESFGIPYHHIPVTADTKPQAEQRQLDVIGD-DIDVIILARYMQIISPTFI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 DHYRNRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   + +   IG+ IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 257 HRDDVNELKRIGRTIERVVLARAVKWHVEDRILVHNNKTVVF 298


>gi|111221742|ref|YP_712536.1| formyltetrahydrofolate hydrolase [Frankia alni ACN14a]
 gi|111149274|emb|CAJ60960.1| formyltetrahydrofolate hydrolase [Frankia alni ACN14a]
          Length = 314

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT++CP    I + +  YL+  G NI D +QF D D+ + FMR+          ++ 
Sbjct: 34  EFVLTLSCPDRLGIVAAVSAYLAGVGGNIADAAQFGDPDSGRFFMRVHVAAEEAGLTLEA 93

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F  +   F++ ++I +     + LILVS+  HCLNDLLYR   G L ++I  V SN
Sbjct: 94  LRAGFARVAHPFAMDWAIHDLAVRPRVLILVSRFGHCLNDLLYRHRSGLLDVDIPAVASN 153

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     LV +Y +PF++LP+    +   EQ +  IIE+  ++L++LARYMQILS  LC  
Sbjct: 154 HPDFADLVGSYAIPFHHLPVDPTTRDRQEQGIREIIERERIDLVVLARYMQILSPELCAS 213

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSF GA PY QA+  GVK+IGATAHY   ELD GPIIEQDV+RV HA
Sbjct: 214 LAGRAINIHHSFLPSFSGARPYHQAHARGVKLIGATAHYVTAELDDGPIIEQDVIRVDHA 273

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +   A+G+++E + L +AV  H++ RV I+ R+T+VF
Sbjct: 274 DGPDRLAALGRDVECRALARAVTWHVEHRVLISGRRTVVF 313


>gi|308068043|ref|YP_003869648.1| formyltetrahydrofolate deformylase (formyl-FH(4) hydrolase)
           [Paenibacillus polymyxa E681]
 gi|305857322|gb|ADM69110.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Paenibacillus polymyxa E681]
          Length = 299

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 167/283 (59%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCM 57
           +   + ++CP    I + +  +L   G NI+   Q+  D      FMRI F     +   
Sbjct: 18  NRARMLVSCPDGPGIVATVSRFLYEHGANIVQSDQYTMDPSGGMFFMRIEFDLPNLSATQ 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                DF  + +QF ++++I       K  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 78  PQLEQDFAAVAEQFRMEWTISAVSRKKKLAIFVSKEDHCLVELLWQWQAGDLDADISLVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P++++P+T   K E+E++ + +I   +++++ILARYMQI+S    
Sbjct: 138 SNHPDMKEYVESFGIPYHHIPVTADTKPEAERRQLEVI-GEDIDVIILARYMQIISPKFI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 EHYRNRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   + +   IG+ IE  VL +AV  H + R+ +++ KT+VF 
Sbjct: 257 HGDDVNELKRIGRTIERVVLARAVKWHAEDRILVHENKTVVFN 299


>gi|85714669|ref|ZP_01045656.1| formyltetrahydrofolate deformylase [Nitrobacter sp. Nb-311A]
 gi|85698554|gb|EAQ36424.1| formyltetrahydrofolate deformylase [Nitrobacter sp. Nb-311A]
          Length = 285

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 120/285 (42%), Positives = 177/285 (62%), Gaps = 8/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNT 55
           MS   Y+LT++CP    I S +  +L+  G NI+D  QF+D +T + FMR+ F       
Sbjct: 1   MSHHQYVLTLSCPDRPGIVSAVSTFLAHNGQNIIDAQQFDDAETGRFFMRVVFNAADLAV 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +      F  I ++F + + +R+     K ++LVS+ DHCL D+LYRW    L +    
Sbjct: 61  TLPALQTGFGAIAERFRMTWQMRDRAARRKVMLLVSKSDHCLVDILYRWRTSELKMIPAA 120

Query: 116 VVSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           +VSNH        ++  +PF+YLP+T+  K   E  ++ ++ +   +L++LARYMQILS+
Sbjct: 121 IVSNHPRETFAHLDFDEIPFHYLPVTD--KASQEAAVLELVSETETDLVVLARYMQILSN 178

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +  K++GR INIHHSFLP FKGA  Y QA+E GVK+IGATAHY   +LD GPII+QDV 
Sbjct: 179 DMSAKLSGRCINIHHSFLPGFKGAKAYHQAHERGVKLIGATAHYVTSDLDEGPIIDQDVE 238

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R++H  T E  +  G++IE +VL +A+  H+  RV +N RKT+VF
Sbjct: 239 RISHRDTPEALVRKGRDIERRVLARAIRHHLDDRVILNGRKTVVF 283


>gi|237798644|ref|ZP_04587105.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021497|gb|EGI01554.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 283

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 107/282 (37%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M ++ L I CP    I + + ++L++    I + S  +D  +   FMR     +T    +
Sbjct: 1   MRTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDSLSGWFFMRHEIRADTLPFDL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F+PI ++F++ + I ++ +    +++ S+  HCL DLL+RW+   L  +I  V+
Sbjct: 61  DGFREAFKPIAEEFAMDWRITDSAQKKHVVLMASRESHCLADLLHRWHSDELDCDIACVI 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARYMQIL   LC
Sbjct: 121 SNHQDLRSMVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYMQILPPQLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+
Sbjct: 181 REYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF
Sbjct: 241 HRDSIENMVRFGRDVEKMVLARGLRAHLEDRVLVHDNKTVVF 282


>gi|190572330|ref|YP_001970175.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           K279a]
 gi|190010252|emb|CAQ43860.1| putative formyl transferase [Stenotrophomonas maltophilia K279a]
          Length = 283

 Score =  293 bits (751), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 121/277 (43%), Positives = 177/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFIA 62
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +    ++   A
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDAGLPLETVHA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               + + F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMATLAEGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+T   +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAPLAASYQVPFHHLPVTADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMAP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|220914326|ref|YP_002489635.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
 gi|219861204|gb|ACL41546.1| formyltetrahydrofolate deformylase [Arthrobacter chlorophenolicus
           A6]
          Length = 298

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 176/279 (63%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKL 59
            ++LT+ CP    I   +  +L   GC+I+D  QF +      FMR+ FV    ++ + +
Sbjct: 18  EHVLTLDCPEGPGIVHAVSGFLLEHGCDIIDNKQFGERSEGHFFMRVHFVSEGDDSTLDV 77

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+ ++F +++ +       K LI+VS+  HCLNDLL+R  IG L +++V VVSN
Sbjct: 78  LRDSFAPVAEKFGMRWQLERQGSKRKVLIMVSKFGHCLNDLLFRARIGELPVDVVAVVSN 137

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  H+ LVE + +PF+++P+T   K  +E +L+ +++  +VEL++LARYMQ+LSD L  K
Sbjct: 138 HRDHQALVEWHGIPFHHIPVTADTKPAAEAELMELVDGLDVELVVLARYMQVLSDDLTRK 197

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 198 LDGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNAELDEGPIISQQVVDVDHT 257

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              ED +A G++ E K L+ AV  H + RV +   +T+V
Sbjct: 258 YGPEDLVAAGRDTECKALSNAVKWHCEGRVILQGNRTVV 296


>gi|23016265|ref|ZP_00056023.1| COG0788: Formyltetrahydrofolate hydrolase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 286

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 183/279 (65%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LTITCP    I + +  +LST  C I + +QF D  +S+ FMRI F        M   
Sbjct: 7   WVLTITCPDTVGIVAAVSGFLSTHDCFITEAAQFGDPLSSRFFMRIVFGAGAMTPPMAEL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  + ++F + + + + ++  + +IL S+  HCLNDLL+R++ G+L + I  V+SNH
Sbjct: 67  EKLFTGVAERFQMIWKLHDCRKKARVVILASKFGHCLNDLLHRYHTGSLPIEIPAVISNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + +VE + +P++YL + + +K+  E +++ +IE+ + +L++LARYMQILS  +C ++
Sbjct: 127 QDMRSIVEWHGIPYHYLAVDKHDKLTQENRVMEVIERADADLVVLARYMQILSTDMCVRL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H  
Sbjct: 187 QGKAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTPDLDEGPIIEQGVERVDHTH 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +D +AIG++IE  VL +AV  H + RV +N  KT+VF
Sbjct: 247 TPDDLVAIGRDIENVVLARAVRWHTEHRVLLNGSKTVVF 285


>gi|253997643|ref|YP_003049707.1| formyltetrahydrofolate deformylase [Methylotenera mobilis JLW8]
 gi|253984322|gb|ACT49180.1| formyltetrahydrofolate deformylase [Methylotenera mobilis JLW8]
          Length = 284

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           ++  L ITCP  + I + I D+L     NIL   Q  D + +   MR+ + FN       
Sbjct: 3   NTATLLITCPDTKGIVAAIADFLLQHNANILHADQHQDAENNLFLMRVEWDFNGFNLDEA 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  +  +FS+Q+ ++ ++  T+  I+VSQ DHCL DLL+R   G LA  I  V+S
Sbjct: 63  SFDQAFSVVANKFSMQWQLKLSQHKTRVAIMVSQYDHCLADLLHRHKSGELACEIPLVIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + LV+ Y + F+++ +T+ NK ++E     +    +++L++LARYMQILS     
Sbjct: 123 NHRDTESLVKFYGIDFHHIQVTKDNKAQAEAAQFKLFADYDIDLIVLARYMQILSPDFVA 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   RIINIHHSFLP+F GA PY +A+E GVK+IGAT+HY    LD GPIIEQ + R++H
Sbjct: 183 RYPQRIINIHHSFLPAFIGARPYHRAFERGVKLIGATSHYVTEVLDEGPIIEQGIDRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              +ED I  G+++E  VL+KAV+ HI+ R+ +   KT++F 
Sbjct: 243 RDQVEDLIQKGRDLERVVLSKAVSWHIENRILLYANKTVIFD 284


>gi|227494745|ref|ZP_03925061.1| formyltetrahydrofolate deformylase [Actinomyces coleocanis DSM
           15436]
 gi|226831745|gb|EEH64128.1| formyltetrahydrofolate deformylase [Actinomyces coleocanis DSM
           15436]
          Length = 320

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 121/277 (43%), Positives = 164/277 (59%), Gaps = 1/277 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
             ILT++CP    I   +   +S    NI+   QF D +T   FMR+        K    
Sbjct: 44  KLILTLSCPDQPGIVYAVTRVISENSGNIIQSQQFGDPETGLFFMRVELE-TPARKQIED 102

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
                   F   + +       +T+I+VS+  HCL DLLYR     L + +V VV NH  
Sbjct: 103 GIAAFAADFDATFQLDEMGRPLRTIIMVSKEGHCLTDLLYRQRYQELGIEVVAVVGNHPD 162

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              + + Y  PF  +P+T + K E+E +L+ ++E   VEL+ILARYMQILSD LC  + G
Sbjct: 163 LAPVAQFYGKPFLCIPVTPETKAEAEAQLLALVESEKVELVILARYMQILSDKLCETLVG 222

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
            +INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RVTH ++ 
Sbjct: 223 NVINIHHSFLPSFKGARPYAQAHTRGVKLIGATAHYVTADLDEGPIIEQDVTRVTHREST 282

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +D +A G+++E +VL +AV  H Q RV +N  +T+VF
Sbjct: 283 KDLVAQGQDVERRVLAQAVKWHTQHRVLLNGHRTVVF 319


>gi|295694969|ref|YP_003588207.1| formyltetrahydrofolate deformylase [Bacillus tusciae DSM 2912]
 gi|295410571|gb|ADG05063.1| formyltetrahydrofolate deformylase [Bacillus tusciae DSM 2912]
          Length = 305

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 117/281 (41%), Positives = 170/281 (60%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NTCMK 58
              + ++CP    + + +  YL +   NI+ + Q+  D D  +LFMR+ F     +   +
Sbjct: 24  RARILLSCPDRPGVVAAVSQYLYSMNANIVRMDQYSTDPDGGRLFMRVEFDLPRLSDRRR 83

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F    +   +Q  IR  +E  +  I VS+ DHCL +LL++W  G L+ + V ++S
Sbjct: 84  ELEEGFARTARPLDMQGEIRYARERKRIAIFVSKMDHCLRELLWQWQAGDLSGDPVVIIS 143

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K +   + LPFY++P+T + K E+E + + I++   V+L++LARYMQILS     
Sbjct: 144 NHPDLKDIAATFSLPFYHVPVTRETKPEAEHRQLEILQNYQVDLVVLARYMQILSTEFVS 203

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPY++AYE GVK+IGATAHY    LD GPIIEQDV RV H
Sbjct: 204 AYPNRIINIHHSFLPAFVGANPYERAYERGVKLIGATAHYVTANLDEGPIIEQDVQRVNH 263

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++ED   IG++IE  VL +AV  H++ R+   K KT+VF
Sbjct: 264 RDSVEDLKRIGRHIERVVLARAVAWHLEDRILTYKNKTVVF 304


>gi|298491299|ref|YP_003721476.1| formyltetrahydrofolate deformylase ['Nostoc azollae' 0708]
 gi|298233217|gb|ADI64353.1| formyltetrahydrofolate deformylase ['Nostoc azollae' 0708]
          Length = 284

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 162/280 (57%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           +  L I+CP    + + I +++ + G NI+   Q  D +      RI +    FN     
Sbjct: 5   TATLLISCPDQRGLVAKIANFIYSNGGNIIHADQHTDFEAGLFLTRIEWLLEGFNLPRDF 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I Q    Q+ +  +    +  I VS  DHCL DL++R         I  ++SN
Sbjct: 65  IGTAFNAIAQPLGAQWELHFSDTVPRLAIWVSHQDHCLFDLIWRQRAKEFNAEIPLIISN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++ E + + + ++P+T+ NK E E + + I+    ++L++LA+YMQI+S      
Sbjct: 125 HPQLQEIAEQFGIQYLHIPITKDNKQEQEIRQLEILHDYKIDLVVLAKYMQIVSADFIKD 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GANPY +A+E GVKIIGATAHY   +LDAGPIIEQDVVRV+H 
Sbjct: 185 FP-RIINIHHSFLPAFIGANPYHRAFERGVKIIGATAHYTTADLDAGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++D I  GK++E  VL +AV  H+Q RV + K +T+VF
Sbjct: 244 DEVDDLIRKGKDLERVVLARAVRLHLQNRVLVYKNRTVVF 283


>gi|239787539|emb|CAX84008.1| Formyltetrahydrofolate deformylase [uncultured bacterium]
          Length = 302

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 177/278 (63%), Gaps = 3/278 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
            YILTI+CP +  I + +  +L+     I + S F D  + + FMR  F    F   + +
Sbjct: 22  HYILTISCPDSVGIVAAVSGFLAEHDAFITESSHFGDPVSRRFFMRTVFASGAFTPPIDV 81

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F+  F  I ++F + + + + +   + LI+VS+ DHCLNDLLYR+  G L + I  +VSN
Sbjct: 82  FVKTFSRIAERFQMVWGLHDARRKERLLIMVSKLDHCLNDLLYRYRTGELRVEIPAIVSN 141

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L   +++PF++LP+    K + E +++ ++++  ++L++LARYMQ+LS  +C +
Sbjct: 142 HPDLEHLAAWHEIPFHHLPIKPDTKADQESQVMALVDQLQIDLVVLARYMQVLSSRMCER 201

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKG+ PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H 
Sbjct: 202 LRGRCINIHHSFLPSFKGSRPYHQAHARGVKIIGATAHYVTMDLDEGPIIEQGVERVDHT 261

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTI 277
              ED   +G++IE  VL++AV  H++ RV +N  KT+
Sbjct: 262 FAPEDLARVGRDIENVVLSRAVRYHVEHRVLLNGSKTV 299


>gi|255943975|ref|XP_002562755.1| Pc20g01960 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587490|emb|CAP85525.1| Pc20g01960 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 287

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 124/285 (43%), Positives = 179/285 (62%), Gaps = 6/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF------VFNT 55
           +S+ILT++ P    I   +  +L     NI+D SQF D  + + FMR  F          
Sbjct: 3   ASFILTLSGPDRPGIVHAVTAFLVQNNLNIIDSSQFGDPTSQRFFMRTQFATANGEDETP 62

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            ++     F+P  Q FSL + I  + +  + LI+VS+  HCLNDLL+R + G L++ +  
Sbjct: 63  ELEKLRTAFEPTAQSFSLNFEINPSVKKPRVLIMVSKIGHCLNDLLFRQSTGQLSIEVPL 122

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           +VSNH     L   Y +PF++LP+T   K + E +++ ++ ++N++L++LARYMQ+LS  
Sbjct: 123 IVSNHPDFATLAATYNIPFHHLPVTADTKAQQEAQILELVSQHNIDLIVLARYMQVLSPT 182

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ+VVR
Sbjct: 183 LCSAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPIIEQNVVR 242

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V H  + ++    G N+E+ VL  AV    ++RV +N  KT+VF 
Sbjct: 243 VNHGMSPKELTHAGSNVESNVLATAVKYVTERRVILNGHKTVVFN 287


>gi|184201794|ref|YP_001856001.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
 gi|183582024|dbj|BAG30495.1| formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
          Length = 302

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 177/281 (62%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
              +LT+ CP    I   +   L   G NI++++Q++D      FMR+            
Sbjct: 20  RELVLTLDCPEQPGIVHAVSGVLLEHGANIVELTQYDDRRVGHFFMRVHMAPTEGAALDQ 79

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +    D  P+ ++F +++ +       + L++VS+  HCLNDLL+R   G L + IV VV
Sbjct: 80  QSLREDLTPVAERFGMRWELHEHGAKRRVLVMVSKFGHCLNDLLFRARTGELPVEIVAVV 139

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH  H++LVE + +PF+++P+T+  K E+E +L++++++  V+L++LARYMQ+LSD L 
Sbjct: 140 SNHLDHQRLVEWHGIPFFHVPVTKDTKPEAEARLLDLVDRFEVDLVVLARYMQVLSDSLA 199

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +M GR+INIHHSFLPSFKGA PY QAY+ GVK +GATAHY   ELD GPII Q VV V 
Sbjct: 200 TRMEGRVINIHHSFLPSFKGAKPYHQAYDRGVKTVGATAHYVNAELDEGPIITQQVVEVN 259

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           HA   ED +A G++ E K L+ AV  H + RV ++  KT+V
Sbjct: 260 HAYGPEDLVAAGRDTECKALSDAVRWHCEGRVILHGAKTVV 300


>gi|166368042|ref|YP_001660315.1| formyltetrahydrofolate deformylase [Microcystis aeruginosa
           NIES-843]
 gi|166090415|dbj|BAG05123.1| phosphoribosylglycinamide formyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 284

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 108/281 (38%), Positives = 165/281 (58%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L I+CP    + + I +++   G NI+   Q  D       MRI +    FN    
Sbjct: 4   TTATLLISCPDQIGLVAKIANFIYANGGNIIHADQHTDFSAGLFLMRIEWQLEGFNLPRG 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  I +     +S+  +    +  I V++ DHCL DLL+R + G +   I  ++S
Sbjct: 64  MIEPAFAAIAKPLQASWSLHFSDTVPRLAIWVTKQDHCLLDLLWRQHGGEIRAEIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     +   + + F+++P+T + KIE E + + ++ +  ++L+ILA+YMQ+L+    +
Sbjct: 124 NHPELHSVANQFGIEFHHIPITAETKIEQEARQLELLREYRIDLVILAKYMQVLTPDFIN 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
                IINIHHSFLP+F GANPY++AY+ GVKIIGATAHY   +LD GPIIEQDVVRV+H
Sbjct: 184 FFP-NIINIHHSFLPAFAGANPYQRAYDRGVKIIGATAHYITADLDQGPIIEQDVVRVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 243 RDTVGDLIRQGKDLERVVLARAVRLHLQNRVLVYANRTVVF 283


>gi|329896277|ref|ZP_08271433.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC3088]
 gi|328921882|gb|EGG29250.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC3088]
          Length = 286

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 132/281 (46%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRIS--FVFNT-CMK 58
           +S+ LT TCP++  I + +  YLS QGC + ++ QF+D DT + F+R    F  NT  + 
Sbjct: 5   TSFTLTATCPASSGIVAAVTSYLSDQGCYLSELHQFDDEDTGRFFLRTVGRFEVNTISLD 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+ +  S++++  +T    KTLI+VS+ DHCL DLLYR     L ++I  VVS
Sbjct: 65  TLRTGFAPVAKTLSMEWAFHDTLAPMKTLIMVSKFDHCLEDLLYRVRKKELTIDITAVVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L E   + F +LP+T  NK + EQ L++I+ +   EL++LARYMQILSD LC 
Sbjct: 125 NHKDCRALAEREGIRFVHLPVTPDNKAQQEQALLDIVSETQTELVVLARYMQILSDDLCQ 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ V  V H
Sbjct: 185 SLKGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTADLDEGPIIEQSVQPVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T E  +A+G++ E   L +AV  H + RVF++  KT++F
Sbjct: 245 TYTPEQLVAVGRDTETMALARAVKLHSEHRVFLDGNKTVIF 285


>gi|126660953|ref|ZP_01732042.1| formyltetrahydrofolate deformylase [Cyanothece sp. CCY0110]
 gi|126617771|gb|EAZ88551.1| formyltetrahydrofolate deformylase [Cyanothece sp. CCY0110]
          Length = 284

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 108/281 (38%), Positives = 164/281 (58%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           S+  L I+CP  + + +   +++   G NI+   Q  D +      RI +  N       
Sbjct: 4   STATLLISCPDQQGLVAKFANFIYDNGGNIIHADQHTDFEAGLFLTRIEWQLNGFKLSRD 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +  + F  + +     + I  +    +  + V++ DHCL DLL+RW    +  +I  ++S
Sbjct: 64  MIPSAFASVAKPLQAVWEIHFSDTIPRLALFVTKQDHCLLDLLWRWQAKEIRADIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K + E + + FYYLP+T++ K + E + + I+ ++ + L+ILA+YMQIL+    +
Sbjct: 124 NHEKLKAIAEQFNIDFYYLPITKETKNQQEARQLEILRQHRINLVILAKYMQILTPEFIN 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
                IINIHHSFLP+F GA PY +A+E GVKIIGATAHY   +LD GPIIEQDVV+V+H
Sbjct: 184 HFAH-IINIHHSFLPAFAGAKPYHRAHERGVKIIGATAHYVTADLDEGPIIEQDVVKVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             TI D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 243 RDTIPDLIRKGKDLERVVLARAVRLHVQNRVLVYGNRTVVF 283


>gi|256831930|ref|YP_003160657.1| formyltetrahydrofolate deformylase [Jonesia denitrificans DSM
           20603]
 gi|256685461|gb|ACV08354.1| formyltetrahydrofolate deformylase [Jonesia denitrificans DSM
           20603]
          Length = 286

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 116/277 (41%), Positives = 175/277 (63%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
            ++LT++CP    I   +   ++  G NI +  QF D DT   FMR+           +A
Sbjct: 9   HWVLTLSCPDRPGIVRAVAGAIADHGGNITESKQFGDPDTGLFFMRVQGETTIARDTLLA 68

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
              P+ +QF   +++        T+I+VS+  H LNDLL++     L + +V VV NH  
Sbjct: 69  TLTPLAEQFEWTWNLDTVGRRIPTIIMVSKAAHALNDLLFQQRAARLPIEVVAVVGNHND 128

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L   Y +PF+++P+T   K ++E +L+ +++    EL++LARYMQ+LSD LC  + G
Sbjct: 129 LADLATFYGVPFHHIPVTADTKPQAEAELLALVQSTGAELVVLARYMQVLSDTLCRALEG 188

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R+INIHHSFLPSFKGA PY +A++ GVK+IGAT+HY   +LD GPIIEQD+ RV H  ++
Sbjct: 189 RVINIHHSFLPSFKGARPYHRAHDRGVKLIGATSHYVTADLDEGPIIEQDIDRVDHEMSV 248

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           E++IA+G+++E +VL++AV  H Q RV +N  KT+VF
Sbjct: 249 EEFIALGQDVERRVLSRAVAWHAQHRVLMNGHKTVVF 285


>gi|120553948|ref|YP_958299.1| formyltetrahydrofolate deformylase [Marinobacter aquaeolei VT8]
 gi|120323797|gb|ABM18112.1| formyltetrahydrofolate deformylase [Marinobacter aquaeolei VT8]
          Length = 284

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 112/281 (39%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D      FMR           +  
Sbjct: 4   TYRLVISCPDRVGIVAKVSNFLSTYNGWITEASHHSDTQAGWFFMRHEIKAESIPFGLDQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F+PI ++F++ + I ++    + +++ S+  HCL DLL+RW+   L   IV V+SN
Sbjct: 64  FRAAFEPIAREFNMNWHIADSARPKRVILMCSKESHCLADLLHRWHSKELNCEIVAVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE +++P++++P++++NK E+   +  + ++   ++++LARYMQIL   LC K
Sbjct: 124 HDDLRRMVEWHEIPYHHVPVSKENKAEAFAHIDELFQQYETDVVVLARYMQILPAELCGK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
            +G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R++H+
Sbjct: 184 YSGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQDVIRISHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +IED + +GK++E  VL + + +HI+ RV   + KT+VF 
Sbjct: 244 DSIEDMVRLGKDVEKNVLARGLRSHIEDRVITYENKTVVFD 284


>gi|116695892|ref|YP_841468.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
 gi|113530391|emb|CAJ96738.1| formyltetrahydrofolate deformylase [Ralstonia eutropha H16]
          Length = 306

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 121/289 (41%), Positives = 174/289 (60%), Gaps = 11/289 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--------VF 53
           +SYILT++CP    I   +   L   G NI+D +QF D D+++ FMR+ F          
Sbjct: 17  ASYILTLSCPDRPGIVHAVSALLVEAGANIVDSAQFGDRDSARFFMRVHFQRPLPEGQDA 76

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +    +    +     + +S+ +     + +++VS+  HCLNDLL+R+  G L + I
Sbjct: 77  GDALAALRSTLAGVAAAHEMDWSLHDAARKPRVMLMVSRIGHCLNDLLFRYRTGQLPIEI 136

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLP---MTEQNKIESEQKLINIIEKNNVELMILARYMQ 170
             +VSNH    +L  +Y +PF++LP    T Q K   E +L +++   +++L++LARYMQ
Sbjct: 137 PAIVSNHKDFYQLAASYDIPFHHLPLLNATPQGKAAQEARLWDLVCDYSIDLVVLARYMQ 196

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           +LSD LC ++ GR INIHHSFLPSFKGA PY QAYE GVK+IGATAHY   +LD GPIIE
Sbjct: 197 VLSDDLCRRLEGRAINIHHSFLPSFKGARPYAQAYERGVKLIGATAHYVTGDLDEGPIIE 256

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           Q+V RV HA       AIG+++E   L +AV  H + RV  N  +T+VF
Sbjct: 257 QEVARVDHAMDAAQLTAIGRDVECVALARAVKWHAEHRVLRNGGRTLVF 305


>gi|78186355|ref|YP_374398.1| formyltetrahydrofolate deformylase [Chlorobium luteolum DSM 273]
 gi|78166257|gb|ABB23355.1| formyltetrahydrofolate deformylase [Chlorobium luteolum DSM 273]
          Length = 293

 Score =  292 bits (748), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 112/281 (39%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           + IL ++C     + S I  ++  +G NI+D+ +  D      F+R+S+  +     +  
Sbjct: 13  TAILLLSCRDRRGLVSRISHFIYERGGNIIDLDEHVDAGEGMFFIRVSWSTDRLTIPVSA 72

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+P+  +F   ++IR T   T+  I VS+ DHCL +LL+R+++G  +  I  V+SN
Sbjct: 73  LEDAFRPLGTEFEASWNIRFTGRPTRFAIFVSRYDHCLQELLWRYSMGEFSAEIPLVISN 132

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L  +Y +PF+   +T   + + E +   +++ N+++ ++LARYMQ+LS     +
Sbjct: 133 HPDLEPLAAHYGIPFHQFRVTADTRADVEAEQQALLDANDIDAIVLARYMQVLSPSFARR 192

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GR INIHHSFLP+F G NPY+QAYE GVKIIGAT HY   ELD GPIIEQD++RVTH 
Sbjct: 193 WHGRAINIHHSFLPAFVGGNPYRQAYERGVKIIGATCHYVTEELDQGPIIEQDIMRVTHR 252

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T++  I  G+++E  VL +AV  H + R+ +N RKTIVF 
Sbjct: 253 DTLQGLIRRGRDLERMVLARAVRLHAEHRILLNGRKTIVFD 293


>gi|319789801|ref|YP_004151434.1| formyltetrahydrofolate deformylase [Thermovibrio ammonificans HB-1]
 gi|317114303|gb|ADU96793.1| formyltetrahydrofolate deformylase [Thermovibrio ammonificans HB-1]
          Length = 284

 Score =  292 bits (748), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 177/280 (63%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP  + I + +  +++  G NIL   Q  D   S  FMRI +    F      
Sbjct: 4   TATLLISCPDRKGILAEVTGFIARNGGNILHADQHIDFQKSIFFMRIEWDLSGFKIPKGE 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI QQF + Y +  + E  +  I VS+ DHCL +LLYR+  G L   +V V+SN
Sbjct: 64  IEKAFRPIAQQFKMNYQLHFSSEVKRVAIFVSKYDHCLYELLYRFKAGELKGELVTVISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + +VE + +PF Y P + +NK E+E++ I I+E+  ++L++LARYMQILSD   ++
Sbjct: 124 HRDLQPVVEMFGVPFVYSPKSRENKREAEEREIEILEREGIDLIVLARYMQILSDRFVNR 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY +AYE GVKIIGAT+HY   ELD GPIIEQDVVRVTH 
Sbjct: 184 FRNRIINIHHSFLPAFVGAKPYHRAYERGVKIIGATSHYVTEELDQGPIIEQDVVRVTHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ED I  G+++E  VL +AV  H++ +V +   KT++F
Sbjct: 244 DSVEDMIRKGRDLEKLVLARAVKWHLENKVLVYDNKTVIF 283


>gi|171318653|ref|ZP_02907799.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
 gi|171096161|gb|EDT41084.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MEX-5]
          Length = 294

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 118/293 (40%), Positives = 184/293 (62%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC- 56
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F  +   
Sbjct: 1   MSTDHSFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADG 60

Query: 57  ------MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
                 +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 61  ADATSALDTLRQEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 120

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LA
Sbjct: 121 IEIPAIVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLA 180

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 181 RYMQILSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 240

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|189909413|gb|ACE60614.1| YkkE [Halobacillus aidingensis]
          Length = 298

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 177/280 (63%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFN---TCMK 58
              L ++CP    I S I  +L   G NI++ +QF  D +    F+RI F      +  K
Sbjct: 18  KARLLVSCPDKPGIVSSISTFLYEHGANIVESNQFTTDHEEGTFFLRIVFAAENMKSIEK 77

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              ADF  + +QF + + +    E  +T + VS+  HCL +LLY W  G L  +I  V+S
Sbjct: 78  TMKADFHSLAEQFEMTWRMTFLHELKRTAVFVSKELHCLRELLYEWESGDLVTDISLVIS 137

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH + +++VE++ +PFYY+P  ++ + E E+K ++++E+ N++L+ILARYMQIL+     
Sbjct: 138 NHESAREIVESFGIPFYYIPANKEIREEVEEKQLDLLEEYNIDLIILARYMQILTPKFVD 197

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   +IINIHHSFLP+F GANP+K+AY+ GVK+IGAT+HY   +LD GPIIEQDV+RV H
Sbjct: 198 RHPSKIINIHHSFLPAFIGANPHKRAYKRGVKLIGATSHYVTDDLDEGPIIEQDVIRVDH 257

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
             ++ D    G+ IE  VL +AV   ++ RV ++K KTIV
Sbjct: 258 RNSVNDLKKKGRLIERSVLNRAVKWALEDRVIVHKNKTIV 297


>gi|134296977|ref|YP_001120712.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
 gi|134140134|gb|ABO55877.1| formyltetrahydrofolate deformylase [Burkholderia vietnamiensis G4]
          Length = 294

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 117/293 (39%), Positives = 183/293 (62%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC- 56
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  + + FMR+ F  +   
Sbjct: 1   MSTDHSFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRSGEFFMRVHFEQDADG 60

Query: 57  ------MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
                 +     +F P+ +QF +++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 61  VDATAALDTLRREFAPLAEQFEMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 120

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LA
Sbjct: 121 IEIPAIVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLA 180

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 181 RYMQILSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 240

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|161620961|ref|YP_001594847.1| formyltetrahydrofolate deformylase [Brucella canis ATCC 23365]
 gi|260567837|ref|ZP_05838306.1| formyl transferase [Brucella suis bv. 4 str. 40]
 gi|161337772|gb|ABX64076.1| formyltetrahydrofolate deformylase [Brucella canis ATCC 23365]
 gi|260154502|gb|EEW89583.1| formyl transferase [Brucella suis bv. 4 str. 40]
          Length = 294

 Score =  292 bits (747), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 210/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL +LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELEVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|194363991|ref|YP_002026601.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           R551-3]
 gi|194346795|gb|ACF49918.1| formyltetrahydrofolate deformylase [Stenotrophomonas maltophilia
           R551-3]
          Length = 283

 Score =  292 bits (747), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 121/277 (43%), Positives = 176/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFIA 62
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +    ++   A
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDAGLPLETVHA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               +   F + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMATLAAGFGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+T   +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAALAASYQVPFHHLPVTADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMVP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|119472136|ref|XP_001258279.1| formyltetrahydrofolate deformylase, putative [Neosartorya fischeri
           NRRL 181]
 gi|119406431|gb|EAW16382.1| formyltetrahydrofolate deformylase, putative [Neosartorya fischeri
           NRRL 181]
          Length = 292

 Score =  292 bits (747), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 124/291 (42%), Positives = 181/291 (62%), Gaps = 12/291 (4%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--------- 51
           M S+ILT++CP    I   +  +L  +  NI+D SQF D  + + FMR+ F         
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA 60

Query: 52  ---VFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGT 108
                   ++   A F+P  +  ++ ++I    +  + LI+VS+  HCLNDLL+R + G 
Sbjct: 61  TDEHPKLSVEELRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ 120

Query: 109 LALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARY 168
           LA+ +  +VSNH     L   Y +PF +LP+T   K + E +++ ++ ++ ++L++LARY
Sbjct: 121 LAIEVPLIVSNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY 180

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQ+LS  LC  M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPI
Sbjct: 181 MQVLSPMLCEAMSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI 240

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQ+VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 291


>gi|62317264|ref|YP_223117.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 1 str.
           9-941]
 gi|83269245|ref|YP_418536.1| formyltetrahydrofolate deformylase [Brucella melitensis biovar
           Abortus 2308]
 gi|189022525|ref|YP_001932266.1| formyltetrahydrofolate deformylase [Brucella abortus S19]
 gi|237816825|ref|ZP_04595817.1| formyltetrahydrofolate deformylase [Brucella abortus str. 2308 A]
 gi|254690771|ref|ZP_05154025.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|254698550|ref|ZP_05160378.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731998|ref|ZP_05190576.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|256255954|ref|ZP_05461490.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|260544502|ref|ZP_05820323.1| formyl transferase [Brucella abortus NCTC 8038]
 gi|260756343|ref|ZP_05868691.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|260759771|ref|ZP_05872119.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|260763010|ref|ZP_05875342.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882167|ref|ZP_05893781.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|297249312|ref|ZP_06933013.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 5 str.
           B3196]
 gi|62197457|gb|AAX75756.1| PurU, formyltetrahydrofolate deformylase [Brucella abortus bv. 1
           str. 9-941]
 gi|82939519|emb|CAJ12492.1| Formyl transferase, N-terminal:Amino acid-binding
           ACT:Formyltetrahydrofolate deformylase [Brucella
           melitensis biovar Abortus 2308]
 gi|189021099|gb|ACD73820.1| Formyl transferase, N-terminal [Brucella abortus S19]
 gi|237787638|gb|EEP61854.1| formyltetrahydrofolate deformylase [Brucella abortus str. 2308 A]
 gi|260097773|gb|EEW81647.1| formyl transferase [Brucella abortus NCTC 8038]
 gi|260670089|gb|EEX57029.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 4 str.
           292]
 gi|260673431|gb|EEX60252.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676451|gb|EEX63272.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 6 str.
           870]
 gi|260871695|gb|EEX78764.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 9 str.
           C68]
 gi|297173181|gb|EFH32545.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 5 str.
           B3196]
          Length = 294

 Score =  292 bits (747), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|317124555|ref|YP_004098667.1| formyltetrahydrofolate deformylase [Intrasporangium calvum DSM
           43043]
 gi|315588643|gb|ADU47940.1| formyltetrahydrofolate deformylase [Intrasporangium calvum DSM
           43043]
          Length = 280

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 136/280 (48%), Positives = 186/280 (66%), Gaps = 1/280 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM-KL 59
           M+ +I+T+TC     I + +   L     NI++  QF+D DT+  FMR  F       + 
Sbjct: 1   MARHIMTLTCDDRPGIVAAVSTALLDVNANIVENQQFSDEDTNLFFMRTVFDAAQDEVQT 60

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +              ++R   E  +TLILVS+ DHCL DLLYRW  G L ++IVGVVSN
Sbjct: 61  VLDAIDRSAAVEHQHLAVRPADERCRTLILVSRFDHCLLDLLYRWKSGDLPIDIVGVVSN 120

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + LVE Y +PF +LP+T++ K  +E +L+ ++   +V L++LARYMQILSD LC +
Sbjct: 121 HEDTRGLVEYYGVPFTHLPVTKETKAAAEAELLRLVAAQDVGLVVLARYMQILSDDLCQQ 180

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+E GVK+IGA+AHY   +LD GPIIEQDVVRVTHA
Sbjct: 181 LAGRAINIHHSFLPGFKGAKPYHQAHERGVKLIGASAHYVTGDLDEGPIIEQDVVRVTHA 240

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +T E  +AIG+++E +VL++AV  H + RVF++ R+TIVF
Sbjct: 241 ETPERLVAIGRDVERRVLSRAVRDHAESRVFLSGRRTIVF 280


>gi|306846119|ref|ZP_07478681.1| formyltetrahydrofolate deformylase [Brucella sp. BO1]
 gi|306273370|gb|EFM55231.1| formyltetrahydrofolate deformylase [Brucella sp. BO1]
          Length = 294

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 154/288 (53%), Positives = 211/288 (73%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTHGIVAAISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|114321248|ref|YP_742931.1| formyltetrahydrofolate deformylase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114227642|gb|ABI57441.1| formyltetrahydrofolate deformylase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 289

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 167/283 (59%), Gaps = 4/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
            + IL I CP    I + I  +LS  G NI+D+ Q  D++    FMR  +    F     
Sbjct: 7   RTAILLIHCPDRRGIVAAISRFLSEHGGNIVDLDQHVDVEQGVFFMRAEWELKGFALPAD 66

Query: 59  LFIADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F+  + + F + + +  + E  +  + VS+  HCL DLL RW  G LA++I  ++
Sbjct: 67  GIAEAFRRQLAEPFEMTWRLHFSDERPRMALFVSRLAHCLYDLLARWQTGELAVDIPLII 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E + + +Y+LP+T   K + E++  +++ +  V+  +LARYMQILS    
Sbjct: 127 SNHPDLRPVAERFGIDYYHLPVTPDTKAKVERQQNDLLAEYRVDFAVLARYMQILSADFI 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
           H    RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   +LDAGPIIEQDV RVT
Sbjct: 187 HAWPERIINIHHSFLPAFAGARPYHAAHERGVKIIGATSHYVTEDLDAGPIIEQDVTRVT 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   + D +  G+++E  VL +AV  H+Q++  + + +T+VF 
Sbjct: 247 HRDAVSDLVRKGRDLEQLVLARAVWLHVQRKTLVYQNRTVVFD 289


>gi|85090213|ref|XP_958310.1| formyltetrahydrofolate deformylase [Neurospora crassa OR74A]
 gi|28919659|gb|EAA29074.1| formyltetrahydrofolate deformylase [Neurospora crassa OR74A]
          Length = 287

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 128/280 (45%), Positives = 183/280 (65%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           + +ILT++CP    I   +    + QG NILD+ QF+D  + K FMR+ F        + 
Sbjct: 7   NDHILTLSCPDKPGIVHAVTGVFAQQGHNILDLQQFSDPVSEKFFMRVHFGPTPTPSTEH 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            I  F  +   + ++Y IR   + T+ LI+VS+  HCLNDLL+R   G L ++I  +VSN
Sbjct: 67  LIEPFNKLATDYQMEYKIRPVAQKTRVLIMVSKIGHCLNDLLFRAKTGQLPIDIPLIVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + L ++Y + F++LP+T+  K + E +++ + +++ +EL++LARYMQ+LS  LC  
Sbjct: 127 HPTFEPLAQSYGIEFHHLPVTKDTKAQQESQVLELAKQHGIELIVLARYMQVLSPTLCEA 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H 
Sbjct: 187 MSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVTRVDHG 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              E  +  G N+E++VL  AV  + +QR+F+N  KT+VF
Sbjct: 247 MGPERLVDEGSNVESQVLAAAVKWYAEQRLFLNNGKTVVF 286


>gi|325961656|ref|YP_004239562.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323467743|gb|ADX71428.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 298

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 121/279 (43%), Positives = 177/279 (63%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT+ C  +  I   +  +L   GC+I+D  QF +      FMR+ F  +     +  
Sbjct: 18  EHVLTLDCSESPGIVHAVSGFLLEHGCDIIDNQQFGERSEGHFFMRVHFASDGDASTVDT 77

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F P+ ++F +++ +       K LI+VS+  HCLNDLL+R  IG L +++V VVSN
Sbjct: 78  LRAAFGPVAERFGMRWRLERQGSKRKVLIMVSKFGHCLNDLLFRARIGELPMDVVAVVSN 137

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT H+ LVE + +PF+++P+T + K  +E +L+ ++++ +VEL++LARYMQ+LSD+L  K
Sbjct: 138 HTDHQALVEWHGIPFFHVPVTPETKPAAEARLLELVDEFDVELVVLARYMQVLSDNLTRK 197

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q  V V H 
Sbjct: 198 LDGKAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNAELDEGPIIAQQTVEVNHT 257

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              ED +A G++ E K L+ AV  H + RV +   +T+V
Sbjct: 258 YGPEDLVAAGRDTECKALSNAVRWHCEGRVILQGNRTVV 296


>gi|332531082|ref|ZP_08406999.1| formyltetrahydrofolate deformylase [Hylemonella gracilis ATCC
           19624]
 gi|332039467|gb|EGI75876.1| formyltetrahydrofolate deformylase [Hylemonella gracilis ATCC
           19624]
          Length = 282

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 132/281 (46%), Positives = 187/281 (66%), Gaps = 2/281 (0%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMK 58
           MS+ YILT +CP    +   +  +L  +G NI + +Q+ND DT   FMR+ F        
Sbjct: 1   MSAAYILTFSCPDRLGLVHAVSGFLLERGGNIEEAAQYNDPDTGLFFMRVRFSCGQVSYP 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A  +   + F +Q+ +   +   +TLI VS+  HCLNDLL+RW IG L ++I  +VS
Sbjct: 61  DLQAQLKAFAEPFQMQWRLNPAETKVRTLIFVSKEGHCLNDLLFRWKIGLLPIDIRAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K E+E K   I++  N EL++LARYMQ+LSD LC 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKAEAEAKQFEIVQAENAELVVLARYMQVLSDDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K++G+ INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H
Sbjct: 181 KLSGKAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++T+ED+ AIG++ E++VL +AV  H + RV +N  KT++F
Sbjct: 241 SKTVEDFTAIGRDTESQVLARAVKWHSEHRVILNGHKTVIF 281


>gi|83312671|ref|YP_422935.1| formyltetrahydrofolate hydrolase [Magnetospirillum magneticum
           AMB-1]
 gi|82947512|dbj|BAE52376.1| Formyltetrahydrofolate hydrolase [Magnetospirillum magneticum
           AMB-1]
          Length = 286

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 125/279 (44%), Positives = 183/279 (65%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           ++LTITCP    I + +  +LST  C I + +QF D  +S+ FMRI F        M   
Sbjct: 7   WVLTITCPDTVGIVAAVSGFLSTHDCFITEAAQFGDPLSSRFFMRIVFGAGAMTPPMAEL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  +  QF + + + + ++  + +ILVS+  HCLNDLL+R++ G+L + I  V+SNH
Sbjct: 67  EKLFTGVAAQFQMIWKLHDGRQKARVVILVSKFGHCLNDLLHRYHTGSLPIEIPAVISNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + +VE + +P++YL + + +K+  E +++ +IE+ + +L++LARYMQILS  +C ++
Sbjct: 127 QEMRSIVEWHGIPYHYLAVDKHDKLTQENRVMEVIERADADLVVLARYMQILSTDMCVRL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQ V RV H  
Sbjct: 187 QGKAINIHHSFLPSFKGAKPYHQAHSRGVKIIGATAHYVTPDLDEGPIIEQGVERVDHTH 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +D +AIG++IE  VL +AV  H + RV +N  KT+VF
Sbjct: 247 TPDDLVAIGRDIENVVLARAVRWHTEHRVLLNGSKTVVF 285


>gi|254695924|ref|ZP_05157752.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216351|ref|ZP_05930632.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260917958|gb|EEX84819.1| formyltetrahydrofolate deformylase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 294

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 153/288 (53%), Positives = 210/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLDT + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTRGIVATISGYLAGKGCNIIDSAQFDDLDTGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW I  L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIDALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|162138522|ref|YP_485198.2| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 287

 Score =  291 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    IT+ +  +L   G N+LD  Q+ND ++   FMR+ F        +  
Sbjct: 5   QYVLTLSCPDRVGITAAVTTFLFENGQNVLDAQQYNDTESGHFFMRVVFNAADRVVPLAE 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F++ + +R+     + ++LVSQ DHCL D+LYRW I  L +    +VSN
Sbjct: 65  LRTGFSAIALKFTMGWHMRDRSTRRRVMLLVSQSDHCLADILYRWRIDELQMIPTAIVSN 124

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY+LP+T+  + + E  +  +I +   +L++LARYMQILSD +  
Sbjct: 125 HPRDTFSGFDFGEIPFYHLPVTKDTRRQQEAAITALIAQTKTDLVVLARYMQILSDEMAG 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 185 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSTLDEGPIIDQDVERISH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL +A++ H+  RV +N RKT+VF
Sbjct: 245 RDTPADLVRKGRDIERRVLARAMHYHLDDRVILNGRKTVVF 285


>gi|70992393|ref|XP_751045.1| formyltetrahydrofolate deformylase [Aspergillus fumigatus Af293]
 gi|66848678|gb|EAL89007.1| formyltetrahydrofolate deformylase, putative [Aspergillus fumigatus
           Af293]
 gi|159124616|gb|EDP49734.1| formyltetrahydrofolate deformylase, putative [Aspergillus fumigatus
           A1163]
          Length = 292

 Score =  291 bits (746), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 122/291 (41%), Positives = 181/291 (62%), Gaps = 12/291 (4%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--------- 51
           M S+ILT++CP    I   +  +L  +  NI+D SQF D  + + FMR+ F         
Sbjct: 1   MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA 60

Query: 52  ---VFNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGT 108
                   ++   A F+P  +  ++ ++I    +  + LI+VS+  HCLNDLL+R + G 
Sbjct: 61  TEEHPKLSVEDLRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ 120

Query: 109 LALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARY 168
           LA+ +  ++SNH     L   Y +PF +LP+T   K + E +++ ++ ++ ++L++LARY
Sbjct: 121 LAIEVPLIISNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY 180

Query: 169 MQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPI 228
           MQ+LS  LC  ++GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPI
Sbjct: 181 MQVLSPMLCEALSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI 240

Query: 229 IEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IEQ+VVRV HA + ++    G N+E+ VL  AV    ++RV +N  KT+VF
Sbjct: 241 IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVF 291


>gi|159186111|ref|NP_356339.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
 gi|159141245|gb|AAK89124.2| formyltetrahydrofolate deformylase [Agrobacterium tumefaciens str.
           C58]
          Length = 294

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 143/288 (49%), Positives = 206/288 (71%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M++YI+ ++CP+   I + +  YL+  GCNI D SQF D +T++ FMR+SF+    +  +
Sbjct: 1   MNTYIMKVSCPARSGIVAAVSGYLARSGCNINDSSQFTDQETARFFMRLSFISEQGSGRE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +  F  +   F + Y I +  +  K +I+VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  ALLDGFGSVAADFDMDYDIHDLSQKKKIVIMVSRFGHCLNDLLYRSRIGALPVEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+++ +T + K E+E  ++ ++     EL++LARYMQ+LSD LC 
Sbjct: 121 NHLDYQKQVVNEDIPFHHIRVTPETKPEAEGAILQVVRDTGAELVVLARYMQVLSDQLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +M+GRIINIHHSFLPSFKGANPYKQAYE GV++IGATAHY   +LD GPIIEQD +RVTH
Sbjct: 181 EMSGRIINIHHSFLPSFKGANPYKQAYERGVRLIGATAHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+  DY+++G+++E++VL +A++AHI QRVF+N  KT+VFPA P  +
Sbjct: 241 AQSGMDYVSLGRDVESQVLARAIHAHIHQRVFLNGNKTVVFPASPGEH 288


>gi|322383925|ref|ZP_08057655.1| formyltetrahydrofolate deformylase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321151402|gb|EFX44589.1| formyltetrahydrofolate deformylase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 291

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 110/277 (39%), Positives = 164/277 (59%), Gaps = 5/277 (1%)

Query: 7   TITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNT---CMKLFIA 62
            I+CP    I + +  +L  QG NI+   Q+  D      F+RI F          +   
Sbjct: 16  LISCPDQPGIVAAVSRFLYEQGANIIQSDQYTMDPSGGMFFIRIEFDLPDLGSRRSVLEQ 75

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           DF     +F +Q+ +    E  +  + VS+ DHCL +LL+ W  G L  +I  V+SNH  
Sbjct: 76  DFAEAASRFDMQWKLFVASEKKRLALFVSKEDHCLLELLWHWRAGDLDADIAMVISNHPD 135

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            ++LV  + +P++++P+ +  K E+EQK + +++    ++++LARYMQI+S         
Sbjct: 136 MEELVLPFGIPYFHVPVIKGKKEEAEQKHLELLDG-KADVIVLARYMQIISPAFIDHYKN 194

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLP+F G  PY QA+E GVK+IGATAHY   ELD GPIIEQDV RV+H   +
Sbjct: 195 KIINIHHSFLPAFVGGKPYAQAHERGVKLIGATAHYVTEELDGGPIIEQDVQRVSHRDNV 254

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED   IG++IE  VL +AV  H++ R+ ++  KT+VF
Sbjct: 255 EDLKRIGRHIERIVLARAVKWHVEDRILVHGNKTVVF 291


>gi|167561509|ref|ZP_02354425.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           EO147]
 gi|167568738|ref|ZP_02361612.1| formyltetrahydrofolate deformylase [Burkholderia oklahomensis
           C6786]
          Length = 293

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 184/287 (64%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +   L  +G NILD +QF D  T + FMR+ F         T 
Sbjct: 6   SFILKLSCPDRRGIVHAVSGVLFDRGSNILDSAQFGDSRTGEFFMRVHFDQAGGGDAATA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P     +   K   E +++ +I++++ +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHSADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|291612543|ref|YP_003522700.1| formyltetrahydrofolate deformylase [Sideroxydans lithotrophicus
           ES-1]
 gi|291582655|gb|ADE10313.1| formyltetrahydrofolate deformylase [Sideroxydans lithotrophicus
           ES-1]
          Length = 284

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 119/285 (41%), Positives = 174/285 (61%), Gaps = 8/285 (2%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--- 54
           MSS   Y LTI+CP    I + +  +++  G  I++ S   + + S+ FMR     +   
Sbjct: 1   MSSTHRYTLTISCPDRAGIIAAVSGFIAQHGGFIVEASYHTEQEASRFFMRQEIRADSLP 60

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                F   F P+ Q+F + + + ++ +  + +ILVS+ DHCLNDLL+RW  G L ++I 
Sbjct: 61  FDANEFRHRFAPLAQEFGMDWQLADSAQKKRLVILVSKQDHCLNDLLHRWRSGELQVDIP 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            V+SNH   +  VE + +PF ++ M  Q+K  + + +    E+   + M+LAR+MQIL  
Sbjct: 121 CVISNHEDLRSFVEWHGIPFVHIDM--QDKAAAFELIAARFEQYRGDCMVLARFMQILPP 178

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC +  GR+INIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD V
Sbjct: 179 ALCRRFPGRVINIHHSFLPSFVGAKPYHQAYLRGVKLIGATCHYVTEELDAGPIIEQDTV 238

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R+ H  T++D +  G++IE  VL++ +  H++ RV +   KTIVF
Sbjct: 239 RIDHGDTVDDLVRYGRDIEKTVLSRGLRYHVEDRVLVCGNKTIVF 283


>gi|116619300|ref|YP_821456.1| formyltetrahydrofolate deformylase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116222462|gb|ABJ81171.1| formyltetrahydrofolate deformylase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 282

 Score =  291 bits (746), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 103/279 (36%), Positives = 162/279 (58%), Gaps = 1/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLFI 61
           + +L I  P  + + + +   L   G NI    Q  D D    FMR+ +  +   +  F 
Sbjct: 4   TAVLLIDAPDRKGLVASVAGLLYRHGANITHADQHQDPDAGLFFMRVEWTLDGFDLDAFQ 63

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            DF+ +  +  L++ +    E  +  + VSQ  HCL+DLLYR   G LA +I  ++ NH 
Sbjct: 64  RDFRGLAAELELRWRLERMSERPRVAVFVSQHLHCLSDLLYRRAAGELACDIPLIIGNHP 123

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L   + + F+++P++   K  SEQ+ + ++ ++ V++++LARYMQILS     +  
Sbjct: 124 EAEALARFHNIAFHHIPVSAATKAASEQEQLRLLREDGVQIVVLARYMQILSPDFVREFP 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            R+IN+HHSFLP+F GA PY  A+  GVK+IGAT+HY    LD GPIIEQDVVR++H   
Sbjct: 184 LRMINVHHSFLPAFVGARPYHAAFRRGVKLIGATSHYVTDTLDEGPIIEQDVVRISHRDQ 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           + D I  G+++E  VL++A+  H++ RV     KT+VF 
Sbjct: 244 VPDLIQKGRDLERVVLSRALRWHLEHRVLCYGNKTVVFD 282


>gi|116672241|ref|YP_833174.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116612350|gb|ABK05074.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 303

 Score =  291 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 122/279 (43%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KL 59
            ++LT+ C  +  I   +  +L   GC+I+D  QF +      FMR+ F  +      + 
Sbjct: 23  EHVLTLDCNESPGIVHAVSGFLLEHGCDIIDNQQFGERSEGHFFMRVHFASDGDASTAET 82

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F P+ ++F + + +       + LI+VS+  HCLNDLL+R  IG L +++V VVSN
Sbjct: 83  LRAAFAPVAERFGMSWRLEPHGSKRRVLIMVSKFGHCLNDLLFRARIGELPVDVVAVVSN 142

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           HT H+ LV  + +PF+++P+T   K E+E +L+ ++++ +VEL++LARYMQ+LSD L  K
Sbjct: 143 HTDHQALVAWHGIPFFHVPVTAATKPEAEARLLELVDEFDVELVVLARYMQVLSDGLTRK 202

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QAY  GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 203 LDGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNGELDEGPIIAQQVVEVDHT 262

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              ED +A G++ E K L+ AV  H + RV +   +T+V
Sbjct: 263 YGPEDLVAAGRDTECKALSNAVRWHCEGRVILRGNRTVV 301


>gi|254247195|ref|ZP_04940516.1| Formyltetrahydrofolate hydrolase [Burkholderia cenocepacia PC184]
 gi|124871971|gb|EAY63687.1| Formyltetrahydrofolate hydrolase [Burkholderia cenocepacia PC184]
          Length = 351

 Score =  291 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 119/288 (41%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 63  SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 122

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 123 ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 182

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 183 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 242

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 243 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 302

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 303 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 350


>gi|166713950|ref|ZP_02245157.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 283

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 177/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 61  AALQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   +   E +L+ ++++  ++L++LARYMQILS H+C
Sbjct: 121 SNHTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQIDLVVLARYMQILSPHVC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 GALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|84625749|ref|YP_453121.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|84369689|dbj|BAE70847.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 283

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 176/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 1   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 61  AALQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   +   E +L+ ++++   +L++LARYMQILS H+C
Sbjct: 121 SNHTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQTDLVVLARYMQILSPHVC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 241 HAMTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 282


>gi|310640823|ref|YP_003945581.1| formyltetrahydrofolate deformylase (formyl-h(4)f hydrolase) (puru)
           [Paenibacillus polymyxa SC2]
 gi|309245773|gb|ADO55340.1| Putative formyltetrahydrofolate deformylase (Formyl-H(4)F
           hydrolase) (PurU) [Paenibacillus polymyxa SC2]
          Length = 299

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 166/283 (58%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF---NTCM 57
           +   + ++CP    I + +  +L   G NI+   Q+  D      FMRI F     +   
Sbjct: 18  NRARMLVSCPDGPGIVATVSRFLYEHGANIVQSDQYTMDPSGGMFFMRIEFDLPNLSAAQ 77

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                DF  + +QF ++++I       K  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 78  SQLEQDFVAVAEQFRMEWTISAVSRKKKLAIFVSKEDHCLVELLWQWQAGDLDADIALVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K+ VE++ +P++++P+T   K E+E++ + +I    ++++ILARYMQI+S    
Sbjct: 138 SNHPDMKEYVESFGIPYHHIPVTADTKPEAERRQLEVI-GEEIDVIILARYMQIISPKFI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 EHYRNRIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   + +   IG+ IE  VL +AV  H + R+ +++ KT+VF 
Sbjct: 257 HGDDVNELKRIGRTIERVVLARAVKWHTEDRILVHENKTVVFN 299


>gi|254700110|ref|ZP_05161938.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
 gi|261750601|ref|ZP_05994310.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
 gi|261740354|gb|EEY28280.1| formyltetrahydrofolate deformylase [Brucella suis bv. 5 str. 513]
          Length = 294

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 153/288 (53%), Positives = 210/288 (72%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MK 58
           M +++LT+TC S   I + I  YL+ +GCNI+D +QF+DLD  + FMR+SF+      + 
Sbjct: 1   MLNFVLTVTCKSTRGIVAAISGYLAGKGCNIIDSAQFDDLDMGRFFMRVSFISEEGVLLD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F + ++  +     KTL++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELCDGFAAVAAPFEMNFNFYDNAHRVKTLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T+ NK E+E+ L+ I+E  N EL++LARYMQ+LSD  C 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIAVTKANKPEAERHLMEIVEDTNTELVVLARYMQVLSDEFCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY    LD GPIIEQDV R+TH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTANLDEGPIIEQDVARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ   DY++IG+++EA+VL +AV+AHI  R F+N  +T+VFPA P ++
Sbjct: 241 AQNSADYVSIGRDVEAQVLARAVHAHIHHRSFLNGNRTVVFPASPGSF 288


>gi|186681065|ref|YP_001864261.1| formyltetrahydrofolate deformylase [Nostoc punctiforme PCC 73102]
 gi|186463517|gb|ACC79318.1| formyltetrahydrofolate deformylase [Nostoc punctiforme PCC 73102]
          Length = 285

 Score =  291 bits (745), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 168/280 (60%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP    + +   +++ + G NI+   Q  D        RI +    FN   + 
Sbjct: 6   TATLLISCPDQRGLVAKFANFIYSNGGNIIHADQHTDFAAGLFLTRIEWQLEGFNLPREF 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I Q  S ++ IR +    +  I VS+ DHCL DL++R         I  ++SN
Sbjct: 66  IAPAFNAIAQPLSAKWEIRFSDTVPRIAIWVSRQDHCLFDLIWRQRAKEFVAEIPLIISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K + E + + F ++P+T+ NK E E + + ++ +  ++L++LA+YMQI+S    ++
Sbjct: 126 HANLKVVAEQFNIDFQHVPITKDNKSEQEAQQLELLRQYKIDLVVLAKYMQIVSADFINQ 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
            + +IINIHHSFLP+F GANPY +A+E GVKIIGATAHYA  +LDAGPIIEQDVVRV+H 
Sbjct: 186 FS-QIINIHHSFLPAFIGANPYHRAFERGVKIIGATAHYATADLDAGPIIEQDVVRVSHR 244

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++D +  GK++E  VL +AV +H+Q RV +   +T+VF
Sbjct: 245 DEVDDLVRKGKDLERVVLARAVRSHLQNRVLVYGNRTVVF 284


>gi|302527129|ref|ZP_07279471.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
 gi|302436024|gb|EFL07840.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
          Length = 281

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 117/281 (41%), Positives = 179/281 (63%), Gaps = 3/281 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMK 58
           M+ + LT+ CP    I   +  +L + GC+I++  QF+D    +LF+R  F       + 
Sbjct: 1   MTQFTLTLHCPERSGIVHAVTTFLVSNGCDIVEHQQFDDDVHGELFLRTEFTCAGPATVD 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F  + + ++++Y   +     + L++VS+  HCLNDLL+RW  G L   I  V S
Sbjct: 61  DLTREFDLVARDYAMRYRFSDRTP-DRLLVMVSKAGHCLNDLLFRWRAGALGAEIALVAS 119

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   LPF ++P+T  +K E+EQ+L++++ +++++L++LARYMQ+LSD LC 
Sbjct: 120 NHEDLRPMAEAAGLPFVHIPVTPASKPEAEQRLLDLVREHDIDLVVLARYMQVLSDELCQ 179

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLP FKGA PY QAY+ GVK +GATAHY   ELD GPIIEQ+V RV H
Sbjct: 180 KLQGRAINIHHSFLPGFKGAKPYAQAYDRGVKYVGATAHYVTPELDEGPIIEQEVQRVDH 239

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +      +G++ EA  L++AV  H ++RV +N  +T+VF
Sbjct: 240 SHSPRALATVGRDAEALALSRAVRWHCERRVLLNGNRTVVF 280


>gi|107023714|ref|YP_622041.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116690801|ref|YP_836424.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
 gi|105893903|gb|ABF77068.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia AU
           1054]
 gi|116648890|gb|ABK09531.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia
           HI2424]
          Length = 294

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 119/288 (41%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|307719336|ref|YP_003874868.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6192]
 gi|306533061|gb|ADN02595.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6192]
          Length = 307

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL  +CP  + I + +  ++ T G NIL   Q ND +T+  FMR+ +    F    + 
Sbjct: 27  SAILLFSCPDTKGIVAEVSHFIFTYGGNILQSHQHNDPETNTFFMRVEWDISDFALPREK 86

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI  ++ + + I  +   T+  I VS+ DHCL D+L R   G +  +IV ++SN
Sbjct: 87  ITQAFEPIAIKYRMDWRIEFSDRRTRMAIFVSKQDHCLYDVLLRHKEGEIDADIVMILSN 146

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + + E + +PFYY P+  + K E E+K I +++++ V+L++LARYMQILS    ++
Sbjct: 147 HETTRPIAEYFGVPFYYFPVNRETKEEVEEKEIALLKEHGVDLVVLARYMQILSPRFVNE 206

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY QAYE GVKIIGAT+HY   +LD GPIIEQDVVRV+H 
Sbjct: 207 FRNRIINIHHSFLPAFAGARPYHQAYERGVKIIGATSHYVTEDLDEGPIIEQDVVRVSHR 266

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T+ D +  GK++E  VL++A+  HI  R+ + + +T++F 
Sbjct: 267 DTVRDLMQKGKDVEKLVLSRALKLHIDHRILVFRNRTVIFD 307


>gi|251795285|ref|YP_003010016.1| formyltetrahydrofolate deformylase [Paenibacillus sp. JDR-2]
 gi|247542911|gb|ACS99929.1| formyltetrahydrofolate deformylase [Paenibacillus sp. JDR-2]
          Length = 278

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 114/278 (41%), Positives = 164/278 (58%), Gaps = 5/278 (1%)

Query: 7   TITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLF---IA 62
            I+CP    I + +  +L   G NI+   Q+  D +    F+R  F  N   K     + 
Sbjct: 2   LISCPDRPGIVAAVSHFLYEHGANIVQSDQYTMDPEGGMFFIRFEFDLNDMDKELPVLVE 61

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           DF  +  +F +++         +  I VS+ DHCL +LL++W  G L  +I  VVSNH  
Sbjct: 62  DFARVADRFDMKWHTFRASRKKRLAIFVSKEDHCLMELLWQWKAGDLDADIAMVVSNHPD 121

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K +VE++ +P++++P+T   K E+E+K + I+     +L++LARYMQI+S     +   
Sbjct: 122 MKDMVESFGIPYHHIPVTADTKAEAERKQMEIVAD-KADLIVLARYMQIISPKFIEQFPN 180

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLP+F G  PY QAY  GVKIIGATAHY   ELD GPIIEQDV RV+H   +
Sbjct: 181 RIINIHHSFLPAFVGGKPYAQAYNRGVKIIGATAHYVTEELDGGPIIEQDVQRVSHRDNV 240

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           E+   IG+ IE  VL +AV  H + R+ +++ KT+VF 
Sbjct: 241 EELKRIGRTIERVVLARAVKWHTEDRIIVHQNKTVVFN 278


>gi|218533530|ref|YP_002424345.1| formyltetrahydrofolate deformylase [Methylobacterium
           chloromethanicum CM4]
 gi|4538619|emb|CAB39401.1| purU protein [Methylobacterium chloromethanicum]
 gi|218525833|gb|ACK86417.1| formyltetrahydrofolate deformylase [Methylobacterium
           chloromethanicum CM4]
          Length = 287

 Score =  291 bits (745), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 119/283 (42%), Positives = 175/283 (61%), Gaps = 4/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
             Y+L I+C     I + +   L  + CNI++  QF D+   + FMR+ F        ++
Sbjct: 4   KRYVLKISCADRPGIVAAVSGALLERDCNIVEAKQFEDVIEKRFFMRVVFSGINGQNSLR 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                  P+ Q+F + +SIR+ +   + +ILVS+ DHCL D+LYR  IG L +++  VV+
Sbjct: 64  EHQEAMTPLAQRFEMDWSIRDCETKRRVMILVSRFDHCLVDILYRKRIGELPMDLTAVVT 123

Query: 119 NHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++    P   LP+T + K   E KL+ +IE+   E+++LARYMQ+LS  L 
Sbjct: 124 NHAAENYAHLDLCGAPLISLPVTAETKRAQEDKLLELIERTGTEVVVLARYMQVLSAELS 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++ R INIHHSFLP FKGA PY QAYE GVK++GATAHY   +LD GPIIEQDV R++
Sbjct: 184 ARLSRRCINIHHSFLPGFKGAKPYHQAYERGVKLMGATAHYVTDDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H+ + ED +  G++IE +VL +A+  H+  RV +N  KT+VFP
Sbjct: 244 HSDSPEDLVRKGRDIERRVLARALRYHLDDRVLLNGHKTVVFP 286


>gi|304405031|ref|ZP_07386691.1| formyltetrahydrofolate deformylase [Paenibacillus curdlanolyticus
           YK9]
 gi|304345910|gb|EFM11744.1| formyltetrahydrofolate deformylase [Paenibacillus curdlanolyticus
           YK9]
          Length = 299

 Score =  291 bits (744), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 166/283 (58%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCMKLF 60
               + I+CP    I + +  +L   G NI+   Q+  D +    F+R  F  N   +  
Sbjct: 18  KRARMLISCPDRPGIVAAVSHFLYEHGANIVQSDQYTMDPEGGMFFIRFEFDLNDLEREL 77

Query: 61  ---IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                DF  +  +F +++         +  I VS+ DHCL +LL++W  G L  +I  VV
Sbjct: 78  PILQEDFVRVADRFDMKWHTFRASRKKRIAIFVSKEDHCLLELLWQWQAGDLDADIAMVV 137

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++LVE + +P++++P+T + K E+E+K + ++    ++L++LARYMQI+     
Sbjct: 138 SNHNDMRELVEGFGIPYHHIPVTPETKPEAEKKQMELVAD-KIDLIVLARYMQIIPQKFI 196

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   RIINIHHSFLP+F G  PY+QAY  GVKIIGATAHY   ELD GPIIEQDV RV+
Sbjct: 197 EQFPNRIINIHHSFLPAFVGGKPYQQAYSRGVKIIGATAHYVTEELDGGPIIEQDVQRVS 256

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   ++D   IG+ IE  VL + V  HI+ R+ +++ KT+VF 
Sbjct: 257 HRDNVDDLKRIGRTIERVVLARGVKWHIEDRMLVHQNKTVVFN 299


>gi|71905698|ref|YP_283285.1| formyltetrahydrofolate deformylase [Dechloromonas aromatica RCB]
 gi|71845319|gb|AAZ44815.1| formyltetrahydrofolate deformylase [Dechloromonas aromatica RCB]
          Length = 289

 Score =  291 bits (744), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 173/280 (61%), Gaps = 4/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLF 60
           Y L+ +CP    I + +  +++  G  IL+ S  +D+ T + FMRI    +     +  F
Sbjct: 9   YTLSASCPDQVGIIARVSGFIAGNGGWILESSFHSDVLTGRYFMRIEIKADSLPFLLAEF 68

Query: 61  IADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              F+  + +  S+ + I ++    + ++LVS+ +HCL DLL RW    L + I  V+SN
Sbjct: 69  RERFRIEVAEPLSMTWQINDSAVKKRVVVLVSKQEHCLYDLLARWQAKELDIEIPCVISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T +  VE + +PF+++P+T  NK  +  ++  I E    + M+LARYMQ+LS  LC  
Sbjct: 129 HDTFRGFVEWHGIPFHHVPVTADNKAAAYAEIQRIFEDVRGDSMVLARYMQVLSPELCDA 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +TG+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQDV+R+ H+
Sbjct: 189 LTGKIINIHHSFLPSFAGAKPYHQAYTRGVKLIGATCHYVTSELDAGPIIEQDVIRIDHS 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  GK+IE  VL + +  H++ RV ++  KT+VF
Sbjct: 249 DSPEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTVVF 288


>gi|171057988|ref|YP_001790337.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170775433|gb|ACB33572.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 295

 Score =  291 bits (744), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 125/288 (43%), Positives = 175/288 (60%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFND----LDTSKLFMRISFVFNT--- 55
            ++LT++CP  + I   +   L   GCNI+D  QF D      T   FMR+ F       
Sbjct: 7   QFVLTLSCPDTKGIVHAVSGLLYQAGCNIIDSQQFGDVLGEDATGLFFMRVHFEAPPHLG 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
              +    F  +  QF +Q  + +     + L++VS+  HCLNDLL+RW  G L ++I  
Sbjct: 67  DAAMLQNLFSHVRSQFGMQARVHSLARKPRLLLMVSKHGHCLNDLLFRWKSGQLPVDIPA 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTE----QNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH     L  +Y + F++LP+      Q K   E+++  + E+  V+L++LARYMQI
Sbjct: 127 IVSNHPDFADLAASYGIAFHHLPLKAGADAQAKRAQEREVEALFEREQVDLVVLARYMQI 186

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS   C  + GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ
Sbjct: 187 LSAEFCDFLAGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTADLDEGPIIEQ 246

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           DV RV H  + ED+ A+G+++E+ VL +AV  H++ RV +N RKT+VF
Sbjct: 247 DVERVDHTHSPEDFTAVGRDVESVVLARAVRWHVEHRVLLNGRKTVVF 294


>gi|315186734|gb|EFU20492.1| formyltetrahydrofolate deformylase [Spirochaeta thermophila DSM
           6578]
          Length = 307

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           S IL  +CP  + I + +  ++ T G NIL   Q ND +T+  FMR+ +    F    + 
Sbjct: 27  SAILLFSCPDTKGIVAEVSHFIFTYGGNILQSHQHNDPETNTFFMRVEWDISDFALPREK 86

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI  ++ + + I  + + T+  I VS+ DHCL D+L R   G +  +IV ++SN
Sbjct: 87  IPQAFEPIAIKYRMDWRIEFSDKRTRMAIFVSKQDHCLYDVLLRHKEGEIDADIVMILSN 146

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + + E + +PFYY P+  + K E E+K I +++++ V+L++LARYMQILS     +
Sbjct: 147 HETTRPIAEYFGVPFYYFPVNRETKEEMEEKEIALLKEHGVDLVVLARYMQILSPRFVGE 206

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY QAYE GVKIIGAT+HY   +LD GPIIEQDVVRV+H 
Sbjct: 207 FRNRIINIHHSFLPAFAGAKPYHQAYERGVKIIGATSHYVTEDLDEGPIIEQDVVRVSHR 266

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T+ D +  GK++E  VL++A+  HI  R+ + + +T++F 
Sbjct: 267 DTVRDLMQKGKDVEKLVLSRALKLHIDHRILVFRNRTVIFD 307


>gi|326386724|ref|ZP_08208345.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208777|gb|EGD59573.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 284

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 120/277 (43%), Positives = 175/277 (63%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIAD 63
           ILT++C     I S +   L   G NIL+  QF+D  +   FMR+        +      
Sbjct: 6   ILTLSCKDRPGIVSGVTGKLFESGANILEAQQFDDALSGNFFMRVVLDPGAQGVVALREA 65

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F+P+ ++F++ + +R++    + +++VS+ DHCL DLLYR  IG LA+++V ++ NH   
Sbjct: 66  FRPVAEEFAMDWRLRDSGLRRRVILMVSRFDHCLGDLLYRARIGELAMDVVAIIGNHPRE 125

Query: 124 K-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              +     +P+Y+LP+T   K   E ++  I+E+   EL++LARYMQILSD + H ++G
Sbjct: 126 ALSVPLWSDIPYYHLPVTAATKPAQEAEIKRIVEETGAELVVLARYMQILSDDMTHYLSG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  VTHA T 
Sbjct: 186 RCINIHHSFLPSFKGAKPYHQAFARGVKMIGATAHYVTADLDEGPIIHQDVESVTHADTP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +D +  G++IE +VL +AV  H++ R  +N  KT+VF
Sbjct: 246 DDLVRKGRDIERRVLAEAVRLHLEDRALLNGHKTVVF 282


>gi|58583965|ref|YP_202981.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428559|gb|AAW77596.1| formyltetrahydrofolate deformylase [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 289

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 176/282 (62%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           M S YILT++CP    I   +   L    CNILD  QF D ++ + F+R+ F     T +
Sbjct: 7   MRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFHKPAKTDI 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +  +F + + + + +   + L+LVS+  HCLNDLL+R +   L + I  VV
Sbjct: 67  AALQQRFAALADEFQMDWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPVEIAAVV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT    L  +Y + F++LP++   +   E +L+ ++++   +L++LARYMQILS H+C
Sbjct: 127 SNHTDFAALAASYGIAFHHLPVSAATRAAQEAQLLTLVDELQTDLVVLARYMQILSPHVC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 187 RALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVD 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA T  D + +G + E++VL +AV  H++ R+ +N  +T+VF
Sbjct: 247 HAMTPRDLVRVGSDTESQVLARAVRCHVEHRIVLNGHRTVVF 288


>gi|167917513|ref|ZP_02504604.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           BCC215]
          Length = 293

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGATAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP     +   K   E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|159029410|emb|CAO90786.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 284

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 110/281 (39%), Positives = 164/281 (58%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L I+CP    + + I +++   G NI+   Q  D       MRI +    FN    
Sbjct: 4   ATATLLISCPDQIGLVAKIANFIYANGGNIIHADQHTDFSAGLFLMRIEWQLEGFNLPRG 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +    F  I +     +S+  +    +  I V++ DHCL DLL+R   G +   I  ++S
Sbjct: 64  MIEPAFAAIAKPLQANWSLHFSDTVPRLAIWVTKQDHCLLDLLWRQQAGEIRAEIPLIIS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH     +   + + FY+LP+T + KIE E + + ++ +  ++L+ILA+YMQ+L+    +
Sbjct: 124 NHRELHSVANQFGIDFYHLPITAETKIEQEARQLELLREYRIDLVILAKYMQVLTPDFIN 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
                IINIHHSFLP+F GANPY++AY+ GVKIIGATAHY   +LD GPIIEQDVVRV+H
Sbjct: 184 FFP-NIINIHHSFLPAFAGANPYQRAYDRGVKIIGATAHYITADLDQGPIIEQDVVRVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ D I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 243 RHTVADLIRQGKDLERVVLARAVRLHLQNRVLVYANRTVVF 283


>gi|171912269|ref|ZP_02927739.1| formyltetrahydrofolate deformylase [Verrucomicrobium spinosum DSM
           4136]
          Length = 286

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 109/280 (38%), Positives = 166/280 (59%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I CP    +   +  ++     NILD+ Q  D   +  FMR+ +    F    + 
Sbjct: 6   TATLLIHCPDQPGLVHAVTGFIFAHQGNILDLEQHIDPPENLFFMRVEWAVENFTLAKEE 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F P+ +++ + +++  + E  +  + VS+  HCL DLL R   G L + I  +VSN
Sbjct: 66  ISAAFTPLGEKYRMGWTLHFSSERKRVALFVSRESHCLYDLLSRHEAGELPVEIPVIVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +   E + +PF++ PMT   K   E+  I+++ ++ V+ ++LARYMQILS+ L  +
Sbjct: 126 HELLRPAAERFGIPFHHFPMTPGTKAAQEKAQIDLLREHRVDTVVLARYMQILSEDLIRE 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +I+NIHHSFLP+F GA PY QAYE GVKIIGAT+HY    LD GPII QDV+RVTH 
Sbjct: 186 FPNQILNIHHSFLPAFVGAKPYHQAYERGVKIIGATSHYVTAALDQGPIIHQDVMRVTHE 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ++ D + +GK++E  VL KA+  H++ +V +   KT+VF
Sbjct: 246 DSVADLVRLGKDLEKTVLAKALWWHVRDKVLVYHNKTVVF 285


>gi|302417080|ref|XP_003006371.1| Formyl transferase [Verticillium albo-atrum VaMs.102]
 gi|261353973|gb|EEY16401.1| Formyl transferase [Verticillium albo-atrum VaMs.102]
          Length = 283

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 128/281 (45%), Positives = 181/281 (64%), Gaps = 2/281 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           + +ILT++CP    I   +    + Q  NILD+ QF+D  + K FMR+ F    +     
Sbjct: 3   NDHILTLSCPDKPGIVHAVTGIFAEQNLNILDLQQFSDPVSEKFFMRVHFGPTPSESTAH 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +     ++Y IR   +  + LI+VS+  HCLNDLL+R   G L + +  +VSN
Sbjct: 63  LDEPFGALAADLKMEYDIRPVAKKLRVLIMVSKIGHCLNDLLFRTKAGQLNIEVPLIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   ++L  NY + F +LP+T+  K E EQK++++I+++++EL++LARYMQ+LS  LC  
Sbjct: 123 HPEFQQLAGNYGIGFKHLPVTKDTKAEQEQKILDLIKEHDIELVVLARYMQVLSPRLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 183 MSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVSRVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              ++ +  G N+E++VL  AV    + RVF+NK KT+VF 
Sbjct: 243 LNPKELVEEGANVESQVLAAAVKWTAEGRVFLNKTKTVVFN 283


>gi|197122272|ref|YP_002134223.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. K]
 gi|220917055|ref|YP_002492359.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196172121|gb|ACG73094.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. K]
 gi|219954909|gb|ACL65293.1| formyltetrahydrofolate deformylase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 286

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 112/286 (39%), Positives = 175/286 (61%), Gaps = 8/286 (2%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSK-LFMRISF---VFN 54
           M+    IL + CP    I + I  +L   G NILD  Q   +D     F R+ F     +
Sbjct: 1   MTQPRAILLVQCPDRPGIVAAISSFLYRHGANILDFDQHTSVDNGGAYFTRLEFQTDRLD 60

Query: 55  TCMKLFIADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
             ++     F   + + F +++ +  + +  K  ILVS+ DH L +LL+ W+ G L  ++
Sbjct: 61  LPVEDLERAFALDVARPFGMEWRLTLSSQRKKVAILVSKHDHALLELLWNWDRGDLHADV 120

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             V+SNH   ++ VE++ +PF ++P +   + ++E +++ ++E    +L++LARYMQI+S
Sbjct: 121 STVISNHPDLRESVESFGVPFVHVPNSRDTRAQAEARMLELLEG-KADLVVLARYMQIVS 179

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             L  +   RIINIHHSFLP+F GA+PY+QAY+ GVKI+GATAHY   ELDAGPII+QDV
Sbjct: 180 PELVARWPNRIINIHHSFLPAFVGADPYRQAYDRGVKIVGATAHYVTAELDAGPIIDQDV 239

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RV+H   ++D   +G+++E +VL +AV  H + RV +N  KT+VF
Sbjct: 240 GRVSHRDAVDDLKRLGRDLERRVLARAVRWHCEDRVIVNGNKTVVF 285


>gi|119512879|ref|ZP_01631944.1| formyltetrahydrofolate deformylase [Nodularia spumigena CCY9414]
 gi|119462461|gb|EAW43433.1| formyltetrahydrofolate deformylase [Nodularia spumigena CCY9414]
          Length = 284

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 166/280 (59%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           +  L I+CP    + +   +++   G NI+   Q  D        RI +    FN   + 
Sbjct: 5   TATLLISCPDRRGLVAKFANFIYANGGNIIHADQHTDFAAGLFLTRIEWQLDGFNLPREF 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I Q    ++ +  +    +  I VS+ DHCL DL++R      A  I  ++SN
Sbjct: 65  IAPAFNAIAQPLDAKWQLHFSDSIPRIAIWVSRQDHCLFDLIWRQRAQEFAAEIPLIMSN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K++ E + + F+++P+T+ NK E E + + ++++  ++L++LA+YMQI+S     K
Sbjct: 125 HANLKEVAEQFGIDFHHIPITKDNKAEQEAQQLELLQRYQIDLVVLAKYMQIVSADFIDK 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              +IINIHHSFLP+F GANPY +A+E GVKIIGATAHYA  +LDAGPIIEQDVVRV+H 
Sbjct: 185 FP-QIINIHHSFLPAFVGANPYHRAFERGVKIIGATAHYATADLDAGPIIEQDVVRVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             IED I  GK++E  VL +AV  H+Q RV +   +T+VF
Sbjct: 244 DEIEDLIRKGKDLERVVLARAVRLHLQNRVLVYTNRTVVF 283


>gi|78067580|ref|YP_370349.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
 gi|77968325|gb|ABB09705.1| formyltetrahydrofolate deformylase [Burkholderia sp. 383]
          Length = 294

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 121/288 (42%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       T
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGADAAT 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRREFAPLAEQFAMRWEMHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS +LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNLCKQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ RV +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRVVLNGTKTVVF 293


>gi|46130832|ref|XP_389147.1| hypothetical protein FG08971.1 [Gibberella zeae PH-1]
          Length = 283

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 181/281 (64%), Gaps = 2/281 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
           + +ILT++CP    I   +    +    NILD+ QF+D  + + FMR+ F        + 
Sbjct: 3   NDHILTLSCPDKSGIVYAVTGIFADNKHNILDLQQFSDPVSERFFMRVHFGPTETESTEH 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  ++ ++Y IR     T+ LI+VS+  HCLNDLL+R   G L + +  +VSN
Sbjct: 63  LTEAFDKLAAEYKMEYDIRPVARKTRVLIMVSKIGHCLNDLLFRMKTGQLRMEVPVIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L E+Y + F++LP+T+  K + E +++ + +K+++EL++LARYMQ+LS  LC  
Sbjct: 123 HPEYAALAESYGIEFHHLPVTKDTKAQQEGQVLELCKKHSIELIVLARYMQVLSPTLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ + RV HA
Sbjct: 183 MSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRIARVDHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            + +D    G N+E++VL  AV  + ++R+F+N  KT+VF 
Sbjct: 243 MSPKDLSEEGSNVESQVLAAAVRWYAEKRLFLNGHKTVVFN 283


>gi|284043157|ref|YP_003393497.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
 gi|283947378|gb|ADB50122.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
          Length = 295

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 172/281 (61%), Gaps = 7/281 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFNTCM----K 58
             L I+C     I + +  +L   G NILD  Q   D +    FMR+ F  +       +
Sbjct: 17  ARLLISCSDQPGIVAAVSRFLFEHGANILDADQHTTDPEGGVFFMRMEFQLDGLDLGRGE 76

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           L  A    + + F + + +       +  +LVS+ +HCL DLL+RW  G L  ++  VVS
Sbjct: 77  LEQAFGATVGEPFGMDWRLSYANRRKRVALLVSREEHCLLDLLWRWRSGDLDADVGLVVS 136

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++ VE++ +PF ++P+ +++K ++E +++  +   +  L++LARYMQILS     
Sbjct: 137 NHRDAERDVESFGVPFLHVPVAKESKPQAEAEILRHLRGFD--LVVLARYMQILSGDFLA 194

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            +   +INIHHSFLP+F GA+PY++A E GVKIIGATAHY   ELDAGPIIEQDV RV+H
Sbjct: 195 ALDTPMINIHHSFLPAFAGADPYRRASERGVKIIGATAHYVTEELDAGPIIEQDVARVSH 254

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             ++E+ + IG++IE  VL +AV+ H+  RV +++ +T+VF
Sbjct: 255 RDSLEELVRIGRDIERIVLARAVSRHLADRVLVHENRTVVF 295


>gi|78486390|ref|YP_392315.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
 gi|78364676|gb|ABB42641.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
          Length = 285

 Score =  290 bits (743), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 113/284 (39%), Positives = 174/284 (61%), Gaps = 4/284 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTC 56
           MS  + L I+CP    I + +  +++++G +I++ +   D      FMR           
Sbjct: 1   MSRVFRLIISCPDQVGIVAKVAGFIASEGGSIIEANHHTDALNQWFFMRHEILASSLKND 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +  F   F  I   F + + I ++ +  K  +  S+  HCL DLLYRW+   L   +  V
Sbjct: 61  LDGFKTKFAAIAADFDMDWQITDSDQPKKIALFASKESHCLADLLYRWHENDLPGEVACV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           ++NH   +++VE Y +PF+++P+T   K E+  K   ++ + +V++++LARYMQIL   +
Sbjct: 121 IANHDDLRRMVEWYDIPFHHVPVTPDTKTEAFAKSQQLVAQYDVDVIVLARYMQILPPQM 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C    GR+INIHHSFLPSF GA PY QAYE GVK+IGAT HY   ELDAGPIIEQDV+RV
Sbjct: 181 CLDYAGRVINIHHSFLPSFVGAKPYHQAYERGVKLIGATCHYVTEELDAGPIIEQDVIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +H+Q+I+D   +G+++E  VL++ +  H++ RV I+  KT+VF 
Sbjct: 241 SHSQSIDDMRRLGRDVEKTVLSRGLRYHLEDRVLIHGNKTVVFD 284


>gi|37523894|ref|NP_927271.1| formyltetrahydrofolate deformylase [Gloeobacter violaceus PCC 7421]
 gi|35214900|dbj|BAC92266.1| formyltetrahydrofolate deformylase [Gloeobacter violaceus PCC 7421]
          Length = 300

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 117/285 (41%), Positives = 166/285 (58%), Gaps = 7/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFN 54
           MS  +  L I+CP    I + +   +   G NIL   Q   D      FMR+ F      
Sbjct: 16  MSPATRTLLISCPDRRGIVAAVSQCVLEAGGNILRSDQHTTDPLGGIFFMRLEFLYANAP 75

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                F   F P+ ++F++ + +  T E  +  + VS+ DHC  DLL+R   G L + I 
Sbjct: 76  ADDDGFARCFAPVAERFAMDWRLVRTGEPKRMALFVSRLDHCFVDLLWRRQSGELPVKIP 135

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH   + +   Y LP++YL + + N+   E +++N++E   V+ ++LARYM++LS 
Sbjct: 136 LVVSNHPDLEPVAAQYGLPYHYLAIDKTNQPAREAQMLNLLEG-EVDFIVLARYMRVLSP 194

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
               +  GRIINIHHSFLP+F GA+PY++A E GVK+IGATAHY   ELDAGPIIEQDVV
Sbjct: 195 QFVERYAGRIINIHHSFLPAFVGASPYERACERGVKVIGATAHYVTEELDAGPIIEQDVV 254

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H   + D    G++IE  VL +AV  H++ RV I   +T+VF
Sbjct: 255 RVNHRDQVADLKLKGRDIERVVLARAVKWHVEDRVLIYGNRTVVF 299


>gi|206559216|ref|YP_002229977.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia J2315]
 gi|198035254|emb|CAR51129.1| putative formyltetrahydrofolate deformylase [Burkholderia
           cenocepacia J2315]
          Length = 294

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 119/288 (41%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSPNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|307314594|ref|ZP_07594195.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
 gi|306899011|gb|EFN29655.1| formyltetrahydrofolate deformylase [Sinorhizobium meliloti BL225C]
          Length = 294

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 153/288 (53%), Positives = 216/288 (75%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--K 58
           M  Y+LTIT  S   I + I  YL+ +GCNI+D SQF+ L+T   FMR++F+       +
Sbjct: 1   MHKYVLTITSKSTRGIVADISGYLAEKGCNIVDSSQFDGLETGLFFMRLAFISEQGAKAE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F+P+ ++F +   IR+T E  K L++VS+  HCLNDLLYRW IG L ++IVGVVS
Sbjct: 61  ELREAFEPVAKRFGMTAEIRDTAERMKVLLMVSRFGHCLNDLLYRWKIGALPIDIVGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K+V N+ +PF+++ +T++NK ++E +L++++E+   EL++LARYMQ+LSD LC 
Sbjct: 121 NHFDYQKVVVNHDIPFHHIKVTKENKPKAEAQLMDVVEQTGAELIVLARYMQVLSDALCK 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+G+IINIHHSFLPSFKGANPYKQAYE GVK+IGATAHY   +LD GPIIEQD+ R+TH
Sbjct: 181 KMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTADLDEGPIIEQDIARITH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ EDY++IG+++E++VL +AV+AHI  R FIN  + +VFP  P +Y
Sbjct: 241 AQSAEDYVSIGRDVESQVLARAVHAHIHHRCFINGNRVVVFPPSPGSY 288


>gi|170734126|ref|YP_001766073.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
 gi|169817368|gb|ACA91951.1| formyltetrahydrofolate deformylase [Burkholderia cenocepacia MC0-3]
          Length = 294

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 119/288 (41%), Positives = 184/288 (63%), Gaps = 11/288 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-------T 55
           S+IL ++CP    I   +  +L  +  NILD +QF D  TS+ FMR+ F  +       +
Sbjct: 6   SFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTSEFFMRVHFEQDGGGVDAAS 65

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +     +F P+ +QFS+++ + +     + +I+VS+  HCLNDLL+R+  G L + I  
Sbjct: 66  ALDTLRKEFAPLAEQFSMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLPIEIPA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQI 171
           +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LARYMQI
Sbjct: 126 IVSNHKEFYQLAASYNIPFHHFPLIGGSSDAAKAAQEARVLEVIDEHQADLVVLARYMQI 185

Query: 172 LSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQ 231
           LS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ
Sbjct: 186 LSTNMCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQ 245

Query: 232 DVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 EVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|167645075|ref|YP_001682738.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
 gi|167347505|gb|ABZ70240.1| formyltetrahydrofolate deformylase [Caulobacter sp. K31]
          Length = 303

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/281 (44%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
            YIL + CP  + + + +  +L+    +I++ S FND    + +MR  F  +     +  
Sbjct: 23  RYILILQCPDRKGVVAAVSGFLADNDASIVESSHFNDGLADQFYMRTVFRPDGAMPGIDD 82

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+ I ++F + +++ +     K LI VS+  HCL DLL+RW  G L + IVGVVSN
Sbjct: 83  LRQGFELIAKRFGMTWALHDANAKPKVLIAVSKFGHCLFDLLHRWRAGLLPVEIVGVVSN 142

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +   E   LP+++LP T  NK E E+  + +++  NV+L++LARYMQILS  LC +
Sbjct: 143 HEDMRSFTEWSGLPYFHLPTTNTNKAEQEEAFLRLVDDLNVDLVVLARYMQILSPALCAR 202

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLPSFKGA PY QA+E GVKIIGATAHY   +LD GPIIEQ V RV H+
Sbjct: 203 LSGRCINIHHSFLPSFKGAKPYHQAFERGVKIIGATAHYVTTDLDEGPIIEQGVHRVDHS 262

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T +D +A+G+++E  VL +AV  H++ RV I   KT+VF 
Sbjct: 263 HTPDDLVALGRDVECTVLARAVTWHVEHRVLIAGAKTVVFD 303


>gi|192360988|ref|YP_001982082.1| formyltetrahydrofolate deformylase [Cellvibrio japonicus Ueda107]
 gi|190687153|gb|ACE84831.1| formyltetrahydrofolate deformylase [Cellvibrio japonicus Ueda107]
          Length = 286

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/280 (44%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
              +LT +C  ++ + + +    +T G NI + SQF D++ ++ FMR  F       +  
Sbjct: 5   KEIVLTFSCQDSKGLVAAVATLFATLGFNIRESSQFEDVERNRFFMRTVFECPDGYNLGQ 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             + F+P+ +Q+ + ++I +++   + LI VSQ  HCLN LL  W  G+L ++IVGV SN
Sbjct: 65  IRSLFKPLGEQYKMDWNIFDSQSKPRVLIAVSQWGHCLNALLNSWKNGSLPIDIVGVASN 124

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L E Y+LPF+YLP+T   K + E ++  +++    + ++LARYMQILSD LCHK
Sbjct: 125 HNVMRDLTEWYELPFHYLPITADTKPQQEAQVWQLLQDVQADFLVLARYMQILSDDLCHK 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAH+   +LD GPIIEQ V RV+H 
Sbjct: 185 LNGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHFVTADLDEGPIIEQAVERVSHV 244

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + E+   IG++IEA VL +AV  H + RV +N  KT+VF
Sbjct: 245 NSPEEMAEIGRDIEAVVLNRAVRWHAEHRVLLNGNKTVVF 284


>gi|171059964|ref|YP_001792313.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
 gi|170777409|gb|ACB35548.1| formyltetrahydrofolate deformylase [Leptothrix cholodnii SP-6]
          Length = 282

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 124/281 (44%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMK 58
           M+ +YILT++CP    I   +   L   G NIL+ +Q+ND  T   FMR+ F    T   
Sbjct: 1   MTPTYILTLSCPDQPGIVHGVAGLLFMHGGNILEAAQYNDEQTGLFFMRVQFACAKTPRA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 Q +   +++ + +    +   T+I+VSQ  HC+NDLL+R+  G L ++I  +VS
Sbjct: 61  DLEHALQELAAVWTMSFELHAGAQRMATVIMVSQHGHCINDLLFRFKSGLLPIDIKAIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH    +L  +Y +PF+++P+T   K E+E K + +I     EL+ILARYMQ+LSD +C 
Sbjct: 121 NHRDFYQLAASYNIPFHHIPVTAATKQEAEAKQLEVIRAEGAELVILARYMQVLSDPMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV R  H
Sbjct: 181 ALNGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVTADLDEGPIIEQDVARADH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T++D  +IG++ E++VL +AV  H ++RV +N  KT++F
Sbjct: 241 SLTVDDLTSIGRDTESQVLARAVKWHSERRVLLNGHKTVIF 281


>gi|88855797|ref|ZP_01130460.1| formyletrahydrofolate deformylase [marine actinobacterium PHSC20C1]
 gi|88815121|gb|EAR24980.1| formyletrahydrofolate deformylase [marine actinobacterium PHSC20C1]
          Length = 284

 Score =  289 bits (741), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 116/279 (41%), Positives = 180/279 (64%), Gaps = 1/279 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + +I+T+TC     I   I   +   G NI +  QF+  DT + FMR+    +     F 
Sbjct: 5   THWIVTLTCDDKPGIVHAISGAIVEAGGNITESQQFSSGDTGRFFMRLQVESDASRDDFE 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               P+ +++++++ +       +TL+L S+  HC+NDLLYR   G LA+ +  ++SNH 
Sbjct: 65  TALAPVTERYTMEWQLDVVGRPLRTLVLASKSGHCVNDLLYRQRAGQLAIEMPLIMSNHP 124

Query: 122 THKKLVENYQLPFYYLPMT-EQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               L E Y++PF   P+T    K+  E +++ ++E++++EL++LARYMQILS  LC ++
Sbjct: 125 DLGSLAEFYEVPFESHPVTTPGQKLAFEDRILEVVEQHDIELVVLARYMQILSPELCKQL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLP FKGANPYKQA+  GVK+IGATAH+   +LD GPIIEQ+VVRV HA 
Sbjct: 185 SGKIINIHHSFLPGFKGANPYKQAHARGVKLIGATAHFVTSDLDEGPIIEQNVVRVDHAS 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  + ++IG++ E++ LT+AV    + RV ++  +TI+F
Sbjct: 245 TASELVSIGQDEESRTLTQAVKWFAEDRVLLDGARTIIF 283


>gi|332285288|ref|YP_004417199.1| formyltetrahydrofolate deformylase [Pusillimonas sp. T7-7]
 gi|330429241|gb|AEC20575.1| formyltetrahydrofolate deformylase [Pusillimonas sp. T7-7]
          Length = 282

 Score =  289 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 122/281 (43%), Positives = 180/281 (64%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M  YILT++CP    I   +  +L     NI+D  QF DL T + F+R+ F         
Sbjct: 1   MKDYILTLSCPDRIGIVHSVTGWLLGLHGNIIDAQQFGDLGTERFFLRVHFALPQPADTA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F    ++F ++  I + +   + LILVS+  HCLNDLL+R + G L + I G+VS
Sbjct: 61  ELEASFAATAERFDMEAHIYDAQCKARLLILVSRQGHCLNDLLFRKHSGQLPVEIAGIVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  +  + + Y +P++YLP+  + +   EQ++++I+ K  ++L++LARYMQILS++LC 
Sbjct: 121 NHKDYAAMAQAYGIPYHYLPVNAETRETQEQQILDIVAKEKIDLVVLARYMQILSNNLCQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD+ RV H
Sbjct: 181 ALSGRAINIHHSFLPSFKGARPYHQAHARGVKIIGATAHYVTADLDEGPIIEQDIERVDH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +D   +G ++E+ VL +AV  H++ R+ +N ++T+VF
Sbjct: 241 TLESQDLTQVGSDVESLVLARAVRWHVEHRILLNGQRTVVF 281


>gi|269955556|ref|YP_003325345.1| formyltetrahydrofolate deformylase [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304237|gb|ACZ29787.1| formyltetrahydrofolate deformylase [Xylanimonas cellulosilytica DSM
           15894]
          Length = 291

 Score =  289 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 122/278 (43%), Positives = 178/278 (64%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + ++LTI+CP    I S I   L+ +G NI +  QF D  +   F+R+  V     +  +
Sbjct: 13  TEWVLTISCPDGPGIVSAITGALAARGDNITESQQFGDPASGLFFLRLQVVSTATREELV 72

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           A   P    F++ +++       +TL+LVS+  HCL DLLYR     + +++VGVV NH 
Sbjct: 73  AALTPAFDAFAMTWNLDVVGRRMRTLLLVSKAAHCLVDLLYRERSQGMPIDVVGVVGNHP 132

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               +   Y  PF+ +P+T+  K E+E +L  ++ + +VEL++LARYMQILSD LC  ++
Sbjct: 133 DLADIAAFYGKPFHRVPVTQATKAEAEDRLRALVAELDVELVVLARYMQILSDDLCRDLS 192

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GRIINIHHSFLPSFKGA PY QA++ GVKIIGAT+HY   +LD GPIIEQDV RV H++ 
Sbjct: 193 GRIINIHHSFLPSFKGARPYAQAHDRGVKIIGATSHYVTGDLDEGPIIEQDVERVDHSRA 252

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + D +AIG+++E   L +AV  H + RV +N  +T++F
Sbjct: 253 VADLVAIGEDVERATLARAVRWHAEHRVLLNGHRTVIF 290


>gi|186939590|dbj|BAG31006.1| putative formyltetrahydrofolate deformylase [Ensifer sp. AJ110404]
          Length = 298

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 151/292 (51%), Positives = 212/292 (72%), Gaps = 6/292 (2%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC 56
           M++    Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMR+SF     
Sbjct: 1   MTTTAPRYALRVACPSIRGVTAAIATYLSQNGCNISDSAQFDDADTDRYFMRVSFQPKEG 60

Query: 57  M--KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
              +     F+PI +++       +  E  K +++VS+  HCLNDLLYRW IG L ++IV
Sbjct: 61  RTLEQLREGFKPIAEKYEANTEFFDETEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIV 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           GV+SNH  ++++V N+ +PF+ + +T++NK E+E   + I+E +  EL++LARYMQ+LSD
Sbjct: 121 GVISNHLDYQRVVVNHDIPFHCIKVTKENKPEAEATQMQIVEDSGAELIVLARYMQVLSD 180

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +C KM+GRIINIHHSFLPSFKGANPYKQAYE GVK+IGAT+HY   +LD GPIIEQD+V
Sbjct: 181 EMCRKMSGRIINIHHSFLPSFKGANPYKQAYERGVKLIGATSHYVTADLDEGPIIEQDIV 240

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           RVTHAQ+ EDY+++G+++E++VL +A++AHI  RVFI+  KT+VFPA P +Y
Sbjct: 241 RVTHAQSGEDYVSLGRDVESQVLARAIHAHIHGRVFIDGNKTVVFPASPGSY 292


>gi|189500718|ref|YP_001960188.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides
           BS1]
 gi|189496159|gb|ACE04707.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides
           BS1]
          Length = 309

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 173/281 (61%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
              +L ++CP    + S I +++  +  NILD+ +  D+ +   F+R+S+  +       
Sbjct: 28  QKAVLLLSCPDRIGLVSRISNFIFERRGNILDLDEHVDIASGMFFIRVSWSRDDVSITTA 87

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F P+  +    + I    E  +  + VS+ DHCL DLL+R+  G  A+ I  ++S
Sbjct: 88  DLQGAFSPLALELGADWKIYVIPEKPRVAVFVSRYDHCLQDLLWRYKTGEFAMEIPLIIS 147

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   Y +PF+  P T +NK+E E K + ++++N V+ ++LARYMQ+LS     
Sbjct: 148 NHRDLEDLAAQYSIPFHVFPKTRENKLEQETKELELLKENRVDTIVLARYMQVLSQRFVD 207

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F G +PYKQA+E GVKIIGAT+HY   ELD GPIIEQD++R+TH
Sbjct: 208 AYPDRIINIHHSFLPAFSGGSPYKQAFERGVKIIGATSHYVTGELDEGPIIEQDIIRITH 267

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ D I  G+++E  VL++A+++H+  RV +N RKTI+F
Sbjct: 268 KDTLGDLIRKGRDLERLVLSRAISSHVDHRVLVNGRKTIIF 308


>gi|297622867|ref|YP_003704301.1| formyltetrahydrofolate deformylase [Truepera radiovictrix DSM
           17093]
 gi|297164047|gb|ADI13758.1| formyltetrahydrofolate deformylase [Truepera radiovictrix DSM
           17093]
          Length = 286

 Score =  289 bits (740), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 121/283 (42%), Positives = 174/283 (61%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
           ++  L I+CP    I + +  +L   G NILD  Q   D    + FMR+ F     +   
Sbjct: 5   NTARLLISCPDRPGIVAAVSQFLYAHGANILDAQQHSTDPKGGEFFMRMVFHLEDLDVTR 64

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F   F  +  + F + + +    +  +  +LVS+ DHCL +LL+R   G   ++I  V
Sbjct: 65  AQFERAFAEVVARPFGMSWRVAYADQRKRMAVLVSKTDHCLLELLWRVRSGEFDVDIPLV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++  E + +PFY+LP+T + K E E +L+ ++E   V+L++LARYMQILS  +
Sbjct: 125 ISNHDLLRETTEAFGIPFYHLPVTPETKAEQEAQLLALLEG-RVDLVVLARYMQILSPEV 183

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +  GRIINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   ELD GPII QDV RV
Sbjct: 184 VSRYRGRIINIHHSFLPAFVGANPYKQAYERGVKLIGATAHYVTDELDEGPIIAQDVARV 243

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H +++ D + +G+ +E  VL +AV AH++ RV I   KT+VF
Sbjct: 244 SHRESVADLVGVGRELERTVLARAVAAHLEDRVLIFGNKTVVF 286


>gi|15615827|ref|NP_244131.1| formyltetrahydrofolate deformylase [Bacillus halodurans C-125]
 gi|10175888|dbj|BAB06984.1| formyltetrahydrofolate deformylase [Bacillus halodurans C-125]
          Length = 289

 Score =  289 bits (739), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 173/284 (60%), Gaps = 5/284 (1%)

Query: 1   MSSYI-LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCM- 57
           M   I L I+C     I + I  +L+  G NI+   Q+  D +  + FMR+ F  N    
Sbjct: 5   MKKRIRLLISCHDQPGIVAAISTFLNHHGANIVQSDQYSTDPEGGRFFMRVEFDQNNDSI 64

Query: 58  --KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +     F  +  ++ + + +       +  I VS+ DHCL +LL++W+   L  +I  
Sbjct: 65  TFEALKTAFTDVAAEYKMNWRMEQASRKKRMAIFVSKEDHCLLELLWKWHSNELICDIPL 124

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH   + +VE Y +P+Y++P++++ K E+EQK I ++ + N+++++LARYMQI+S H
Sbjct: 125 VISNHDELRDVVEGYGIPYYHIPVSKERKAEAEQKQIELLHQYNIDVIVLARYMQIISSH 184

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
                  +IINIHHSFLP+F GANPY +A+E GVK+IGATAH+   +LD GPIIEQDV+R
Sbjct: 185 FVDTFKDKIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHFVTDDLDEGPIIEQDVLR 244

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  ++      G+N+E  VL +AVN +++ ++ +   KT+VF
Sbjct: 245 VNHRYSVPQLRVAGRNVERVVLARAVNWYLEDKIIVYSNKTVVF 288


>gi|302896088|ref|XP_003046924.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256727852|gb|EEU41211.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 283

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 121/281 (43%), Positives = 183/281 (65%), Gaps = 2/281 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
           + +ILT++CP    I   +    ++   NILD+ QF+D  + + FMR+ F        + 
Sbjct: 3   NDHILTLSCPDKSGIVHAVTGIFASHKHNILDLQQFSDPVSDRFFMRVHFGPTETESTEH 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +  F  +  ++ + Y IR      + LI+VS+  HCLNDLL+R   G L + +  +VSN
Sbjct: 63  LVEPFDKLAAEYKMDYDIRPVARKMRVLIMVSKIGHCLNDLLFRMKTGQLRIEVPVIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  +  L ++Y + F++LP+T+  K E E +++++++++N+EL++LARYMQ+LS  LC  
Sbjct: 123 HPDYAPLAQSYGIEFHHLPVTKDTKAEQESQVLDLVKQHNIELVVLARYMQVLSPTLCEA 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 183 MSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHS 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
              ++    G N+E++VL  AV  + ++R+F+NK KT+VF 
Sbjct: 243 MNPKELSEEGSNVESQVLAAAVRWYAERRLFLNKTKTVVFN 283


>gi|146281549|ref|YP_001171702.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri A1501]
 gi|145569754|gb|ABP78860.1| formyltetrahydrofolate deformylase [Pseudomonas stutzeri A1501]
          Length = 277

 Score =  289 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 109/276 (39%), Positives = 173/276 (62%), Gaps = 3/276 (1%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKLFIADF 64
           I CP    I + + ++L+T    I + +  +D  +   FMR     +     +  F   F
Sbjct: 2   IACPDGVGIVAKVSNFLATYNGWITEANHHSDHQSGWFFMRHEIRADSLPFDLDGFRQAF 61

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
            PI ++FS+++ I +++   + +++ S+  HCL DLL+RW+ G L  +I  V+SNH   +
Sbjct: 62  APIAREFSMEWRITDSERRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVISNHDDLR 121

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            +VE + +P++++P+   NK E+  ++  ++ +   ++++LARYMQIL   LC +   R+
Sbjct: 122 SMVEWHGIPYFHVPVDPANKQEAFAEVTRLVREQRADVIVLARYMQILPAELCDEFAQRV 181

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+H  +IED
Sbjct: 182 INIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSHRDSIED 241

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            + +GK++E  VL++ +  H++ RV ++  KT+VF 
Sbjct: 242 MVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTLVFN 277


>gi|78485696|ref|YP_391621.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
 gi|78363982|gb|ABB41947.1| formyltetrahydrofolate deformylase [Thiomicrospira crunogena XCL-2]
          Length = 282

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 177/281 (62%), Gaps = 2/281 (0%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMK 58
           MS SY+LT++CP    I S +  +L+   C I + +   D +    FMR      N   +
Sbjct: 1   MSASYVLTVSCPDKIGIVSKVSTFLADHQCMITEANHHADEELGMFFMRNEISNLNMSEE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F  I QQF +Q+ + +  +  + +I+VS+ DHCL DLLYRW  G +  +I  V+S
Sbjct: 61  SFKLKFLDIAQQFDMQWKLSSGAKKKRVIIMVSKQDHCLYDLLYRWKSGEMDYDIPCVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K LVE + +P+ ++P+T  NK ++  +++  +E    + ++LARYMQI+   LC 
Sbjct: 121 NHLDLKGLVEWHGIPYVHIPVTPDNKSQAFSEVVKWVEHYQADTIVLARYMQIIPPDLCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K  G+IINIHHSFLPSF GA PY QA+E GVK+IGAT HY   ELDAGPIIEQDV RV+H
Sbjct: 181 KYPGQIINIHHSFLPSFIGARPYHQAFERGVKLIGATCHYVTEELDAGPIIEQDVRRVSH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +++ ++ + +GK++E   L + +  H++ RV ++  KTIVF
Sbjct: 241 SESADEMVVLGKDVEKNALARGLKHHLEDRVLLSGNKTIVF 281


>gi|262200787|ref|YP_003271995.1| formyltetrahydrofolate deformylase [Gordonia bronchialis DSM 43247]
 gi|262084134|gb|ACY20102.1| formyltetrahydrofolate deformylase [Gordonia bronchialis DSM 43247]
          Length = 316

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 104/284 (36%), Positives = 161/284 (56%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             Y+LT+ CP    I + I  +L+  G  I + +  +D +T   F R +   ++      
Sbjct: 32  RRYVLTLGCPDRTGIVARISSFLADVGGWITEAAYHSDAETGWFFTRQAVRADSVASTAD 91

Query: 59  LFIADFQPIVQQ---FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                F   V         + + +T E    ++LVS+  HCL DLL R   G L  +I  
Sbjct: 92  QLRERFATEVAPELGDETDWRLTDTGERKSVVLLVSKESHCLTDLLGRAYRGELPASIEA 151

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+ NH   ++L   + +PF+++P   + K E+  ++  I++ ++ + ++LAR+MQIL   
Sbjct: 152 VIGNHRDLEELPTRFGIPFHHVPFAGERKAEAFAEVGRIVDAHSPDAIVLARFMQILPPQ 211

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GR +NIHHSFLPSF GA PY QA+  GVK+IGAT HY   +LDAGPIIEQDV+R
Sbjct: 212 LCDAWAGRALNIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTADLDAGPIIEQDVIR 271

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  ++ D +  G++IE  VL + +  H++ R+ ++ RKT+VF
Sbjct: 272 VDHGDSVSDMVRQGRDIETLVLARGLRWHLEDRILVHGRKTVVF 315


>gi|300310922|ref|YP_003775014.1| formyltetrahydrofolate deformylase [Herbaspirillum seropedicae
           SmR1]
 gi|300073707|gb|ADJ63106.1| formyltetrahydrofolate deformylase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 289

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 118/285 (41%), Positives = 174/285 (61%), Gaps = 7/285 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            YILT++C     I   +  +L+  GCNI+D +QF D  +   FMR+ F           
Sbjct: 5   EYILTLSCLDQRGIVHRVSGFLADHGCNIIDSAQFGDAQSKLFFMRVHFSSEDASVSDAA 64

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             ADF  +     + + + +  +  + +++VS+  HCLNDLL+R+  G L + I  +VSN
Sbjct: 65  LRADFGVLGDALQMNWQLHDAGKKPRVMLMVSKIGHCLNDLLFRYKSGLLPVEIPAIVSN 124

Query: 120 HTTHKKLVENYQLPFYYLPMT----EQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           HT   +L  +Y +PF++LP+      + K   EQ+++ I+E N ++L++LARYMQILS  
Sbjct: 125 HTDFYQLAASYNIPFHHLPLATGAPMEVKRAQEQRIMEIVEANQIDLVVLARYMQILSPE 184

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAH+   +LD GPIIEQ V R
Sbjct: 185 MCEALRGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHFVTGDLDEGPIIEQGVER 244

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V H+   +   AIG++IE  VL +AV    + R+ +N  KT++F 
Sbjct: 245 VDHSMGPDTLTAIGRDIECVVLARAVKWFTEHRILLNGHKTVIFN 289


>gi|186470705|ref|YP_001862023.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
 gi|184197014|gb|ACC74977.1| formyltetrahydrofolate deformylase [Burkholderia phymatum STM815]
          Length = 296

 Score =  288 bits (738), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 116/279 (41%), Positives = 167/279 (59%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
            + LT++CP    I S +  +L+     I++ +   D    + FMR   V       +  
Sbjct: 16  RFTLTLSCPDRIGIVSAVSTFLAEHRGWIIEATHHADEVEKRFFMRHEIVAESLPFGIGG 75

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F  I ++F++ + I +     + +ILVS+ +HCL DLL RW  G L + I  V+SN
Sbjct: 76  FRERFAHIAKEFAMDWKISDNSVKKRVVILVSKLEHCLYDLLARWKAGELDIEIPCVISN 135

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T +  VE + +PF+ +P+T  NK ++  ++  + E  + + M+LARYMQ+LS  LC  
Sbjct: 136 HETWRSFVEWHGIPFHCVPVTPDNKAQAYDEVQRLFEDAHADTMVLARYMQVLSPKLCAD 195

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             GRIINIHHSFLPSF GA PY QAY  GVK+ GAT HY   ELD GPIIEQDV+RV+H+
Sbjct: 196 YPGRIINIHHSFLPSFVGAKPYHQAYSRGVKLTGATCHYVTEELDQGPIIEQDVIRVSHS 255

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              +D + +G++IE  VL + +  HI+ RV I+  KTIV
Sbjct: 256 DRPDDLVRLGRDIEKTVLARGLRYHIEDRVLIHGNKTIV 294


>gi|319944247|ref|ZP_08018523.1| formyltetrahydrofolate deformylase [Lautropia mirabilis ATCC 51599]
 gi|319742542|gb|EFV94953.1| formyltetrahydrofolate deformylase [Lautropia mirabilis ATCC 51599]
          Length = 285

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 127/284 (44%), Positives = 174/284 (61%), Gaps = 5/284 (1%)

Query: 1   MSS-----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT 55
           M++     YILT+ CP    I   I   L   G NI + +Q+ND DT   FMR+ F    
Sbjct: 1   MNTTTRPEYILTLACPDRAGIVHTITGLLLVHGGNITEAAQYNDPDTGLFFMRVQFTSPA 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                    Q      SL++++        T+ILVS+  HCLNDLL+R   G L ++I  
Sbjct: 61  APTTLRDALQAAASDLSLRWNLAENGRRMPTVILVSKLGHCLNDLLFRTRAGMLPIDIRA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   +  VE   +PF+++P++   +  +E + + IIE +  EL++LARYMQILSD+
Sbjct: 121 IISNHEDFRPQVEAQGIPFHHVPVSAATREAAEARQLEIIESSGAELVVLARYMQILSDN 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ GR INIHHSFLPSFKGA PY QA++ GVKIIGATAHY   ELD GPIIEQDV R
Sbjct: 181 LCRQLQGRAINIHHSFLPSFKGARPYYQAHDRGVKIIGATAHYVTAELDEGPIIEQDVER 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  T++   A+G ++E  VL +AV  H + R+ +N  KT+VF
Sbjct: 241 VDHTMTVDTLTALGGDVENVVLARAVKWHAEHRIMLNGHKTVVF 284


>gi|330818331|ref|YP_004362036.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
 gi|327370724|gb|AEA62080.1| Formyltetrahydrofolate deformylase [Burkholderia gladioli BSR3]
          Length = 293

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 119/292 (40%), Positives = 182/292 (62%), Gaps = 13/292 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----- 52
           MS+   +IL ++CP    I   +  +L  +  NI+D +QF D  T + FMR+ F      
Sbjct: 1   MSTDHSFILKLSCPDKHGIVHAVSGFLFERDTNIVDSAQFGDSRTGEFFMRVHFDQTTNS 60

Query: 53  -FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLAL 111
              + +     +F P+ ++F++ + + +  +  + +ILVS+  HCLNDLL+R+  G L +
Sbjct: 61  DAESTLDTLRNEFAPLAERFAMHWEMHDALKKPRVVILVSKIGHCLNDLLFRYRTGQLPI 120

Query: 112 NIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILAR 167
            I  +VSNH    +L  +Y +PF++ P     + + K   E +++ +I ++  +L++LAR
Sbjct: 121 EIAAIVSNHKDFYQLAASYDVPFHHFPLAAGASAEAKAAQEARVLEVIGEHATDLVVLAR 180

Query: 168 YMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGP 227
           YMQILS  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GP
Sbjct: 181 YMQILSPQLCEQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGP 240

Query: 228 IIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IIEQ+V RV H+ T E   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 IIEQEVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRILLNGTKTVVF 292


>gi|258593320|emb|CBE69659.1| Putative formyltetrahydrofolate deformylase (Formyl-H(4)F
           hydrolase) (purU) [NC10 bacterium 'Dutch sediment']
          Length = 286

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 170/282 (60%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCM 57
           +   L I+CP    I + +   L  QG NI+   Q   D +    F+RI F     ++  
Sbjct: 5   TRARLLISCPDRPGIVAAVSQCLFEQGANIVHSDQHTTDPEGGVFFVRIEFDLPELDSRG 64

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F+PI ++F + + + N        I VS+ DHCL +LL+RW    +A  I  VV
Sbjct: 65  TELERVFEPIARRFRMDWRLTNAARVKPIAIFVSKEDHCLLELLWRWRAEDMAAEIAMVV 124

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE Y +PFY++ +T++ + ++E   + ++E   V+L+++ARYM++LS    
Sbjct: 125 SNHANLRGLVEAYGIPFYHIAVTQERQEQAEASQLQLVEG-KVDLIVMARYMRVLSSAFI 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   RIINIHHSFLP+F GA+PY QA+  GVK+IGATAHYA   LDAGPIIEQDV RV 
Sbjct: 184 RRFPNRIINIHHSFLPAFVGADPYAQAHSRGVKLIGATAHYATDALDAGPIIEQDVERVD 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+ED   IG+++E  VL +AV  H++ +V ++  KT+VF
Sbjct: 244 HRHTVEDLKRIGRHVERVVLARAVTWHLEDKVLVHGNKTVVF 285


>gi|170940393|emb|CAP65620.1| unnamed protein product [Podospora anserina S mat+]
          Length = 282

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 122/276 (44%), Positives = 176/276 (63%), Gaps = 2/276 (0%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLFIAD 63
           LT++CP    I   +    + +  NI+D+ QF+D  T K FMR+ F        +     
Sbjct: 7   LTLSCPDKPGIVHAVTGVFAGEKVNIIDLQQFSDPVTEKFFMRVHFGPTPTESPEFLRPH 66

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F+ +  ++ + Y IR   +  K LI+VS+  HCLNDLL+R   G L + I  +VSNH   
Sbjct: 67  FEKLAGEYDMTYDIRPVAQKPKVLIMVSKIGHCLNDLLFRAKTGQLPIEIPLIVSNHPDF 126

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
             L  +Y + F +LP+T+  K   E +++ +I+++NVEL++LARYMQ+LS  LC  M+G+
Sbjct: 127 APLAASYGIEFRHLPVTKDTKAAQEGQILELIKEHNVELVVLARYMQVLSPTLCEAMSGK 186

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
           IINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+ + +
Sbjct: 187 IINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHSLSPK 246

Query: 244 DYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +  G N+E++VL  AV  + ++RVF+N  +T+VF
Sbjct: 247 ALVDEGSNVESQVLAAAVKWYAERRVFLNGTRTVVF 282


>gi|322695316|gb|EFY87126.1| formyltetrahydrofolate deformylase [Metarhizium acridum CQMa 102]
          Length = 286

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 123/281 (43%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MK 58
           + YILT++CP    I   +    ++ G N+LD+ QF+D  + + FMR+ F         +
Sbjct: 5   NDYILTLSCPDKPGIIHAVTAVFASHGHNVLDLQQFSDPVSRRFFMRVHFGPKADSITAE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   + + Y IR   +  K LI+VS+  HCLNDLL+R   G L + +  +VS
Sbjct: 65  HLAQPFGELAAAYEMTYDIRPVAQKMKVLIMVSKIGHCLNDLLFRMKTGQLKIEVPVIVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  +K L  +Y + F++LP+T   K + E +++ ++ ++ +EL++LARYMQ+LS  LC 
Sbjct: 125 NHADYKALAASYGIEFHHLPVTGDTKAQQEAQVLELVRRHGIELVVLARYMQVLSPTLCE 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H
Sbjct: 185 AMSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   ++ +  G N+E++VL  AV  +  +RVF+N  KT+VF
Sbjct: 245 SMDPKELVEEGSNVESQVLAAAVRWYADRRVFLNGSKTVVF 285


>gi|326388304|ref|ZP_08209907.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326207470|gb|EGD58284.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 284

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 126/279 (45%), Positives = 186/279 (66%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLF 60
            ++L ++C   + I + I   ++ Q CNI+  +QF D+ T + FMR+SF     +  + F
Sbjct: 5   QFVLLVSCQDRKGIVAAIAGSIAAQDCNIIHNAQFGDVYTGRFFMRVSFAGPEGLTTEKF 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+   ++L + + + +   + L++VS+  HCLNDLLYR     L + +  VVSNH
Sbjct: 65  SEAFLPVGAAYNLDWKVHDLRVKQRALVMVSKGGHCLNDLLYRTATRYLPMEVTSVVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T ++ VE+  +PF+Y+P+T +NK E E +L+ +I++  V+L+ILARYMQ+LSD  C K+
Sbjct: 125 KTWQRRVEHEGIPFHYMPITPENKEEQEARLLEMIDEQQVDLIILARYMQVLSDATCRKL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHS LP+FKGA PY +A+E GVK++GAT HY   +LD GPII QDV  V HA 
Sbjct: 185 EGRVINIHHSSLPAFKGAKPYHRAWERGVKMVGATGHYVTADLDEGPIIAQDVSMVDHAD 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TIED IA G+  E++VLT+AV AH + RV +N  +T+VF
Sbjct: 245 TIEDLIAQGQETESRVLTRAVKAHCEHRVMLNGARTVVF 283


>gi|85375737|ref|YP_459799.1| formyltetrahydrofolate deformylase [Erythrobacter litoralis
           HTCC2594]
 gi|84788820|gb|ABC65002.1| formyltetrahydrofolate deformylase [Erythrobacter litoralis
           HTCC2594]
          Length = 284

 Score =  288 bits (737), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 122/277 (44%), Positives = 173/277 (62%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-FNTCMKLFIAD 63
           +LT++C     IT+ +  +L   GCNIL+  QFND ++ + FMRI+F            D
Sbjct: 6   VLTLSCADRPGITANVTGFLFEHGCNILEARQFNDRESDRFFMRIAFDPLEADPDALKRD 65

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F     +  + + +       + LI+VS+ DHCL DLLYRW IG L +  V +VSNH   
Sbjct: 66  FAAYADRLGMDWKLAKRDRRRRVLIMVSRFDHCLADLLYRWRIGELPIEPVAIVSNHPRE 125

Query: 124 KKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
                +   +PF++LP+T + K++ E ++  I E+ + EL++LARYMQILSD        
Sbjct: 126 AISHTHIGEVPFHHLPVTHETKLDQEAQVRAIAEETDTELVVLARYMQILSDEQAAHFAA 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  ++HA + 
Sbjct: 186 RCINIHHSFLPGFKGAKPYHQAHARGVKMIGATAHYVTTDLDEGPIIHQDVEPISHADSP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED +  G++IE++VL +AV  H+++RV IN ++TIVF
Sbjct: 246 EDLVRKGRDIESRVLAEAVRMHVEERVLINGQRTIVF 282


>gi|83647665|ref|YP_436100.1| formyltetrahydrofolate deformylase [Hahella chejuensis KCTC 2396]
 gi|83635708|gb|ABC31675.1| formyltetrahydrofolate deformylase [Hahella chejuensis KCTC 2396]
          Length = 284

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
            +Y L I CP    I + +  +L+T    + + S  +D      +MR           + 
Sbjct: 3   RTYRLVIACPDRVGIVAKVTTFLATYNGWLTEASHHSDPTNGWFYMRNEIKASSLPFDLN 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F+PI ++F + + + ++++  + +++ S+  HCL DLL+RW+   +   IVGV+S
Sbjct: 63  SFRIAFEPIAREFQMCWHVADSQQPKRIVLMASKESHCLADLLHRWHAKEMDGEIVGVIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++VE + +P+Y++P+   +K  +  ++  +++  + E+++LARYMQIL   LC 
Sbjct: 123 NHDDLRRMVEWHDIPYYHVPVDPDDKSVAFAEVERLVDALDAEVIVLARYMQILPPELCD 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           + TGRIINIHHSFLPSF GA PY QAY+ GVK+IGAT HY   +LD GPIIEQDV+RV H
Sbjct: 183 RYTGRIINIHHSFLPSFAGARPYHQAYKRGVKLIGATCHYVTQDLDEGPIIEQDVIRVNH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + TIED + +GK++E +VL + +  H++ RV +++ KTIVF
Sbjct: 243 SDTIEDMVRLGKDVEKQVLARGLRYHLEDRVIVHENKTIVF 283


>gi|126668594|ref|ZP_01739547.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
 gi|126626924|gb|EAZ97568.1| formyltetrahydrofolate deformylase [Marinobacter sp. ELB17]
          Length = 284

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 181/281 (64%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           +Y L I+CP    I + + ++LST    I + S  +D  +   FMR     N     ++ 
Sbjct: 4   TYRLVISCPDGVGIVAKVSNFLSTYNGWITEASHHSDTHSGWFFMRHEIKANSIPFGLEQ 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F PI ++F++ + I ++ +  K +++ S+  HC+ DLL+RW    L + IV VVSN
Sbjct: 64  FRAAFAPIAREFNMNWRITDSAQPKKVVLMCSKESHCVADLLHRWQSNELNVEIVAVVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +++VE + +P++++P+++ N+ E+   + ++ E++ V++++LARYMQ+L   LC K
Sbjct: 124 HDDLRRMVEWHDIPYHHVPVSKDNREEAFAHIEDLFEQHQVDVVVLARYMQVLPPELCAK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G++INIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQ V+R+TH 
Sbjct: 184 YAGKVINIHHSFLPSFAGARPYHQAYSRGVKLIGATCHYVTQDLDEGPIIEQSVIRITHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            T +D + +GK++E  VL + + +HI+ RV  ++ KT+VF 
Sbjct: 244 DTTDDMVRLGKDVEKSVLARGLRSHIEDRVITHENKTVVFD 284


>gi|148553864|ref|YP_001261446.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
 gi|148499054|gb|ABQ67308.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
          Length = 283

 Score =  288 bits (736), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 174/278 (62%), Gaps = 3/278 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLFI 61
           Y+LT++CP    I + +   L +   NI++ +QF D +T + FMR+ F       + +  
Sbjct: 5   YVLTLSCPDQPGIVTRVTAELYSYRANIVEAAQFEDRETGRFFMRVVFTVPEGVTLDVVR 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
             F P+ + + + ++IR   +  K L+L S+ DHCL DLLYR  IG L + +VG+VSNH 
Sbjct: 65  DTFTPVARHYDMHWAIRPRDQRRKVLLLASKFDHCLVDLLYRNRIGELNMEVVGIVSNHP 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
                 +    PF++ P+T  +K E E ++  ++++   EL++LARYMQILSD L   + 
Sbjct: 125 RETY-GDLGDAPFHHFPITRDSKAEQEARIKALVDETGAELIVLARYMQILSDDLAAFLA 183

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV +++HA +
Sbjct: 184 GRCINIHHSFLPGFKGAKPYHQAHARGVKMIGATAHYVTADLDEGPIIAQDVEQISHADS 243

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            E  +  G++IE +VL +AV  H+  RV +N  KT+VF
Sbjct: 244 PEALVRKGRDIERRVLARAVRHHLADRVLLNGAKTVVF 281


>gi|307295559|ref|ZP_07575395.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
 gi|306878598|gb|EFN09818.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
          Length = 288

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 172/281 (61%), Gaps = 5/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMK 58
           S++LT+ C     I + +  +L+ +G  I D  Q+ D +  + FMR++F          +
Sbjct: 8   SWVLTLACADRVGIVAAVSQFLAERGGFITDSQQYADREAGRFFMRVAFEATDERLGDTE 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               DF  +  +F++ + +    E  + LI VS+  HCL DLL+RW  GTLA++I+GVVS
Sbjct: 68  RLREDFADVGTRFAMDWRLTAADERPRMLIAVSKGSHCLADLLHRWQTGTLAVDIMGVVS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++ E + +P++ LP     K   E  L+ I E+   E +ILARYMQ+LS+ L  
Sbjct: 128 NHPDMRRITEWHGIPYHELPPNGD-KAAQEAALLGIFERTQSEYLILARYMQVLSEGLVE 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V R+ H
Sbjct: 187 ALAGRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERIDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T ED I IG++IEA+VL +AV     +RV  N  KT+VF
Sbjct: 247 RATAEDMIRIGRDIEAQVLARAVGWLADRRVLRNGGKTVVF 287


>gi|308176491|ref|YP_003915897.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307743954|emb|CBT74926.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 280

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 178/279 (63%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M+ YI+T++C     I   I   L   GCNI +  QF   +T   FMRI       +   
Sbjct: 1   MNQYIVTLSCIDRPGIVHAISGGLLGAGCNITESQQFLSPETGTFFMRIEVATEQSLAQI 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A   PI   F +   + +  + T+T+I+ S+  H LNDLL+    GTLA+++  +VSNH
Sbjct: 61  RAGLAPIRDDFHMSLRVDDGAKRTRTMIMCSKAGHALNDLLFAQRAGTLAIDVPVIVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K + + Y + F +LP+T++NK ++E +L+ + E   +EL++LARYMQILSD LC +M
Sbjct: 121 LDLKPMADFYGVDFVHLPVTKENKSQAEAELLKLAEDYGIELVVLARYMQILSDSLCERM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPII+Q+V  V+H +
Sbjct: 181 EGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIDQEVTHVSHTR 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  + +G+++E + LT+AV  H + RV ++ ++TIVF
Sbjct: 241 TAEQLVELGRSVEGRTLTRAVQWHAEHRVMLDGQRTIVF 279


>gi|120434846|ref|YP_860532.1| formyltetrahydrofolate deformylase [Gramella forsetii KT0803]
 gi|117576996|emb|CAL65465.1| formyltetrahydrofolate deformylase [Gramella forsetii KT0803]
          Length = 283

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 105/282 (37%), Positives = 172/282 (60%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMK 58
           M    L I CP    I + +  +   +  NI+ I Q+ DL+    FMR+   FN      
Sbjct: 1   MPKLTLLIHCPDTSGIIAAVTSFFHQRKGNIIYIDQYVDLENQTFFMRLECEFNHQISFD 60

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
              A F+  +   + + + +   +   K  ILVS+ DHCL D+L R+  G L + I  ++
Sbjct: 61  DVKAHFKKDLGNPYKMSWHMFGAESKLKMAILVSKYDHCLYDILGRYRSGELNVIIPLIL 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + +++ +PFY++P+ +  K E+E + + +++K N++ ++LARYMQI+S +L 
Sbjct: 121 SNHKDLEPVAKSFNIPFYHIPVLKDKKEEAETQQLELLKKENIDFIVLARYMQIISGNLI 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   ELDAGPIIEQD+ R++
Sbjct: 181 KRFPNQIINIHHSFLPAFAGAKPYHFAYKRGVKIIGATSHYVTDELDAGPIIEQDITRIS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +++D I  G+++E  VL + +  H++++  +   +T+VF
Sbjct: 241 HSHSVKDLILKGRDLEKIVLARGIKLHLERKTLVYNNRTVVF 282


>gi|303325207|pdb|3OBI|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325208|pdb|3OBI|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325209|pdb|3OBI|C Chain C, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
 gi|303325210|pdb|3OBI|D Chain D, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Np_949368) From Rhodopseudomonas Palustris Cga009 At
           1.95 A Resolution
          Length = 288

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 169/281 (60%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT++CP    I S +  +L   G NILD  Q+ND ++   F R+ F        +  
Sbjct: 6   QYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFXRVVFNAAAKVIPLAS 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  +F+  +  R+ +   K  +LVSQ DHCL D+LYRW +G L      +VSN
Sbjct: 66  LRTGFGVIAAKFTXGWHXRDRETRRKVXLLVSQSDHCLADILYRWRVGDLHXIPTAIVSN 125

Query: 120 HTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           H        ++  +PFY+ P+ +  + + E  +  +I + + +L++LARY QILSD    
Sbjct: 126 HPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYXQILSDEXSA 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY    LD GPII+QDV R++H
Sbjct: 186 RLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T  D +  G++IE +VL++A++ H+  RV +N RKT+VF
Sbjct: 246 RDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVF 286


>gi|254481371|ref|ZP_05094616.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
 gi|214038534|gb|EEB79196.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
          Length = 290

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 179/283 (63%), Gaps = 3/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
           SS+ L I+CP    I + I  +++ +G ++++ +Q  D++    ++R        +    
Sbjct: 8   SSFTLIISCPDEVGIVAAICQFIAQRGGSLIESNQHTDVEQGWFYLRNVIDGQSLSIDEN 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F  +F P+  +FS+++ +R+     +  I+ S   HCL DLL+RW    L   I  V+S
Sbjct: 68  RFREEFAPLADKFSMEWYLRDNSVPQRVAIMASHSSHCLADLLHRWKSNELNCTIPCVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE + +PF+++P+ +++K E+ +K  NIIE++  E ++LARYMQI+   +C 
Sbjct: 128 NHENLRSMVEWHGIPFHHVPVPKEDKSEAFEKTANIIERHQAETIVLARYMQIIPPAICS 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
             +GR+INIHHSFLPSF GANPY++AY+ GVK+IGAT HY   +LD GPIIEQDV+RV+H
Sbjct: 188 SYSGRLINIHHSFLPSFIGANPYQKAYDRGVKLIGATCHYVTEDLDEGPIIEQDVIRVSH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           +   +D + +G+++E   L++ +  H++ RV +   KT+VF  
Sbjct: 248 SCDKDDMVRLGRDVERSALSRGLRYHLEDRVIVRGNKTVVFTP 290


>gi|186939595|dbj|BAG31003.1| putative formyltetrahydrofolate deformylase [Aminobacter sp.
           AJ110403]
          Length = 291

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 144/286 (50%), Positives = 204/286 (71%), Gaps = 2/286 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KL 59
           + Y L +  PS   +T+ + +YL++ GCNI D +QF+D  T + FMR+SF        + 
Sbjct: 6   NRYALRVAGPSIRGVTAAVANYLASNGCNISDSAQFDDKSTGRYFMRVSFHSEEGRTLED 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I ++F       +     K +++VS+  HCLNDLLYRW IG L ++IVGV+SN
Sbjct: 66  LRNGFAEIAKKFEADVEFFDETTKRKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  ++KLV N+ +PF+ + +T++NK ++E + + I+E    EL++LARYMQ+LSD +C K
Sbjct: 126 HMDYQKLVVNHDIPFHCIKVTKENKPQAEAEQMRIVEDTGAELIVLARYMQVLSDEMCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD VRVTHA
Sbjct: 186 MSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDTVRVTHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNN 285
           Q+ +DY+++G+++E++VL +A++AHI  RVFIN  KTIVFP  P +
Sbjct: 246 QSADDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTIVFPPSPGS 291


>gi|29346791|ref|NP_810294.1| formyltetrahydrofolate deformylase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29338688|gb|AAO76488.1| formyltetrahydrofolate deformylase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 284

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 106/283 (37%), Positives = 173/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 1   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 60

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 61  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKMSHCLFDMLARYTAGEWNVEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 121 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 181 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  +IED +  GK++E  VL++AV  HI++++   K KT++F
Sbjct: 241 THKDSIEDLVNKGKDLEKIVLSRAVQKHIERKILAYKNKTVIF 283


>gi|115352892|ref|YP_774731.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|172061740|ref|YP_001809392.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
 gi|115282880|gb|ABI88397.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria AMMD]
 gi|171994257|gb|ACB65176.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria MC40-6]
          Length = 294

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 118/293 (40%), Positives = 184/293 (62%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----- 52
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F      
Sbjct: 1   MSTDHSFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADG 60

Query: 53  --FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
               + +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 61  ADAASALDTLRQEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 120

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LA
Sbjct: 121 IEIPAIVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHQADLVVLA 180

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 181 RYMQILSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 240

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|289614542|emb|CBI58715.1| unnamed protein product [Sordaria macrospora]
          Length = 286

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 124/280 (44%), Positives = 185/280 (66%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           + +ILT++CP    I   +    + +G NILD+ QF+D  + K FMR+ F        + 
Sbjct: 6   NDHILTLSCPDKPGIVHAVTGVFAQKGHNILDLQQFSDPVSEKFFMRVHFGPTPTPSTEH 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +  F  +  ++ ++Y IR   + T+ LI+VS+  HCLNDLL+R   G L ++I  +VSN
Sbjct: 66  LMEPFNKLAAEYQMEYKIRPVSQKTRVLIMVSKIGHCLNDLLFRAKTGQLPIDIPLIVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + L ++Y + F++LP+T++ K + E +++ + +++ +EL++LARYMQ+LS  LC  
Sbjct: 126 HPTFEPLAQSYGIEFHHLPVTKETKAQQEGQILELAKQHGIELIVLARYMQVLSPTLCEA 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 186 MSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHS 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 +  G N+E++VL  AV  + +QR+F+N  KT+VF
Sbjct: 246 MGPNVLVDEGSNVESQVLAAAVKWYAEQRLFLNNGKTVVF 285


>gi|152995766|ref|YP_001340601.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
 gi|150836690|gb|ABR70666.1| formyltetrahydrofolate deformylase [Marinomonas sp. MWYL1]
          Length = 286

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 108/281 (38%), Positives = 185/281 (65%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
            ++ L I+CP    I + +  +L+ +  +I++ S   DL+    FMR        +  ++
Sbjct: 4   KTFRLVISCPDRVGIVAAVSQFLNERQGSIIEASHHTDLEQKWFFMRHDIDAESLDIDVE 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           +F  +F PI ++F++++ ++++++  K ++L ++  HCLND+++RW+ G L   IVGV++
Sbjct: 64  IFRKEFAPIAEEFNMRWYVKDSEDRPKVVLLATKESHCLNDIMHRWHTGELNCEIVGVIA 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE Y++P++ +P+ +++K+ + Q++   I+    + ++LARYMQI  ++LC 
Sbjct: 124 NHEDLRSMVEWYKIPYFCIPVPKEDKMPAFQEIEACIDSTQADTIVLARYMQIFPEYLCE 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H
Sbjct: 184 KYRHKVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRH 243

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   ED + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 244 SHAAEDMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 284


>gi|170700366|ref|ZP_02891376.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
 gi|170134710|gb|EDT03028.1| formyltetrahydrofolate deformylase [Burkholderia ambifaria
           IOP40-10]
          Length = 294

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 118/293 (40%), Positives = 184/293 (62%), Gaps = 14/293 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----- 52
           MS+   +IL ++CP    I   +  +L  +  NILD +QF D  T + FMR+ F      
Sbjct: 1   MSTDHSFILKLSCPDRHGIVHAVSGFLFERSNNILDSAQFGDSRTGEFFMRVHFEQDADG 60

Query: 53  --FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
               + +     +F P+ +QF++++ + +     + +I+VS+  HCLNDLL+R+  G L 
Sbjct: 61  ADAASALDTLRKEFAPLAEQFAMRWELHDAAVKPRVVIMVSKIGHCLNDLLFRYRTGQLP 120

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILA 166
           + I  +VSNH    +L  +Y +PF++ P     ++  K   E +++ +I+++  +L++LA
Sbjct: 121 IEIPAIVSNHKEFYQLAASYNIPFHHFPLVGGSSDAAKAAQEARVLEVIDEHRADLVVLA 180

Query: 167 RYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAG 226
           RYMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD G
Sbjct: 181 RYMQILSPNMCQQLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEG 240

Query: 227 PIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           PIIEQ+V RV H+ T +   AIG+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 PIIEQEVERVDHSMTPDQLTAIGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 293


>gi|83720563|ref|YP_441053.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|167579785|ref|ZP_02372659.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           TXDOH]
 gi|167617860|ref|ZP_02386491.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis Bt4]
 gi|257140294|ref|ZP_05588556.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
 gi|83654388|gb|ABC38451.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           E264]
          Length = 293

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 119/287 (41%), Positives = 183/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGAADAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEIPAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++ P     +   K   E +++ +I+++  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|320591949|gb|EFX04388.1| formyltetrahydrofolate deformylase [Grosmannia clavigera kw1407]
          Length = 316

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 182/281 (64%), Gaps = 2/281 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMKL 59
           +++ILT++CP    I   +   L+ Q  N+LD+ QF+D  +   FMR+ F  +       
Sbjct: 36  NTHILTLSCPDRPGIVHAVTGILAAQKLNVLDLQQFSDRASETFFMRVHFGPSEVDSTAA 95

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + + FS+ Y IR+     + LI+VS+  HCLNDLL+R   G L + +  VVSN
Sbjct: 96  LDEPFAQLARDFSMTYDIRSVARKVRVLIMVSKIGHCLNDLLFRMRTGQLHVEVPLVVSN 155

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H     LV +Y + F +LP+T+ +K   E++++ +I ++N+EL++LARYMQ+LS  LC  
Sbjct: 156 HGEFADLVRSYGIDFAHLPVTKDSKAAQEERILELITEHNIELVVLARYMQVLSPKLCQV 215

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV H+
Sbjct: 216 MSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHS 275

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            + +  +  G N+E++VL  AV  + +++VF+N  KT+VF 
Sbjct: 276 MSPKALVDEGSNVESQVLAAAVKWYAERKVFLNGTKTVVFN 316


>gi|300113988|ref|YP_003760563.1| formyltetrahydrofolate deformylase [Nitrosococcus watsonii C-113]
 gi|299539925|gb|ADJ28242.1| formyltetrahydrofolate deformylase [Nitrosococcus watsonii C-113]
          Length = 283

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           S + L I+CP    I + +  ++++ G  I + S ++D  +   FMR           +K
Sbjct: 3   SEFRLIISCPDRVGIVAEVSSFIASHGGWINEASHYSDPVSGWFFMRHCIKSSSLPFGIK 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI Q++ +++S+ ++    + +++ S+  HCL DLL+RW+   L  +I  ++S
Sbjct: 63  AFKDKFSPIAQKYKMKWSLSDSSVKKRVVLMASKESHCLVDLLHRWHSNELYCDIRCIIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+LV+ Y  P++++P+  + K  + +++I +IE N+ +L++LARYMQIL   +C+
Sbjct: 123 NHERLKQLVDAYGAPYHFVPIAGEKKEGAFRRIIQLIEDNHTDLIVLARYMQILPGDICN 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLPSF GA PY QA E GVK+IGAT HY    LDAGPII+QDV+RV+H
Sbjct: 183 TYQNRIINIHHSFLPSFVGAKPYHQASERGVKLIGATCHYVTEALDAGPIIDQDVIRVSH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T++D I +G+++E  VL + V +H+  RV ++  KTIVF
Sbjct: 243 HNTVDDMIRLGRDVEKLVLARGVRSHLGDRVLVHGNKTIVF 283


>gi|253572247|ref|ZP_04849650.1| formyltetrahydrofolate deformylase [Bacteroides sp. 1_1_6]
 gi|298386562|ref|ZP_06996118.1| formyltetrahydrofolate deformylase [Bacteroides sp. 1_1_14]
 gi|251838022|gb|EES66110.1| formyltetrahydrofolate deformylase [Bacteroides sp. 1_1_6]
 gi|298260939|gb|EFI03807.1| formyltetrahydrofolate deformylase [Bacteroides sp. 1_1_14]
          Length = 285

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 106/283 (37%), Positives = 173/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 62  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKMSHCLFDMLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  +IED +  GK++E  VL++AV  HI++++   K KT++F
Sbjct: 242 THKDSIEDLVNKGKDLEKIVLSRAVQKHIERKILAYKNKTVIF 284


>gi|190891658|ref|YP_001978200.1| formyltetrahydrofolate deformylase [Rhizobium etli CIAT 652]
 gi|190696937|gb|ACE91022.1| formyltetrahydrofolate deformylase protein [Rhizobium etli CIAT
           652]
          Length = 298

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 154/286 (53%), Positives = 211/286 (73%), Gaps = 2/286 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLF 60
            Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMRISF  +    +   
Sbjct: 7   RYALRVACPSIRGVTAAIAGYLSQNGCNISDSAQFDDADTGRYFMRISFQPHDGQTLDQL 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F+PI  +F       +  E  K +++VS+  HCLNDLLYRW IG L ++IVGV+SNH
Sbjct: 67  RQGFEPIAGKFEASAEFFDESEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T ++++V N+ +PF+ + +T +NK E+E K + I+E++  EL++LARYMQ+LSD +C KM
Sbjct: 127 TDYQRVVVNHDIPFHCIKVTRENKPEAEAKQMQIVEESGAELIVLARYMQVLSDDMCRKM 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD+VRVTHAQ
Sbjct: 187 SGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIVRVTHAQ 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           + EDY+++G+++E++VL +A++AHI  RVFIN  KT+VFPA P +Y
Sbjct: 247 SGEDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTVVFPASPGSY 292


>gi|153808216|ref|ZP_01960884.1| hypothetical protein BACCAC_02504 [Bacteroides caccae ATCC 43185]
 gi|149129119|gb|EDM20335.1| hypothetical protein BACCAC_02504 [Bacteroides caccae ATCC 43185]
          Length = 285

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 173/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELRDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 62  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDMLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  +IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 242 THKDSIEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|302877349|ref|YP_003845913.1| formyltetrahydrofolate deformylase [Gallionella capsiferriformans
           ES-2]
 gi|302580138|gb|ADL54149.1| formyltetrahydrofolate deformylase [Gallionella capsiferriformans
           ES-2]
          Length = 282

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 172/283 (60%), Gaps = 6/283 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TC 56
           M+  Y LTI+CP    I + +  +++  G  I++ S   + ++ + FMR     +     
Sbjct: 1   MNRHYTLTISCPDRAGIIAAVAGFIAQHGGFIVEASYHTEQESERFFMRQEIRADSLPFD 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
              F   F  + Q+F++ + + ++ +  + +ILVS+ DHCL+DLL+RW  G L ++I  V
Sbjct: 61  AAEFGLRFAALAQEFNMHWQLADSAQNKRLVILVSRQDHCLDDLLHRWRSGELLVDIPCV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   +  VE + +PF    +  Q+K  + + +  + ++   + M+LAR+MQIL   L
Sbjct: 121 ISNHEDLRSFVEWHGIPFI--KVDMQDKTAAFEHIAALFDEYQGDTMVLARFMQILPPFL 178

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +  GRIINIHHSFLPSF GA PY QAY  GVK+IGAT HY   ELDAGPIIEQD VR+
Sbjct: 179 CQRYPGRIINIHHSFLPSFVGAKPYHQAYLRGVKLIGATCHYVTDELDAGPIIEQDTVRI 238

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T++D +  G++IE  VL++ +  H++ RV +   KTIVF
Sbjct: 239 DHGDTVDDLVRYGRDIEKTVLSRGLRYHVEDRVLVCGNKTIVF 281


>gi|300789373|ref|YP_003769664.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
 gi|299798887|gb|ADJ49262.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
          Length = 280

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 118/279 (42%), Positives = 175/279 (62%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLF 60
           ++ LT+ CP    I   +  +L  QGC+I++  QF+D     LF+R SF     T +   
Sbjct: 2   TFTLTLKCPERSGIVHAVTTFLVGQGCDIVEHQQFDDDVRGSLFLRTSFTCTEETTVDDL 61

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F P+   F +++   +     + L++VS+  HCLNDLL+RW  G L   I  VVSNH
Sbjct: 62  TRAFAPVAGDFGMEFGFSDGTP-PRILVMVSKFGHCLNDLLFRWRAGGLGAEIAVVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + + E   +PF ++P+T + K E+EQ+L++++ +   +L++LARYMQ+LS+ LC K+
Sbjct: 121 EDLRPMAEAAGVPFVHVPVTPETKPEAEQRLLDLVGEYEADLIVLARYMQVLSNELCQKL 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QAY+ GVK +GATAHY   +LD GPIIEQ+V RV H  
Sbjct: 181 EGRAINIHHSFLPGFKGAKPYHQAYDRGVKYVGATAHYVTPDLDEGPIIEQEVQRVDHTY 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  + + +G++ EA  L++AV  H ++RV +N   T+VF
Sbjct: 241 SPRELVTVGRDAEALALSRAVRWHCERRVLLNGNSTVVF 279


>gi|254522129|ref|ZP_05134184.1| formyltetrahydrofolate deformylase [Stenotrophomonas sp. SKA14]
 gi|219719720|gb|EED38245.1| formyltetrahydrofolate deformylase [Stenotrophomonas sp. SKA14]
          Length = 283

 Score =  287 bits (734), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 119/277 (42%), Positives = 174/277 (62%), Gaps = 2/277 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLFIA 62
           ILT++CP    I   +   L   GCNILD  QF D ++ + F+R+ F  +  +      A
Sbjct: 6   ILTLSCPDRTGIVYRVSGLLFDHGCNILDAQQFGDEESGRFFLRVHFDRDASLPLDTVHA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               +   + + + + + +   + L+LVS+  HCLNDLL+R + G L ++I  V SNH  
Sbjct: 66  AMAALAADYGMDWQLHDGRRRARLLVLVSKQGHCLNDLLFRAHSGQLKVDIAAVASNHAD 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  +YQ+PF++LP+    +   EQ++I+++E+  ++L++LARYMQILS  LC  + G
Sbjct: 126 FAPLAASYQVPFHHLPVNADTRAVQEQQIIDLVERERIDLVVLARYMQILSPTLCRALAG 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           R INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV HA   
Sbjct: 186 RAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQDVARVDHAMAP 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + + +G + E+ VL +AV  H++ R+ +N  +T+VF
Sbjct: 246 RELVRLGSDTESLVLARAVRRHVEHRILLNGHRTVVF 282


>gi|77165265|ref|YP_343790.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani ATCC
           19707]
 gi|254434870|ref|ZP_05048378.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani AFC27]
 gi|76883579|gb|ABA58260.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani ATCC
           19707]
 gi|207091203|gb|EDZ68474.1| formyltetrahydrofolate deformylase [Nitrosococcus oceani AFC27]
          Length = 283

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           S + L I+CP    I + +  ++++ G  I + S ++D  +   FMR           +K
Sbjct: 3   SEFRLIISCPDRVGIVAEVSSFIASYGGWINEASHYSDPVSGWFFMRHCIRSSSLPFGIK 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI +++ +++S+ ++    + +++ S+  HCL DLL+RW+   L  +I  V+S
Sbjct: 63  AFKDKFSPIAEKYKMKWSLFDSSMKKRIVLMASRESHCLVDLLHRWHSKELYCDIRCVIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+LV+ Y  P++++P + ++K  + +++I ++E N  +L++LARYMQIL   +C 
Sbjct: 123 NHEHLKRLVDAYGAPYHFVPTSRKSKENAFERIIQLVEDNQADLIVLARYMQILPGDICD 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLPSF GA PY QA E GVK+IGAT HY    LDAGPII+QDV+R+TH
Sbjct: 183 TYQNRIINIHHSFLPSFVGAKPYHQASERGVKLIGATCHYVTEALDAGPIIDQDVMRITH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T+ED I +G+++E  VL + V +H++ RV ++  KTIVF
Sbjct: 243 HNTVEDMIRLGRDVEKLVLARGVRSHLEDRVLVHGNKTIVF 283


>gi|332704185|ref|ZP_08424273.1| formyltetrahydrofolate deformylase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554334|gb|EGJ51378.1| formyltetrahydrofolate deformylase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 286

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 115/283 (40%), Positives = 174/283 (61%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCM 57
           ++  L ITCP    I + +  +L +   NI  + Q + D +    FMR+ F     +   
Sbjct: 5   TTARLLITCPDKPGIVAAVTGFLYSHNVNINTLDQHSSDPEGGNFFMRLEFQTPHLDISK 64

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                 F  +   +F + + I    E  K  ILVS+ DHCL +LL+RW+ G L  +I  V
Sbjct: 65  PALEKAFGEVVAPRFDMHWRIHYAWERKKMAILVSRWDHCLLELLWRWSRGELHCDISMV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VE++ +PF+++P+ ++N+ E++Q ++ +++    + ++LARYMQIL    
Sbjct: 125 ISNHPDLREAVESFGVPFHHIPIIKENRHEADQAMLKLLDGQ-ADFVVLARYMQILPKEF 183

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
               + RIINIHHSFLP+F GA+PY+QAYE GVKIIGATAHY   ELDAGPIIEQDV RV
Sbjct: 184 VAPYSRRIINIHHSFLPAFIGADPYRQAYERGVKIIGATAHYVTEELDAGPIIEQDVARV 243

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   IE    +G+++E +VL +AV  H+  R+ ++  KT+VF
Sbjct: 244 SHRYNIEALKDLGRDLERQVLARAVRCHVDDRIIVDGNKTVVF 286


>gi|159489056|ref|XP_001702513.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158280535|gb|EDP06292.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 289

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 109/277 (39%), Positives = 163/277 (58%), Gaps = 6/277 (2%)

Query: 9   TCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT------CMKLFIA 62
           +CP  + + + +   L   GCNI+   QF D  +   F RI+F F+          +   
Sbjct: 11  SCPDQKGVIAAVSQLLYGFGCNIVASDQFTDSSSGMFFQRITFDFSEIVIGPGNTAVLER 70

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
               +  +F++++ I    +  +  +LVS+ DHCL DLL R   G L   I  ++SNH  
Sbjct: 71  AIAELANRFNMKWKIAYKNKVKRMAVLVSKQDHCLYDLLIRLRSGELRCEIPFIISNHPD 130

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K + + + +PF +LP+ + NK   E+ L  +I++  ++++ILARYMQI +   C +   
Sbjct: 131 LKHIADTFNVPFVHLPLDKNNKEAQEEALEKLIKEEKIDVVILARYMQIFTQGFCERHWE 190

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
             INIHHSFLP+F+GA PY +A+E GVKIIGATAH+A  ELDAGPII+Q V R+TH   +
Sbjct: 191 HTINIHHSFLPAFEGARPYHRAHERGVKIIGATAHFATAELDAGPIIDQAVARITHRDNV 250

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ED I  G+++E  VL +AV  H+  RV +   KT+VF
Sbjct: 251 EDMIRKGRDLERMVLARAVRWHLDDRVMVYNNKTVVF 287


>gi|145589336|ref|YP_001155933.1| formyltetrahydrofolate deformylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047742|gb|ABP34369.1| formyltetrahydrofolate deformylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 284

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 129/282 (45%), Positives = 184/282 (65%), Gaps = 3/282 (1%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK 58
           M++  Y LT+TCP+   I + +  Y+   G +I +  QF+D  + + FMR+SF   T   
Sbjct: 1   MTTENYYLTLTCPNKPGIIAAVSTYIFQAGGDIEEAQQFDDKASKQFFMRVSFSCPTDGN 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F  I ++F L + +R  K+  + LI+ S+ DHCL DLLYRW IG L + I G+VS
Sbjct: 61  TLRSGFIEIAKRFELTWDLRAVKDLKRVLIMASKLDHCLVDLLYRWRIGELPMIICGIVS 120

Query: 119 NHTTH-KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PFY+LP+T + K   E KL+ II  N V+++ILARYMQILSD+L 
Sbjct: 121 NHPREVYASIDFADIPFYHLPVTAETKPAQEAKLLEIIADNKVDMVILARYMQILSDNLS 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR IN+HHSFLPSFKGA PY QA+  G+K+IGATAH+   +LD GPIIEQDV RVT
Sbjct: 181 SELSGRCINVHHSFLPSFKGAKPYHQAHARGIKLIGATAHFVTSDLDEGPIIEQDVTRVT 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T ED +  G+++E  VL++A+  ++  RV IN   ++VF
Sbjct: 241 HGDTPEDLVRKGRDLERTVLSRALRYYLHDRVLINGATSVVF 282


>gi|307295747|ref|ZP_07575580.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
 gi|306878403|gb|EFN09624.1| formyltetrahydrofolate deformylase [Sphingobium chlorophenolicum
           L-1]
          Length = 285

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 129/283 (45%), Positives = 177/283 (62%), Gaps = 4/283 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMK 58
           MS  Y L ++CP    I S +   L + G NI +  QF+D +T K FMR+   F     +
Sbjct: 1   MSEEYYLKLSCPDRPGIVSAVSTALFSAGANISEAQQFDDPETGKFFMRVVARFVEGDAE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F + F+    +F + +S+R   +  K + LVS+ DHCL  LLY   IG + +++V ++S
Sbjct: 61  SFRSAFEATAGRFGMDWSLRAASQRRKVVALVSKFDHCLGHLLYASRIGEIDMDVVAIIS 120

Query: 119 NHTTHKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           NH   K  ++++   +P++Y P+T   K E E ++   I     EL+ILARYMQILSD L
Sbjct: 121 NHPKEKLTIKSWLEDIPYHYFPVTADTKAEQEARIKETISATGAELVILARYMQILSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
              ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V
Sbjct: 181 ASYLSGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEPV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +HA T ED +  G++IE +VL++AV  HIQ RVFIN  KT+VF
Sbjct: 241 SHADTPEDLVRKGRSIEQRVLSQAVLHHIQDRVFINANKTVVF 283


>gi|319652410|ref|ZP_08006526.1| YkkE protein [Bacillus sp. 2_A_57_CT2]
 gi|317395872|gb|EFV76594.1| YkkE protein [Bacillus sp. 2_A_57_CT2]
          Length = 299

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 109/279 (39%), Positives = 173/279 (62%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCMKLF 60
            L I CP    I + +  +L     NI++ SQ+  + +    F+RI F      +  +  
Sbjct: 21  RLLINCPDQPGIVAAVSKFLFQHDANIIESSQYSTNPEGGTFFIRIEFECPGLQSKEEEL 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F+ I + FS+++ +    E  KT I VS+  HCL +LL+ W  G L  +I  +VSNH
Sbjct: 81  KSQFKEIAETFSMEWKLAFVYELKKTAIFVSKELHCLRELLWEWQSGDLLTDIALIVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++ E+  +PF Y+P +++N++E E++ + ++++ +++L+ILARYMQIL+       
Sbjct: 141 EEAREIAESLHIPFSYIPASKENRVEVEERQLQLLKEFDIDLIILARYMQILTPAFVGAH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA PY +A++ GVKIIGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 PFKIINIHHSFLPAFVGARPYDRAHQRGVKIIGATSHYVTNDLDEGPIIEQDIKRVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            I+D    G++IE  VL +AV  H++ R+ +++ KTIVF
Sbjct: 261 HIDDLKKSGRSIERSVLARAVKWHLEDRIIVHENKTIVF 299


>gi|158337630|ref|YP_001518805.1| formyltetrahydrofolate deformylase [Acaryochloris marina MBIC11017]
 gi|158307871|gb|ABW29488.1| formyltetrahydrofolate deformylase [Acaryochloris marina MBIC11017]
          Length = 284

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 105/285 (36%), Positives = 166/285 (58%), Gaps = 6/285 (2%)

Query: 1   MS--SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNT 55
           MS  +  L I+CP  + + + I  +++T   NI+      D        R+ +    F  
Sbjct: 1   MSAPTATLLISCPDQQGLVAKIAHFIATHHGNIIHADHHTDFTNQLFLSRLEWSLEGFQL 60

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                   F  + +     + +  +    +  I VS+ DHCL DLL+R   G L + I  
Sbjct: 61  SRSQIGTQFSELAESLRANWQLHFSDCKPRMSIWVSKQDHCLLDLLWRQQAGDLPVEIPL 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH T + + E + + FY+LP+ +++K   E++ + ++++ N++L++LA+YMQILS  
Sbjct: 121 IISNHDTLQPIAEQFNIDFYHLPINKESKARQEKQQLALLKQYNIDLVVLAKYMQILSPQ 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
                +   INIHHSFLP+F GANPY++AY+ GVKIIGATAHY   ELD GPIIEQ+VVR
Sbjct: 181 FIAAFS-STINIHHSFLPAFPGANPYQRAYKRGVKIIGATAHYVTEELDEGPIIEQEVVR 239

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V+H  + +++I  GK++E   L +AV  H+Q RV +   +T+VF 
Sbjct: 240 VSHRDSSDEFIRKGKDVERSALARAVRLHLQNRVLVYNHRTVVFD 284


>gi|315497228|ref|YP_004086032.1| formyltetrahydrofolate deformylase [Asticcacaulis excentricus CB
           48]
 gi|315415240|gb|ADU11881.1| formyltetrahydrofolate deformylase [Asticcacaulis excentricus CB
           48]
          Length = 292

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 131/282 (46%), Positives = 179/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
           S Y+L I CP    I + +  YL+    +I++ +QFND      ++R+ F         M
Sbjct: 10  SHYVLIIKCPDTRGIVAAVSGYLNDNDISIVESNQFNDSQGDMFYVRVVFKQAGARMPPM 69

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            +    F+PI  +FS+++ I N     + +I VS+  HCL +LL+RW  G L + I  VV
Sbjct: 70  SILREGFKPIAHRFSMEWDIHNLSVRPRVVIAVSKFGHCLYELLHRWRSGLLPVEIAAVV 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +  VE   LP+ +LP+T+  K E E + +++IE +  +L++LARYMQILSD   
Sbjct: 130 SNHEDMRSFVEWNGLPYVHLPITKDTKAEQEAQFLSLIETHQADLVVLARYMQILSDEFS 189

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLPSFKGA PY QA++ GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 190 RRLEGRCINIHHSFLPSFKGAKPYHQAHQRGVKIIGATAHYVTSDLDEGPIIEQDVQRVH 249

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +AIG++IEA+VL +AV  H ++RV IN  KTIVF
Sbjct: 250 HGLTPEQLVAIGQDIEARVLARAVTWHAERRVIINGGKTIVF 291


>gi|298346648|ref|YP_003719335.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 43063]
 gi|298236709|gb|ADI67841.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 43063]
          Length = 291

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 120/277 (43%), Positives = 177/277 (63%), Gaps = 1/277 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
             +LT++CP    I   +   + + G NI+  +QF DLD+   FMR+      C     +
Sbjct: 15  KLVLTLSCPDQPGIVHAVSGMVVSAGGNIIQSAQFADLDSGLFFMRVEMDV-PCAHDIRS 73

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
             + +  +F + + +     A +T+I+VS+  HCL+DLLYR    ++ +++  VV NH  
Sbjct: 74  RVETLAAEFDMAWELDEIGRALRTVIMVSKEGHCLSDLLYRVRDHSIPIDVKAVVGNHPD 133

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              +   YQ+PF  +P+T+ NK E+E++L++++    VEL++LARYMQILSD LC +M+G
Sbjct: 134 LAPIATFYQVPFILVPVTKDNKPEAERQLLDLVAAEKVELVVLARYMQILSDKLCREMSG 193

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H  T 
Sbjct: 194 RIINIHHSFLPSFKGAKPYDQAHDRGVKLIGATAHYVTADLDEGPIIEQDVSRVDHTFTA 253

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            D    G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 254 IDMRKQGQDVERRVLAQAVKWHAEHRVLMNGDRTVIF 290


>gi|288553823|ref|YP_003425758.1| formyltetrahydrofolate deformylase [Bacillus pseudofirmus OF4]
 gi|288544983|gb|ADC48866.1| formyltetrahydrofolate deformylase [Bacillus pseudofirmus OF4]
          Length = 287

 Score =  286 bits (732), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 172/282 (60%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NTCM 57
           +   L I+C     I S +  +L     NI+   QF  D +    FMRI F     +   
Sbjct: 6   NRARLLISCQDKPGIVSAVSTFLHQYDANIVQSDQFSTDPEGGMFFMRIEFDLGNSSPDF 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F  +F  +  +   ++ +       +  ILVS+ DHCL +LL+RW  G L ++I  ++
Sbjct: 66  LRFKKEFHTLADKLDFEWKMELAARKKRMAILVSKEDHCLLELLWRWRSGELQVDIPLII 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH T+K++VE+Y +PFY++P+T   K E+EQ++IN++++++V+ ++LARYMQILS    
Sbjct: 126 SNHPTNKQVVESYGIPFYHVPVTRDTKEEAEQEVINLLKQHDVDFIVLARYMQILSPTFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GANPY +A+E GVK+IGATAHY   +LD GPIIEQDV+RV 
Sbjct: 186 ESFPYRIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHYVTDDLDEGPIIEQDVLRVN 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  + ++    G+N+E   L +AV  H   +V +   KT+VF
Sbjct: 246 HRYSTQELRVAGRNVERIALARAVEWHTNDQVIVYGNKTVVF 287


>gi|255690083|ref|ZP_05413758.1| formyltetrahydrofolate deformylase [Bacteroides finegoldii DSM
           17565]
 gi|260624360|gb|EEX47231.1| formyltetrahydrofolate deformylase [Bacteroides finegoldii DSM
           17565]
          Length = 285

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 62  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDMLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH   IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 242 THKDAIEDLVNKGKDLEKIVLSRAVQKHIERKVLTYKNKTVIF 284


>gi|153004657|ref|YP_001378982.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. Fw109-5]
 gi|152028230|gb|ABS25998.1| formyltetrahydrofolate deformylase [Anaeromyxobacter sp. Fw109-5]
          Length = 286

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 109/287 (37%), Positives = 172/287 (59%), Gaps = 8/287 (2%)

Query: 1   MSSY--ILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFN 54
           M++   IL + CP    I + I  +L   G NI D  Q   D +    F R+ F     +
Sbjct: 1   MTTARAILLVQCPDRPGIVAAISSFLFRHGANITDFDQHTADEEGGVYFTRLEFQTDRLD 60

Query: 55  TCMKLFIADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
             ++     F   + + F++ + +  + +  +  +LVS+ DH + +LL+ W  G L  ++
Sbjct: 61  LPIEDLERAFALDVARPFAMDWRLTLSSQRKRIAVLVSKHDHAMLELLWTWKRGDLRGDV 120

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             VVSNH   +  VE + +PF ++P T + + ++E +L  +++    ++++LARYMQI+S
Sbjct: 121 TLVVSNHPDLRPAVEAFGVPFEHVPNTREIRPQAEARLAELLDG-RADVVVLARYMQIVS 179

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             L  +   R+INIHHSFLP+F GA+PY+QA+E GVKI+GATAHY   +LDAGPIIEQDV
Sbjct: 180 PDLVARWPNRMINIHHSFLPAFVGADPYRQAHERGVKIVGATAHYVTAQLDAGPIIEQDV 239

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            RVTH   +ED   +G+ +E +VL +AV+ H + RV ++  KT+VF 
Sbjct: 240 GRVTHRHDVEDLKRLGRELERRVLARAVHWHCEDRVIVHGNKTVVFD 286


>gi|304389643|ref|ZP_07371605.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315655196|ref|ZP_07908097.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 51333]
 gi|315656891|ref|ZP_07909778.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|304327196|gb|EFL94432.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315490451|gb|EFU80075.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii ATCC 51333]
 gi|315492846|gb|EFU82450.1| formyltetrahydrofolate deformylase [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 287

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 120/277 (43%), Positives = 177/277 (63%), Gaps = 1/277 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
             +LT++CP    I   +   + + G NI+  +QF DLD+   FMR+      C     +
Sbjct: 11  KLVLTLSCPDQPGIVHAVSGMVVSAGGNIIQSAQFADLDSGLFFMRVEMDV-PCAHDIRS 69

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
             + +  +F + + +     A +T+I+VS+  HCL+DLLYR    ++ +++  VV NH  
Sbjct: 70  RVETLAAEFDMAWELDEIGRALRTVIMVSKEGHCLSDLLYRVRDHSIPIDVKAVVGNHPD 129

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              +   YQ+PF  +P+T+ NK E+E++L++++    VEL++LARYMQILSD LC +M+G
Sbjct: 130 LAPIATFYQVPFILVPVTKDNKPEAERQLLDLVAAEKVELVVLARYMQILSDKLCREMSG 189

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQDV RV H  T 
Sbjct: 190 RIINIHHSFLPSFKGAKPYDQAHDRGVKLIGATAHYVTADLDEGPIIEQDVSRVDHTFTA 249

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            D    G+++E +VL +AV  H + RV +N  +T++F
Sbjct: 250 IDMRKQGQDVERRVLAQAVKWHAEHRVLMNGDRTVIF 286


>gi|237718340|ref|ZP_04548821.1| formyltetrahydrofolate deformylase [Bacteroides sp. 2_2_4]
 gi|229452273|gb|EEO58064.1| formyltetrahydrofolate deformylase [Bacteroides sp. 2_2_4]
          Length = 284

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 1   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 60

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 61  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDMLARYTAGEWNVEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 121 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 181 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH   IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 241 THKDAIEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 283


>gi|22417102|gb|AAM96665.1| probable formyltetrahydrofolate deformylase [Sphingobium
           chlorophenolicum L-1]
          Length = 285

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 129/283 (45%), Positives = 177/283 (62%), Gaps = 4/283 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF-NTCMK 58
           MS  Y L ++CP    I S +   L + G NI +  QF+D +T K FMR+   F     +
Sbjct: 1   MSEEYYLKLSCPDRPGIVSAVSTALFSAGANISEAQQFDDPETGKFFMRVVARFVEGDAE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F + F+    +F + +S+R   +  K + LVS+ DHCL  LLY   IG + +++V ++S
Sbjct: 61  SFRSAFEAPAGRFGMDWSLRAASQRRKVVALVSKFDHCLGHLLYASRIGEIDMDVVAIIS 120

Query: 119 NHTTHKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           NH   K  ++++   +P++Y P+T   K E E ++   I     EL+ILARYMQILSD L
Sbjct: 121 NHPKEKLTIKSWLEDIPYHYFPVTADTKAEQEARIKETISATGAELVILARYMQILSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
              ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V
Sbjct: 181 ASYLSGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEPV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +HA T ED +  G++IE +VL++AV  HIQ RVFIN  KT+VF
Sbjct: 241 SHADTPEDLVRKGRSIEQRVLSQAVLHHIQDRVFINANKTVVF 283


>gi|90022021|ref|YP_527848.1| formyltetrahydrofolate deformylase [Saccharophagus degradans 2-40]
 gi|89951621|gb|ABD81636.1| formyltetrahydrofolate deformylase [Saccharophagus degradans 2-40]
          Length = 293

 Score =  286 bits (731), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 135/282 (47%), Positives = 183/282 (64%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI---SFVFNTCMK 58
           S  IL  +C     I + +    S QG NI + SQF D+ T + FMR    S      + 
Sbjct: 11  SELILKFSCDDQPGIVASVASLFSLQGFNIRESSQFEDVSTRRFFMRTLLESVEGPKSLA 70

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             ++ FQ +  ++ + + + +  E TK LI VSQ  HCL++LL  W  G L ++IVGVVS
Sbjct: 71  DVMSAFQSVADRYKMTWELTDAAEKTKVLIAVSQWGHCLDNLLNGWKRGYLPVDIVGVVS 130

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K L E Y +PF+YLP+T   K + EQ+++++++ +  +L++LARYMQILSD LC 
Sbjct: 131 NHEVMKPLCEWYGVPFHYLPVTADTKPQQEQQILDVMDSSEADLLVLARYMQILSDDLCK 190

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   ELD GPIIEQ V RV+H
Sbjct: 191 KLEGRAINIHHSFLPGFKGARPYHQAYERGVKLIGATAHYVTAELDEGPIIEQAVERVSH 250

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           A T E+ + IG++ EA VL +AV  H ++RV +N +KT+VF 
Sbjct: 251 ANTPEELVEIGRDSEAVVLQRAVRWHAERRVLLNGKKTVVFN 292


>gi|296134953|ref|YP_003642195.1| formyltetrahydrofolate deformylase [Thiomonas intermedia K12]
 gi|295795075|gb|ADG29865.1| formyltetrahydrofolate deformylase [Thiomonas intermedia K12]
          Length = 291

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 126/284 (44%), Positives = 173/284 (60%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
            ++LT++CP    I   +   L   GCNI+D  Q+ D DT   FMR+ F     ++    
Sbjct: 7   EFVLTLSCPDAPGIVHSVSGLLYQAGCNIMDSQQYGDADTGLFFMRVHFSAPEHLQDAAQ 66

Query: 63  D---FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + ++F +Q    + +   K +I VSQ  HCLNDLLYRW  G LA++I  VVSN
Sbjct: 67  LALLFGDVRKRFDMQAQFHDLRIRPKVVIAVSQYGHCLNDLLYRWKAGQLAMDIAAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTE----QNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           HTT   L  +Y + F++LP+      + K   EQ L  +++++   L++LARYMQILS  
Sbjct: 127 HTTFADLTRSYGIEFHHLPLKAGEAAETKRAQEQALFGVMQQSGAALLVLARYMQILSAE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
            C ++ GR INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 187 FCAQLEGRAINIHHSFLPSFKGARPYAQAYARGVKLIGATAHYVTADLDEGPIIEQDVER 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  +  D  A+G+++E+ VL +AV   ++ R+  N  KT+VF
Sbjct: 247 VDHTMSAADLTAVGQDVESVVLARAVRWQVEHRILRNGHKTVVF 290


>gi|182412501|ref|YP_001817567.1| formyltetrahydrofolate deformylase [Opitutus terrae PB90-1]
 gi|177839715|gb|ACB73967.1| formyltetrahydrofolate deformylase [Opitutus terrae PB90-1]
          Length = 285

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 99/283 (34%), Positives = 156/283 (55%), Gaps = 4/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----FNTCM 57
           S+ +  +  P    + + +  ++  +G NIL   Q  D +    F R+ +       + +
Sbjct: 3   STLVALLHGPDQPGLVARVAGWIYERGGNILHADQHRDREAGIFFQRVEWEPLAASGSGL 62

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 FQ       ++  + ++    + ++ VS+ DHC +DL  RW  G  +  +  V+
Sbjct: 63  SASAEAFQVFAASLGMEARLTSSDHRARVVVFVSKADHCFHDLALRWRAGEFSGELAAVI 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +     Y LPF++LP+T   K  +E + +  + + + +L++LARYMQ+LS    
Sbjct: 123 SNHRDLEPAARGYGLPFFHLPVTADTKAAAEAQQLAKLRELDADLVVLARYMQVLSGEFL 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++   +INIHHSFLP+F G  PY QA+  GVKIIGATAHYA  +LD GPII QDV RVT
Sbjct: 183 QQLGRPVINIHHSFLPAFAGGRPYHQAHARGVKIIGATAHYATRDLDEGPIIHQDVTRVT 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   ++D I +G+++E +VL +AV  H+  RV     KT+VF 
Sbjct: 243 HRYGVDDLIRLGRDLEKRVLAQAVRWHLDNRVLAYGNKTVVFD 285


>gi|167033112|ref|YP_001668343.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
 gi|166859600|gb|ABY98007.1| formyltetrahydrofolate deformylase [Pseudomonas putida GB-1]
          Length = 288

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 130/281 (46%), Positives = 183/281 (65%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMK 58
            +IL ++CP+   I + +  YL+  GC I +++QF+D D  + FMR  F FNT       
Sbjct: 7   HFILRVSCPAVSGIVAAVTTYLAEHGCYISEMAQFDDEDNGRFFMRAVFRFNTGVSGDTP 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F  + Q+F +Q+S+ ++    + L++VS+ DHCL+DLLYR   G L + I  VVS
Sbjct: 67  QLEAGFTDVAQRFDMQWSLHSSARPMRVLLMVSKFDHCLSDLLYRHAKGELDMQITAVVS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F YLP+T+  K E E  L+ I+E    EL++LARYMQILSD LC 
Sbjct: 127 NHLDLRPMAERQGIRFVYLPVTKDTKAEQEAALLRIVEDTGTELVVLARYMQILSDDLCR 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 187 QLSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTRDLDEGPIIEQEVQRVDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   +  +AIG++ E   L++AV  H++ RVF+N  +T++F
Sbjct: 247 AYAPDALVAIGRDTETIALSRAVKYHLEHRVFLNHDRTVIF 287


>gi|325274280|ref|ZP_08140392.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
 gi|324100597|gb|EGB98331.1| formyltetrahydrofolate deformylase [Pseudomonas sp. TJI-51]
          Length = 298

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 141/287 (49%), Positives = 218/287 (75%), Gaps = 2/287 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
           ++Y+L +TCPS   +T+ I  +LS++GCNI D +QF+D  T+  FMRI+F       ++ 
Sbjct: 6   NNYVLRVTCPSIRGVTADITSFLSSRGCNIRDSAQFDDESTNHYFMRITFRSEEGQSLED 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +FQP+V ++ +++   + +   K +++VS+  HCLNDLLYRW IG L ++IVGV+SN
Sbjct: 66  LRKEFQPLVDKYKMEFEFFDERAKRKVILMVSRFGHCLNDLLYRWGIGALPIDIVGVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +K+VE + +P++++ +T++NK E+E   + I+ +   EL++LARYMQILSD +C +
Sbjct: 126 HLDFQKVVEGHGIPYHHIKVTKENKAEAEAAQMRIVREAGAELIVLARYMQILSDEMCQQ 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKG +PYKQA+E GVK+IGAT+H+   +LD GPIIEQD+VR+THA
Sbjct: 186 MSGRIINIHHSFLPSFKGGSPYKQAFERGVKLIGATSHFVTADLDEGPIIEQDIVRITHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           Q+ EDY+++G+++E++VL +A++A++  RVF+N+ KTIVFP  P++Y
Sbjct: 246 QSPEDYVSLGRDVESQVLARAIHAYVHGRVFMNENKTIVFPPSPDSY 292


>gi|237715158|ref|ZP_04545639.1| formyltetrahydrofolate deformylase [Bacteroides sp. D1]
 gi|294648250|ref|ZP_06725787.1| formyltetrahydrofolate deformylase [Bacteroides ovatus SD CC 2a]
 gi|294810696|ref|ZP_06769344.1| formyltetrahydrofolate deformylase [Bacteroides xylanisolvens SD CC
           1b]
 gi|229444991|gb|EEO50782.1| formyltetrahydrofolate deformylase [Bacteroides sp. D1]
 gi|292636438|gb|EFF54919.1| formyltetrahydrofolate deformylase [Bacteroides ovatus SD CC 2a]
 gi|294442029|gb|EFG10848.1| formyltetrahydrofolate deformylase [Bacteroides xylanisolvens SD CC
           1b]
          Length = 284

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 173/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 1   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 60

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 61  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDILARYTAGEWNVEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+N+  ++LARYMQ++S+ +
Sbjct: 121 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHNITFIVLARYMQVISEQM 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 181 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH   IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 241 THKDAIEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 283


>gi|160882276|ref|ZP_02063279.1| hypothetical protein BACOVA_00222 [Bacteroides ovatus ATCC 8483]
 gi|260173801|ref|ZP_05760213.1| formyltetrahydrofolate deformylase [Bacteroides sp. D2]
 gi|293372882|ref|ZP_06619256.1| formyltetrahydrofolate deformylase [Bacteroides ovatus SD CMC 3f]
 gi|299146591|ref|ZP_07039659.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_23]
 gi|315922064|ref|ZP_07918304.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156112365|gb|EDO14110.1| hypothetical protein BACOVA_00222 [Bacteroides ovatus ATCC 8483]
 gi|292632171|gb|EFF50775.1| formyltetrahydrofolate deformylase [Bacteroides ovatus SD CMC 3f]
 gi|298517082|gb|EFI40963.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_23]
 gi|313695939|gb|EFS32774.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 285

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 107/283 (37%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 62  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDMLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHKITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH   IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 242 THKDAIEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|294338935|emb|CAZ87279.1| putative formyltetrahydrofolate deformylase PurU [Thiomonas sp.
           3As]
          Length = 291

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 126/284 (44%), Positives = 173/284 (60%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
            ++LT++CP    I   +   L   GCNI+D  Q+ D DT   FMR+ F     ++    
Sbjct: 7   EFVLTLSCPDAPGIVHSVSGLLYQAGCNIMDSQQYGDADTGLFFMRVHFSAPEHLQDAAQ 66

Query: 63  D---FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  + ++F +Q    + +   K +I VSQ  HCLNDLLYRW  G LA++I  VVSN
Sbjct: 67  LALLFGDVRKRFDMQAQFHDLRIRPKVVIAVSQYGHCLNDLLYRWKAGQLAMDIAAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTE----QNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           HTT   L  +Y + F++LP+      + K   EQ L  +++++   L++LARYMQILS  
Sbjct: 127 HTTFADLTRSYGIEFHHLPLKAGEAAETKRAQEQALFGVMQQSGAALLVLARYMQILSAE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
            C ++ GR INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 187 FCAQLEGRAINIHHSFLPSFKGARPYAQAYVRGVKLIGATAHYVTADLDEGPIIEQDVER 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  +  D  A+G+++E+ VL +AV   ++ R+  N  KT+VF
Sbjct: 247 VDHTMSAADLTAVGQDVESVVLARAVRWQVEHRILRNGHKTVVF 290


>gi|242280412|ref|YP_002992541.1| formyltetrahydrofolate deformylase [Desulfovibrio salexigens DSM
           2638]
 gi|242123306|gb|ACS81002.1| formyltetrahydrofolate deformylase [Desulfovibrio salexigens DSM
           2638]
          Length = 289

 Score =  285 bits (730), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 119/283 (42%), Positives = 178/283 (62%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVFN---TCM 57
           S+  LT++C     I S +  +L ++  NI+   Q + D    + F+R+ F  N     +
Sbjct: 7   STAYLTVSCKDRPGIVSAVSGFLFSKNANIIHSDQHSSDPVGGRFFLRMKFHMNGIEDGL 66

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + F  +F   +  +F ++++I       KT ILVS+ DH L DLL+R     L   I  V
Sbjct: 67  EEFRQEFAEKVADKFDMEWNINPAWIKKKTAILVSKFDHALMDLLWRAKRDELHTEITMV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   +K VE++ +PF+++P+ + NK  SE K++ ++E  N +L+ILARYMQIL+  L
Sbjct: 127 ISNHDDLRKAVESFDVPFHHVPVEKGNKEASENKILELMEG-NADLVILARYMQILTPKL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA+PY++A E GVK+IGATAHY   ELD GPIIEQDV+RV
Sbjct: 186 IDAYPNRIINIHHSFLPAFVGADPYRRAGERGVKLIGATAHYVTEELDQGPIIEQDVIRV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H    E+   +G++IE +VL++AV  H+ +RV ++  KT+VF
Sbjct: 246 SHRHDYEELKVLGRDIERQVLSRAVKWHLTERVLVDGNKTVVF 288


>gi|262408891|ref|ZP_06085436.1| formyltetrahydrofolate deformylase [Bacteroides sp. 2_1_22]
 gi|298481763|ref|ZP_06999953.1| formyltetrahydrofolate deformylase [Bacteroides sp. D22]
 gi|262353102|gb|EEZ02197.1| formyltetrahydrofolate deformylase [Bacteroides sp. 2_1_22]
 gi|295087720|emb|CBK69243.1| formyltetrahydrofolate deformylase [Bacteroides xylanisolvens XB1A]
 gi|298271985|gb|EFI13556.1| formyltetrahydrofolate deformylase [Bacteroides sp. D22]
          Length = 285

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 108/283 (38%), Positives = 173/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M++  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MTTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL D+L R+  G   + I  +
Sbjct: 62  EKIEDYFRTLYGQKYEMDFRLYFSDVKPRMAIFVSKLSHCLFDILARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+N+  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQERKEMELLAKHNITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    +IINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNKIINIHHSFLPAFVGAKPYHAAFQRGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH   IED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 242 THKDAIEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|146308474|ref|YP_001188939.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576675|gb|ABP86207.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 284

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 126/283 (44%), Positives = 181/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----C 56
           M+ YIL I+CP+   I + +  YL+ + C + +++QF+D  T + FMR  F FN      
Sbjct: 1   MNHYILKISCPATSGIVAAVTTYLAGRDCYLSELAQFDDEFTGRFFMRAVFRFNDTTRAD 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +      F  I   F++ + +  ++   + L++VS+ DHCL DLLYR + G L + I  +
Sbjct: 61  IDALRQGFDDIAVPFAMDWELFESQRPMRVLLMVSKFDHCLVDLLYRHHKGELDMQITAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + + E   + F YLP+T   K + E  L+ I+++   EL++LARYMQILSD L
Sbjct: 121 VSNHLDLRPMAEREGIRFIYLPVTRDTKAQQEAALMKIVDETQTELVVLARYMQILSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 181 CQQLSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            HA   +D +AIG++ E   L+KA+  H++ RV +N  KT++F
Sbjct: 241 DHAYLPDDLVAIGRDTETVALSKALKYHLEHRVLLNGDKTVIF 283


>gi|23100148|ref|NP_693614.1| formyltetrahydrofolate deformylase [Oceanobacillus iheyensis
           HTE831]
 gi|22778380|dbj|BAC14649.1| formyltetrahydrofolate deformylase [Oceanobacillus iheyensis
           HTE831]
          Length = 300

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 119/281 (42%), Positives = 174/281 (61%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF- 60
              L I CP  + I + +  +L  QG NI+  +Q+  D +  + FMR+ F      +   
Sbjct: 19  RARLLIKCPDKQGIVAAVSTFLHEQGANIVASNQYTVDPEGGQFFMRLEFEIKGLSEQVG 78

Query: 61  --IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQ + +   +++ I    E     I VS+  HCL +LL+ W  G L  NI  V+S
Sbjct: 79  QLKEKFQIVAEHMDMEWRIAMMSELKNVAIFVSKEPHCLLELLWEWQSGDLLANIKVVIS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH T +++VE   +PFY++P+T++ K E+E+K   I++K ++EL+ILARYMQILS H   
Sbjct: 139 NHETAREMVEAVGIPFYHIPVTKEQKKEAEEKQNQILKKYDIELIILARYMQILSPHFVE 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K   +IINIHHSFLP+F GA PY++AY+ GVK+IGAT+HY   +LD GPIIEQD+ RV H
Sbjct: 199 KYESKIINIHHSFLPAFIGAKPYERAYDRGVKMIGATSHYVTNDLDEGPIIEQDIDRVNH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            Q   D   IG++IE +VL +AV  H++ R+ ++  KTI+F
Sbjct: 259 EQDAADLKKIGQSIERRVLARAVKWHLEDRILVHGNKTIIF 299


>gi|85709524|ref|ZP_01040589.1| formyltetrahydrofolate deformylase [Erythrobacter sp. NAP1]
 gi|85688234|gb|EAQ28238.1| formyltetrahydrofolate deformylase [Erythrobacter sp. NAP1]
          Length = 289

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 165/280 (58%), Gaps = 7/280 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT-CMKLFIAD 63
           ILT+ CP    IT+ +  +L  +GCNILD  QF   +  + FMR+ F       +    D
Sbjct: 10  ILTLDCPDRPGITAKVTAFLFKRGCNILDAQQFG--EDERFFMRVVFEAGGHDSEDLRRD 67

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
           F P  Q F+++++I       + LI+VS+ DHCL DL+YRW  G L +  V +VSNH   
Sbjct: 68  FAPFAQDFAMRWTIAAQDRPRRVLIMVSKADHCLADLIYRWRTGELNIEPVAIVSNHPRE 127

Query: 124 KKL----VENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
             L     +   +PF+++P+T   K E+E  L NI E    EL++LARYMQI SD     
Sbjct: 128 VALSSGRTDIGDVPFHHVPVTPDTKAEAEAALRNIAEDVQAELVVLARYMQIFSDEQSAH 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              R INIHHSFLP FKGA PY QA+  GVKIIGATAH+   +LD GPII QDV R+TH 
Sbjct: 188 FAERCINIHHSFLPGFKGARPYHQAHRRGVKIIGATAHFVTADLDEGPIIHQDVERITHT 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  D +  G++IE +VL +AV      RV +N  +T+VF
Sbjct: 248 DSPSDLVRKGRDIERRVLAEAVRLFAGDRVLMNGARTVVF 287


>gi|209549227|ref|YP_002281144.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534983|gb|ACI54918.1| formyltetrahydrofolate deformylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 298

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 154/292 (52%), Positives = 210/292 (71%), Gaps = 6/292 (2%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC 56
           M++    Y L + CPS   +T+ I  YLS  GCNI D +QF+D DT + FMRISF     
Sbjct: 1   MTTTAPRYALRVACPSIRGVTAAIATYLSQSGCNISDSAQFDDADTGRYFMRISFQPQDG 60

Query: 57  MK--LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                    F+PI  +F       +  E  K +++VS+  HCLNDLLYRW IG L ++IV
Sbjct: 61  HTLGQLRDGFEPIADRFEANAEFFDEAEKKKVILMVSRFGHCLNDLLYRWRIGALPIDIV 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           GV+SNH  ++++V N+ +PF+ + +T +NK E+E K + I+E +  EL++LARYMQ+LSD
Sbjct: 121 GVISNHMDYQRIVVNHDIPFHCIKVTRENKPEAEAKQMQIVEGSGAELVVLARYMQVLSD 180

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            +C KM+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQD+V
Sbjct: 181 EMCRKMSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQDIV 240

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           RVTHAQ+ EDY+++G+++E++VL +A++AHI  RVFIN  KT+VFPA P +Y
Sbjct: 241 RVTHAQSGEDYVSLGRDVESQVLARAIHAHIHGRVFINGNKTVVFPASPGSY 292


>gi|25169086|emb|CAD47922.1| putative formyltetrahydrofolate deformylase [Arthrobacter
           nicotinovorans]
          Length = 287

 Score =  285 bits (729), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 110/281 (39%), Positives = 177/281 (62%), Gaps = 2/281 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL-- 59
              IL+++C     I   +  +L + GCNIL   QF+D    + FMR+       + +  
Sbjct: 7   RQVILSLSCRDRIGIVHAVSGFLVSHGCNILASQQFDDAAERRFFMRVHISCPATVSIGD 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             + F  +   + +++++ +  +  K  +LVS+ +HCLNDLL+RW  G L ++   + SN
Sbjct: 67  LKSAFLAVASTYEMEWTLVDASDRPKVALLVSKAEHCLNDLLFRWRSGQLKVDFPFIASN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T + + + + +PF+++P+T + K E+E+ L+ ++ ++ VEL +LARYMQ+LSD+LC +
Sbjct: 127 HATLQPVADAHGIPFFHIPVTPETKQEAEEHLLALLAEHEVELTVLARYMQVLSDNLCRE 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+ INIHHSFLP FKGA PY QA++ GVK++GATAHY   ELD GPIIEQ+V+RV H 
Sbjct: 187 LAGKAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTAELDEGPIIEQEVLRVGHD 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            +       G++ E   L++AV  H +QR+ +N  +T+VF 
Sbjct: 247 YSPAQLAVAGQDAERLALSRAVQWHAEQRILLNGHRTVVFN 287


>gi|237810793|ref|YP_002895244.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
 gi|237506166|gb|ACQ98484.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           MSHR346]
          Length = 293

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAETFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP     +   K   E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|326795809|ref|YP_004313629.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
 gi|326546573|gb|ADZ91793.1| formyltetrahydrofolate deformylase [Marinomonas mediterranea MMB-1]
          Length = 285

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 178/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           + Y L I+CP    I + +  +L+ +  +I++ S   D +    FMR        N  ++
Sbjct: 3   NHYRLVISCPDRVGIVAAVSQFLNERQGSIVEASHHTDPEQKWFFMRHVIDAESLNISVE 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI  QF + + + ++ +  K ++L ++  HCLND+L+RW+ G L+ +IVGV++
Sbjct: 63  EFREQFAPIADQFDMTWYVNDSADRPKVMLLATKESHCLNDILHRWHTGELSCDIVGVIA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE Y++P++ + + +++K+ + Q +   I+ +  + ++LARYMQI  ++LC 
Sbjct: 123 NHEELRSMVEWYKVPYHCIQVPKEDKMPAFQAIEKCIDDSEADTIVLARYMQIFPEYLCE 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K   R+INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H
Sbjct: 183 KYRHRVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T  D + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 243 SHTAADMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 283


>gi|258653769|ref|YP_003202925.1| formyltetrahydrofolate deformylase [Nakamurella multipartita DSM
           44233]
 gi|258556994|gb|ACV79936.1| formyltetrahydrofolate deformylase [Nakamurella multipartita DSM
           44233]
          Length = 284

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 123/284 (43%), Positives = 175/284 (61%), Gaps = 4/284 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--- 56
           M+ S++LT++CP    I   +   L+  GC+I +  QF+D    KLF+R +F        
Sbjct: 1   MTGSFVLTLSCPEQPGIVHAVTTVLNDHGCDITEHQQFDDPMNGKLFLRTAFTAPAGGCV 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                  F  I   F++ + + +    T+ LI+ S+ DHCL DLLYRW  G+L   +  V
Sbjct: 61  ADALRTGFASIADAFAMTWQLHDATHRTRILIMASKFDHCLTDLLYRWRTGSLGGQVAAV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     L +  ++PF ++P+T  +K  +E  L+ +I++ +++L++LARYMQ+LSD L
Sbjct: 121 VSNHQDLAHLADTARVPFVHIPVTADSKPAAEHHLLQVIDQQDIDLVVLARYMQVLSDPL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHSFLPSF GA PY QAYE GVK +GATAHY   ELD GPIIEQ++ RV
Sbjct: 181 CRTLHGRAINIHHSFLPSFTGAKPYHQAYERGVKYVGATAHYVTAELDEGPIIEQELTRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            H +  ED IA+G++ E   L +AV  H Q R+ +N  +TIVF 
Sbjct: 241 DHRRAPEDLIAVGRDAERLALARAVTWHCQHRILLNGNRTIVFN 284


>gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040588|gb|ACT57384.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 288

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF
Sbjct: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH
Sbjct: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM
Sbjct: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ
Sbjct: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ 288
           TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
Sbjct: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ 288


>gi|325285270|ref|YP_004261060.1| formyltetrahydrofolate deformylase [Cellulophaga lytica DSM 7489]
 gi|324320724|gb|ADY28189.1| formyltetrahydrofolate deformylase [Cellulophaga lytica DSM 7489]
          Length = 281

 Score =  284 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 111/279 (39%), Positives = 174/279 (62%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRIS--FVFNTCMKLF 60
              + I CP    I S + +++ T+G NI+ I Q+ D +++  FMR+   F     +  F
Sbjct: 2   KLTILINCPDQAGIISTVTNFIHTKGGNIVYIDQYVDKESATFFMRLESEFSNALTLNEF 61

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F+ +   + +++ +       K  I VS+ DHCL DLL R++ G LA++I  ++SNH
Sbjct: 62  KSGFKTLAPTYQMKWEVYKEVTVPKMAIFVSKYDHCLYDLLSRYSSGELAVDIPLIISNH 121

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K +   + +PFY++P+T+  K E+E+K + ++ + NV+ ++LARYMQI+S  +  + 
Sbjct: 122 DKAKNIANQFNIPFYHIPVTKATKKEAEEKQLALLSEYNVDFIVLARYMQIVSQTVIDQY 181

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   +LD GPII+QDV  V+H  
Sbjct: 182 PNKIINIHHSFLPAFAGAKPYHAAYKRGVKIIGATSHYVTADLDEGPIIDQDVTTVSHTH 241

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +I D IA G+++E  VL + V  HI+++  +   KTIVF
Sbjct: 242 SITDLIAKGRDLEKIVLARGVKLHIERKTMVFNNKTIVF 280


>gi|53718182|ref|YP_107168.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           K96243]
 gi|76809709|ref|YP_332190.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|126439130|ref|YP_001057643.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126452460|ref|YP_001064889.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|134279777|ref|ZP_01766489.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|167718040|ref|ZP_02401276.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei DM98]
 gi|167737056|ref|ZP_02409830.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 14]
 gi|167814165|ref|ZP_02445845.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 91]
 gi|167822687|ref|ZP_02454158.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 9]
 gi|167844262|ref|ZP_02469770.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           B7210]
 gi|167892772|ref|ZP_02480174.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 7894]
 gi|167901267|ref|ZP_02488472.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei NCTC
           13177]
 gi|167909484|ref|ZP_02496575.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 112]
 gi|217419672|ref|ZP_03451178.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|226199523|ref|ZP_03795080.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242314278|ref|ZP_04813294.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|254181845|ref|ZP_04888442.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|254187777|ref|ZP_04894289.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254196387|ref|ZP_04902811.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|254259682|ref|ZP_04950736.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
 gi|254296105|ref|ZP_04963562.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
 gi|52208596|emb|CAH34532.1| putative formyltetrahydrofolate deformylase [Burkholderia
           pseudomallei K96243]
 gi|76579162|gb|ABA48637.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710b]
 gi|126218623|gb|ABN82129.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 668]
 gi|126226102|gb|ABN89642.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106a]
 gi|134248977|gb|EBA49059.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 305]
 gi|157805779|gb|EDO82949.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 406e]
 gi|157935457|gb|EDO91127.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pasteur 52237]
 gi|169653130|gb|EDS85823.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei S13]
 gi|184212383|gb|EDU09426.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 1655]
 gi|217396976|gb|EEC36992.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei 576]
 gi|225928404|gb|EEH24434.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           Pakistan 9]
 gi|242137517|gb|EES23919.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1106b]
 gi|254218371|gb|EET07755.1| formyltetrahydrofolate deformylase [Burkholderia pseudomallei
           1710a]
          Length = 293

 Score =  284 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 181/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R+  G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYRTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP     +   K   E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|146308487|ref|YP_001188952.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
 gi|145576688|gb|ABP86220.1| formyltetrahydrofolate deformylase [Pseudomonas mendocina ymp]
          Length = 288

 Score =  284 bits (728), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 187/281 (66%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMK 58
            +I+ I+CP+   I + +  YL+ +GC I ++SQF+D  + + FMR  F FN      + 
Sbjct: 7   HFIIKISCPAASGIVAAVTTYLADRGCYISEMSQFDDETSGRFFMRAVFRFNDRYEGDID 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  + Q+F +++++ +T +  + L++VS+ DHCL DLLYR + G L + I  +VS
Sbjct: 67  EVEQGFVAVAQRFEMEWALHSTAQPMRVLLMVSKYDHCLVDLLYRHHKGELDMQITAIVS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F YLP+T+ +K + E  L+ I+++   EL++LARYMQILSD LC 
Sbjct: 127 NHLELRPMAEREGIRFIYLPVTKDSKAQQEAALMKIVDETQTELVVLARYMQILSDDLCK 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 187 QLSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           A   +D +AIG++ E   L+KAV  H++ RVF+N  +T++F
Sbjct: 247 AYLPDDLVAIGRDTETVALSKAVKYHLEHRVFLNGERTVIF 287


>gi|254473959|ref|ZP_05087352.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
 gi|211956848|gb|EEA92055.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
          Length = 285

 Score =  284 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 124/284 (43%), Positives = 197/284 (69%), Gaps = 5/284 (1%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM 57
           M++   Y+LT++C   + I + + + +++Q CNI + +Q+ D +T++ FMRISF     M
Sbjct: 1   MNTQANYVLTLSCGDRKGIVAAVANSIASQNCNICESAQYGDPETNRFFMRISFNAPEGM 60

Query: 58  --KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             + F   F P+   +   + + +  +  + L+LVSQ  HCLNDLLYR + G L +++V 
Sbjct: 61  TKEQFEEGFGPVATGYGFDWKVHDLSKKPRVLVLVSQMGHCLNDLLYRNSTGQLPMDLVA 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V SNHT ++  VE+ Q+PF+YLP+T++ K E E +++ ++E+ N++L+ILARYMQILS+ 
Sbjct: 121 VASNHTKYQSRVEHEQIPFHYLPVTKETKAEQEAQIVELVERENIDLVILARYMQILSNE 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC ++ G++INIHHSFLPSF GA PY +A+  GVK++GATAHY   +LD GPIIEQDV R
Sbjct: 181 LCERLAGKVINIHHSFLPSFIGAKPYHRAHARGVKMVGATAHYVTADLDEGPIIEQDVSR 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V H  ++ + IA G++ E++VL +AV  H++ R+ +N  +T++F
Sbjct: 241 VEHFHSVNELIAQGRDTESQVLARAVRYHLEHRILLNGDRTVIF 284


>gi|258404656|ref|YP_003197398.1| formyltetrahydrofolate deformylase [Desulfohalobium retbaense DSM
           5692]
 gi|257796883|gb|ACV67820.1| formyltetrahydrofolate deformylase [Desulfohalobium retbaense DSM
           5692]
          Length = 289

 Score =  284 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 116/283 (40%), Positives = 175/283 (61%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCM 57
           ++  L ITCP    I + +  +L   G NI  + Q   D +    FMR+ F     +   
Sbjct: 7   TTARLLITCPDRPGIVAAVTGFLYAHGANINTLDQHTTDPEGGTFFMRLEFQTPHLDLSR 66

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                 F  +  ++F++ + I    +  KT +LVS+ +H L DLL+RW  G L  +I  V
Sbjct: 67  PALEHAFAEVVAERFAMDWRIAYAADRKKTAVLVSRHEHGLMDLLWRWVRGELYTDISMV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VE++ +PF+++P+   +K E+EQ+++ +++    +L+ILARYMQILS   
Sbjct: 127 ISNHPDWREAVESFGVPFHHIPVDSASKEEAEQQMLELLDGQ-ADLVILARYMQILSPDF 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA+PY+QA E GVK+IGATAHY   ELDAGPIIEQDV+RV
Sbjct: 186 VAAFPQRIINIHHSFLPAFAGADPYRQAAERGVKLIGATAHYVTAELDAGPIIEQDVIRV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  T  D  A+G++IE +VL++AV  H++ ++     +T+VF
Sbjct: 246 SHRHTTADLKALGRDIERQVLSRAVKWHLEDKIIPFANQTVVF 288


>gi|323700667|ref|ZP_08112579.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. ND132]
 gi|323460599|gb|EGB16464.1| formyltetrahydrofolate deformylase [Desulfovibrio desulfuricans
           ND132]
          Length = 293

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 114/285 (40%), Positives = 170/285 (59%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF-----VFNT 55
           S+  L ITCP    I + +  YL  +  NI+   Q   D +  + FMR  F       + 
Sbjct: 7   STVRLLITCPDQPGIVAAVSGYLHRKNANIIHSDQHSTDPEGGRFFMRNEFFLPGLDMDG 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +L     + +   F + +S+       + +IL S+ DH L +LL+RW  G L   +  
Sbjct: 67  LEELRREFAEEVTNGFVMDWSLNPVWVPKRMVILCSKVDHALMELLWRWKRGDLDAEVAM 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINI-IEKNNVELMILARYMQILSD 174
           V+SNH T ++ VEN+ +PF+++P+    + + + +   I +    V+L++LARYMQIL+ 
Sbjct: 127 VISNHPTLQREVENFDVPFHHVPVGPSLRDKVKAEDTMIELMNGQVDLIVLARYMQILTS 186

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
               +   RIINIHHSFLP+F GA+PY++AYE GVK+IGATAHY   +LD GPIIEQDV+
Sbjct: 187 DFVKRYPSRIINIHHSFLPAFVGADPYRRAYERGVKLIGATAHYVTEKLDEGPIIEQDVI 246

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RVTH+ T++D   +G +IE  VL +AV  H++ RV ++  KTIVF
Sbjct: 247 RVTHSHTVDDLKRLGGDIERHVLARAVKWHLEDRVIVDGNKTIVF 291


>gi|53724066|ref|YP_104585.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|67643417|ref|ZP_00442163.1| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|121601300|ref|YP_991418.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124385368|ref|YP_001027506.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126448392|ref|YP_001082472.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|167001023|ref|ZP_02266824.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
 gi|254174886|ref|ZP_04881547.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|254201672|ref|ZP_04908036.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|254207004|ref|ZP_04913355.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|254357483|ref|ZP_04973757.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|52427489|gb|AAU48082.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 23344]
 gi|121230110|gb|ABM52628.1| formyltetrahydrofolate deformylase [Burkholderia mallei SAVP1]
 gi|124293388|gb|ABN02657.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10229]
 gi|126241262|gb|ABO04355.1| formyltetrahydrofolate deformylase [Burkholderia mallei NCTC 10247]
 gi|147747566|gb|EDK54642.1| formyltetrahydrofolate deformylase [Burkholderia mallei FMH]
 gi|147752546|gb|EDK59612.1| formyltetrahydrofolate deformylase [Burkholderia mallei JHU]
 gi|148026547|gb|EDK84632.1| formyltetrahydrofolate deformylase [Burkholderia mallei 2002721280]
 gi|160695931|gb|EDP85901.1| formyltetrahydrofolate deformylase [Burkholderia mallei ATCC 10399]
 gi|238524769|gb|EEP88200.1| formyltetrahydrofolate deformylase [Burkholderia mallei GB8 horse
           4]
 gi|243063095|gb|EES45281.1| formyltetrahydrofolate deformylase [Burkholderia mallei PRL-20]
          Length = 293

 Score =  284 bits (727), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 182/287 (63%), Gaps = 10/287 (3%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV------FNTC 56
           S+IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+ F           
Sbjct: 6   SFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHFEQAGACGAAAA 65

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    A+F P+ + F++++ + +     + +ILVS+  HCLNDLL+R++ G L + I  +
Sbjct: 66  LDALRAEFAPLAEAFAMRWELHDAAVKPRVVILVSKIGHCLNDLLFRYHTGQLPIEISAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           VSNH    +L  +Y +PF++LP     +   K   E +++ +I+ +  +L++LARYMQIL
Sbjct: 126 VSNHKDFYQLAASYDIPFHHLPLAAGASADAKAAQEARVLEVIDGHAADLVVLARYMQIL 185

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S  LC ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+
Sbjct: 186 SPALCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGPIIEQE 245

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 246 VERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|300782378|ref|YP_003762669.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
 gi|299791892|gb|ADJ42267.1| formyltetrahydrofolate deformylase [Amycolatopsis mediterranei U32]
          Length = 288

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 161/283 (56%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
             Y++T  CP    I + I  +L+  G  I++ +   D DT   F R     +       
Sbjct: 6   RRYVITFGCPDRTGIIARISGFLAEHGGWIVEAAYHTDPDTGWFFTRQVVRADSLPFDAA 65

Query: 59  LFIADFQPIVQQFSLQ--YSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
              A F  +  + S +  + + +T E  + +ILVS+  HCL DLL R   G L +++  V
Sbjct: 66  ELRARFGEVAAELSAESSWQVSDTGERRRAVILVSKAGHCLYDLLGRVASGELDVDVAAV 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           + NH +   +   + +PF+++P    +K  +  ++  ++ +++   ++LAR+MQIL   L
Sbjct: 126 IGNHDSLADITRAHGIPFHHVPFPPGDKAGAFAQVRKLVGEHDPHAVVLARFMQILPADL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C +  GR INIHHSFLPSF GA PY QA+  GVK++GAT HY   +LDAGPIIEQDV+RV
Sbjct: 186 CREWAGRAINIHHSFLPSFIGAKPYHQAHTRGVKLVGATCHYVTADLDAGPIIEQDVIRV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  ++ED +  G++IE   L + +  H++ RV ++  +T+VF
Sbjct: 246 DHGDSVEDMVRKGRDIEKVTLARGLRWHLENRVLVHGNRTVVF 288


>gi|26988670|ref|NP_744095.1| formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
 gi|24983455|gb|AAN67559.1|AE016385_5 formyltetrahydrofolate deformylase [Pseudomonas putida KT2440]
          Length = 286

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/280 (42%), Positives = 179/280 (63%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLF 60
           + Y+L++ C     I S +  +L   G NI++  QFND D+SK FMR+S       +  F
Sbjct: 5   NQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVEIPVAGVNDF 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F  +V++++ ++  R   +  K +I+VS+ DHCL DLLYR  +G L + +VG++SNH
Sbjct: 65  NSAFGKVVEKYNAEWWFRPRTDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNH 124

Query: 121 TTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                 +     +PF+YLP+T   K   E ++ NI+ ++  +L++LARYMQILSD L   
Sbjct: 125 PREALSVSLVGDIPFHYLPVTPATKAAQESQIKNIVTQSQADLIVLARYMQILSDDLSAF 184

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPII QDV  V+H 
Sbjct: 185 LSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHR 244

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  G++IE +VL++AV   ++ R+ +N  +T+VF
Sbjct: 245 DSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 284


>gi|163787731|ref|ZP_02182178.1| formyltetrahydrofolate deformylase [Flavobacteriales bacterium
           ALC-1]
 gi|159877619|gb|EDP71676.1| formyltetrahydrofolate deformylase [Flavobacteriales bacterium
           ALC-1]
          Length = 284

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 181/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M+   L I C     I + + ++++    NI+ I Q  D + +  FMR+   F   +  +
Sbjct: 1   MNKITLQIHCQDQPNIIASVTNFMANNDGNIVYIDQHVDREQNIFFMRLECEFMSNSFSI 60

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           + F   F   + ++F L++ + + ++  K  + VS+ DHCL D+L R+N G L L I  +
Sbjct: 61  ENFKNLFNTTLAEKFKLKWRMYSAEKKPKMALFVSKYDHCLYDILGRYNSGELFLEIPFI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   K + +N+++PFY++P+T+  K E+EQ+ + +++ NN++ ++LARYMQI+S  L
Sbjct: 121 LSNHKDLKLIADNFKIPFYHVPVTKDTKDEAEQRQLELLKANNIDFIVLARYMQIVSSTL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   ELDAGPIIEQDV  V
Sbjct: 181 IDKYPNKIINIHHSFLPAFVGAKPYHSAYKRGVKIIGATSHYITEELDAGPIIEQDVAHV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H+ +I+D IA G+++E  VL+ A+  H  ++V +   KT++F
Sbjct: 241 SHSYSIKDLIAKGRDLEKIVLSNAIRLHANRKVMVYNNKTVIF 283


>gi|325961674|ref|YP_004239580.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323467761|gb|ADX71446.1| formyltetrahydrofolate deformylase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 309

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 181/281 (64%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           + Y+LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F         +
Sbjct: 29  AQYVLTLACPERPGIVRAITAFLADRGFDIVEHQQFDDHMSGKLYLRTAFTPGDKEVSAE 88

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F  +  +F ++++I + +   + L++VS+  HCLNDL++RW  G+L   I  VVS
Sbjct: 89  GLSAEFAAVADEFDMEFAIHDGRPQ-RVLVMVSKFGHCLNDLIFRWRAGSLGAEIAVVVS 147

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   LPF ++P+T   K ++E +L+ ++E+ + +L++LARYMQ+LSD L  
Sbjct: 148 NHEDLRPMAEAAGLPFIHVPVTADTKPQAEARLLELVEEYDADLVVLARYMQVLSDSLSE 207

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 208 TLRGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTADLDEGPIIEQEVFRVDH 267

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +      + +G++ E++ L++AV  H Q RV +N  +T+VF
Sbjct: 268 SLDPNALVTVGRDAESQALSRAVKWHCQHRVLLNNTRTVVF 308


>gi|306991895|pdb|3O1L|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str.
           Dc3000 At 2.20 A Resolution
 gi|306991896|pdb|3O1L|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Pspto_4314) From Pseudomonas Syringae Pv. Tomato Str.
           Dc3000 At 2.20 A Resolution
          Length = 302

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 105/282 (37%), Positives = 169/282 (59%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            ++ L I CP    I + + ++L++    I + S  +D  +   F R     +T    + 
Sbjct: 21  RTFRLVIACPDRVGIVAKVSNFLASHNGWITEASHHSDNLSGWFFXRHEIRADTLPFDLD 80

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F PI ++FS  + I ++ +  + ++  S+  HCL DLL+RW+   L  +I  V+S
Sbjct: 81  GFREAFTPIAEEFSXDWRITDSAQKKRVVLXASRESHCLADLLHRWHSDELDCDIACVIS 140

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +  VE + +P+Y++P+  ++K  +  ++  ++  +  ++++LARY QIL   LC 
Sbjct: 141 NHQDLRSXVEWHDIPYYHVPVDPKDKEPAFAEVSRLVGHHQADVVVLARYXQILPPQLCR 200

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   ELDAGPIIEQDVVRV+H
Sbjct: 201 EYAHQVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVSH 260

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             +IE+ +  G+++E  VL + + AH++ RV ++  KT+VF 
Sbjct: 261 RDSIENXVRFGRDVEKXVLARGLRAHLEDRVLVHDNKTVVFD 302


>gi|254786909|ref|YP_003074338.1| formyltetrahydrofolate deformylase [Teredinibacter turnerae T7901]
 gi|237683770|gb|ACR11034.1| formyltetrahydrofolate deformylase [Teredinibacter turnerae T7901]
          Length = 288

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 131/286 (45%), Positives = 177/286 (61%), Gaps = 7/286 (2%)

Query: 1   MSS----YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI---SFVF 53
           MS      IL  +C     I + +    S QG NI + SQF D+ T + FMR    S   
Sbjct: 1   MSQKVEELILKFSCDDQPGIVASVASLFSLQGFNIRESSQFEDVTTKRFFMRTLLESVEG 60

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +    + F  I  ++ + + + + ++  K LI VSQ  HCLN+LL  W  GTL + I
Sbjct: 61  PKSLHDVESAFHSIADRYRMDWCLCDGRKKAKVLIAVSQWGHCLNNLLNSWKRGTLPVEI 120

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           VGVVSNH   + L E Y +P++YLP+T++ K E E +++ ++     EL++LARYMQILS
Sbjct: 121 VGVVSNHEEMRSLTEWYSVPYHYLPVTKETKREQEAQILKVMGDAGAELLVLARYMQILS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D LC  + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   ELD GPIIEQ V
Sbjct: 181 DDLCRALAGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTAELDEGPIIEQAV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            RVTHA + E+ + +G++ EA VL +AV  H + R+ +N  KT+VF
Sbjct: 241 ERVTHANSPEELVELGRDTEAVVLQRAVRWHAENRILLNGGKTVVF 286


>gi|212691494|ref|ZP_03299622.1| hypothetical protein BACDOR_00986 [Bacteroides dorei DSM 17855]
 gi|237726224|ref|ZP_04556705.1| formyltetrahydrofolate deformylase [Bacteroides sp. D4]
 gi|265751768|ref|ZP_06087561.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_33FAA]
 gi|212665974|gb|EEB26546.1| hypothetical protein BACDOR_00986 [Bacteroides dorei DSM 17855]
 gi|229434750|gb|EEO44827.1| formyltetrahydrofolate deformylase [Bacteroides dorei 5_1_36/D4]
 gi|263236560|gb|EEZ22030.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_33FAA]
          Length = 285

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L + CP    I + + ++++    NI+ + Q+ D   +  FMRI +    F     
Sbjct: 3   TTAKLLLHCPDQPGILAEVTNFITINRGNIVYLDQYVDHVENIFFMRIEWEIKDFFIPKD 62

Query: 59  LFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F+ +  Q++ +++ +  +    K  I VS+  HCL D+L R+  G   + I  ++
Sbjct: 63  KIEDYFETLYAQKYEMKFRLYFSDVKPKMAIFVSKLSHCLFDMLARYTAGEWNVEIPLII 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E + +PFY  P+T++NK+E E+  + ++E++N+  ++LARYMQ++S+ + 
Sbjct: 123 SNHPDLQHVAERFGIPFYLFPITKENKMEQEKAEMELLEQHNINFIVLARYMQVISEQMI 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+T
Sbjct: 183 EAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTSELDAGPIIEQDVVRIT 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T++D ++ GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 243 HKDTVQDLVSKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|146300081|ref|YP_001194672.1| formyltetrahydrofolate deformylase [Flavobacterium johnsoniae
           UW101]
 gi|146154499|gb|ABQ05353.1| formyltetrahydrofolate deformylase [Flavobacterium johnsoniae
           UW101]
          Length = 284

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 104/283 (36%), Positives = 170/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M    + I C   + I + +  +++    NI+ I Q  D++ +  FMR+   F      +
Sbjct: 1   MQKITILIHCKDQKGIIAAVTTFIARVEGNIMYIDQHVDVEQNVFFMRLECEFANHKITI 60

Query: 58  KLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +    +F + +   F++ + + N ++  K  + VS+ DHCL D+L R++ G L + I  +
Sbjct: 61  ESLKEEFDKTLAADFNMSWDLYNQEQKPKMALFVSKYDHCLFDILGRYSAGELNVEIPVI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PF+ +P T+ NK E E K I ++++  +  ++LARYMQI++  L
Sbjct: 121 ISNHNDLRSIAERFDIPFHCVPFTKDNKEEGEAKQIELLKRYEINFIVLARYMQIITPKL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA PY  A++ GVKIIGAT+HY   ELD GPIIEQD+ RV
Sbjct: 181 IELYENRIINIHHSFLPAFPGAKPYHSAFKRGVKIIGATSHYVTEELDEGPIIEQDIARV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  ++ED+I  G+++E  VL +A+  H +++  +   KT+VF
Sbjct: 241 SHIHSVEDFIMKGRDLERIVLARAIKLHSERKTMVYSNKTVVF 283


>gi|319782725|ref|YP_004142201.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168613|gb|ADV12151.1| formyltetrahydrofolate deformylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 293

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 181/278 (65%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM--KLFI 61
           +ILT++C     I + +   L+  G NI + SQF D  T++ FMRI+F+           
Sbjct: 16  HILTLSCEDRPGIVAAVTAELAANGANIAESSQFWDRQTNRFFMRIAFISPPGSTGDSLA 75

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +  V +F ++ ++ +     K +++VS+ DH L  LLY+  +G L   +  VVSNH 
Sbjct: 76  RALESSVDRFGMKTALVDQGRRPKIIVMVSKFDHALLHLLYQIRVGWLNAEVAAVVSNHE 135

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++  E   +P+++ P T++NK E EQKL++++++   EL+ILARYMQ+ S  L  ++ 
Sbjct: 136 DARRFAELEGIPYHHWPTTKENKAEQEQKLLDLVQRTGAELVILARYMQVFSKGLSDRLF 195

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPII+Q+  RVTHA +
Sbjct: 196 GRAINIHHSFLPSFKGAKPYHQAFDRGVKLIGATAHYVTSDLDEGPIIDQETERVTHAMS 255

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A+G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 256 AEDFVAVGRDIESRVLARAVKLHLEARVMLNGHKTVVF 293


>gi|254421439|ref|ZP_05035157.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7335]
 gi|196188928|gb|EDX83892.1| formyltetrahydrofolate deformylase [Synechococcus sp. PCC 7335]
          Length = 286

 Score =  283 bits (725), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 169/281 (60%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
             YILT++CP    I + +   +S     I      +D    + F R        +  ++
Sbjct: 5   RRYILTLSCPDRVGIVAAVSTLISNNNGWINQAHHHSDQLEQRFFTRQEILADSLSFPIE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F+PI  QF + + IR++   T+ ++LVS+  HCL DLL RW    L + I  V+S
Sbjct: 65  ELRSRFEPIAAQFKMDWKIRDSTRKTRVVVLVSKSGHCLYDLLSRWKSQELEIEIACVIS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + LVE + +P+YY+P+T Q K  +  ++++  E  + ++M+LARYMQIL   +C 
Sbjct: 125 NHEVFRGLVEWHGIPYYYVPVTPQKKTAAYSQMMSYFEAVDGDVMVLARYMQILPPEMCD 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           + +G+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPII+QDV+R+ H
Sbjct: 185 RYSGKIINIHHSFLPSFVGAKPYHQAYARGVKLIGATCHYVTEDLDCGPIIDQDVLRIDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    D +  GK+IE  VL + +  HI+ RV ++K KTIVF
Sbjct: 245 SDAPRDLVRYGKDIEKTVLARGLRYHIEDRVMLHKNKTIVF 285


>gi|116194169|ref|XP_001222897.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88182715|gb|EAQ90183.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 284

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 124/279 (44%), Positives = 177/279 (63%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CMKLF 60
           ILT++CP    I   +    + +  NILD+ QF+D  + K FMR+ F  +       +  
Sbjct: 6   ILTLSCPDKPGIVHAVTGIFAREEHNILDLQQFSDPVSEKFFMRVHFGPSPRAAESTEHL 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  + + + + Y IR   +  + LI+VS+  HCLNDLL+R   G L + I  +VSNH
Sbjct: 66  RPIFDSLAEDYKMTYKIRPVSQKPRVLIMVSKIGHCLNDLLFRAKAGQLPIEIPLIVSNH 125

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                L  +Y + F++LP+T++ K   E +++++I+K+++EL++LARYMQ+LS  LC  M
Sbjct: 126 PEFAALAASYGIEFHHLPVTKETKAVQEGQILDLIKKHSIELVVLARYMQVLSPTLCEAM 185

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GRIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ V RV H+ 
Sbjct: 186 SGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRVARVDHSI 245

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                +  G NIE++VL  AV  + + RVF+N  KT+VF
Sbjct: 246 NPNGLVDEGSNIESQVLAAAVKWYAEGRVFLNGTKTVVF 284


>gi|258541648|ref|YP_003187081.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632726|dbj|BAH98701.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256635783|dbj|BAI01752.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-03]
 gi|256638838|dbj|BAI04800.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-07]
 gi|256641892|dbj|BAI07847.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-22]
 gi|256644947|dbj|BAI10895.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648002|dbj|BAI13943.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651055|dbj|BAI16989.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654046|dbj|BAI19973.1| formyltetrahydrofolate deformylase [Acetobacter pasteurianus IFO
           3283-12]
          Length = 301

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 121/279 (43%), Positives = 180/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLF 60
            +ILT +CP    I + +   L+ +G +I +  QF++ ++  LFMR++F       +   
Sbjct: 22  QFILTFSCPDQPGIVAAVTSVLAERGADITETHQFSNRESGTLFMRLAFNAPAPGGLAEI 81

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P+ ++F +   + +     + +I+VS+ DH L +LLY+  +G L  +IV +VSNH
Sbjct: 82  NDVLAPVAKRFGMNMRLHDAAVLPRIIIMVSRFDHALLNLLYQVRVGWLKADIVAIVSNH 141

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T      E   +P+Y  P+ +QNK E E KL  +I++   +L++LARYMQ+LSD L  ++
Sbjct: 142 TDSAATAEQAGIPYYCWPVNKQNKAEQEDKLRALIKETKADLVVLARYMQVLSDSLSAEL 201

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+  RVTH  
Sbjct: 202 SGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIEQETARVTHNL 261

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++EDYIA G+ +E++VL +AV  H++ RV IN  +T+VF
Sbjct: 262 SVEDYIATGRGVESQVLARAVKMHVEHRVMINGHRTVVF 300


>gi|150006331|ref|YP_001301075.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus ATCC 8482]
 gi|254881761|ref|ZP_05254471.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_3_47FAA]
 gi|294776134|ref|ZP_06741625.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus PC510]
 gi|319643728|ref|ZP_07998344.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_40A]
 gi|149934755|gb|ABR41453.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus ATCC 8482]
 gi|254834554|gb|EET14863.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_3_47FAA]
 gi|294450008|gb|EFG18517.1| formyltetrahydrofolate deformylase [Bacteroides vulgatus PC510]
 gi|317384670|gb|EFV65633.1| formyltetrahydrofolate deformylase [Bacteroides sp. 3_1_40A]
          Length = 285

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 110/282 (39%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L + CP    I + + ++++    NI+ + Q+ D   +  FMRI +    F     
Sbjct: 3   TTAKLLLHCPDQPGILAEVTNFITINKGNIVYLDQYVDHVENIFFMRIEWEIKDFFIPKN 62

Query: 59  LFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F+ +  Q++ +++ +  +    K  I VS+  HCL D+L R+  G   + I  ++
Sbjct: 63  KIEDYFETLYAQKYEMKFRLYFSDVKPKMAIFVSKLSHCLFDMLARYTAGEWNVEIPLII 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E + +PFY  P+T++NK+E E+  + ++EK+N+  ++LARYMQ++S+ + 
Sbjct: 123 SNHPDLQHVAERFGIPFYLFPITKENKMEQEKAEMELLEKHNINFIVLARYMQVISEQMI 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+T
Sbjct: 183 EAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTSELDAGPIIEQDVVRIT 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T++D ++ GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 243 HKDTVQDLVSKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|74317995|ref|YP_315735.1| formyltetrahydrofolate deformylase [Thiobacillus denitrificans ATCC
           25259]
 gi|74057490|gb|AAZ97930.1| formyltetrahydrofolate deformylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 284

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 168/281 (59%), Gaps = 3/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKL 59
           + +L I+CP    + + I D+L     NIL   Q  D +     MR+ +    FN  ++ 
Sbjct: 4   TAVLLISCPDQRGLVAAIADFLLAHRANILHADQHQDAELKLFLMRVEWDLAGFNLDLRD 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   FQPI ++F + + +  +    +  + VS+ DHCL DLLYR+  G L   +  ++SN
Sbjct: 64  FATAFQPIAERFGMTWRLAESSRKPRMAVFVSKFDHCLADLLYRYQSGELHCELPIILSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + L + Y++P+ ++ +T+++K E+EQ  + I+    ++ ++LARYMQ+LS      
Sbjct: 124 HEDTRWLADAYRVPYQHMAVTKESKHETEQIQLAILRDQKIDFIVLARYMQVLSGDFIRH 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F GA PY +A+E GVK+IGATAHY    LD GPIIEQDV R++H 
Sbjct: 184 FPNRIINIHHSFLPAFHGAKPYHRAFERGVKLIGATAHYVTETLDDGPIIEQDVARISHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
             I+D I  G ++E  VL++AV  H+  RV +   KT+VF 
Sbjct: 244 DHIDDLIHKGADLEKVVLSRAVKWHLDNRVLVYANKTVVFD 284


>gi|238028647|ref|YP_002912878.1| formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
 gi|237877841|gb|ACR30174.1| Formyltetrahydrofolate deformylase [Burkholderia glumae BGR1]
          Length = 293

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 120/292 (41%), Positives = 182/292 (62%), Gaps = 13/292 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV----- 52
           MS+   +IL ++CP    I   +  +L  +  NI+D +QF D  T + FMR+ F      
Sbjct: 1   MSTDHSFILKLSCPDKHGIVHAVSGFLFERDTNIVDSAQFGDSRTGEFFMRVHFDQASAA 60

Query: 53  -FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLAL 111
              T +      F P+ ++F++++ + +     + +ILVS+  HCLNDLL+R+  G L +
Sbjct: 61  DAGTALDTLRDAFAPLAERFAMRWELHDASIKPRVVILVSKIGHCLNDLLFRYRTGQLPI 120

Query: 112 NIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILAR 167
            I  +VSNH    +L  +Y +PF++ P     + Q K   E +++ +I++++ +L++LAR
Sbjct: 121 EIAAIVSNHKDFYQLAASYDVPFHHFPLVAGASAQAKAAQEARVLEVIDEHSADLVVLAR 180

Query: 168 YMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGP 227
           YMQILS  +C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GP
Sbjct: 181 YMQILSQDMCRRLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGP 240

Query: 228 IIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IIEQ+V RV H+ T E   AIG+++E   L +AV  H++ R+  N  KT+VF
Sbjct: 241 IIEQEVERVDHSMTPEQLTAIGRDVECVTLARAVKWHVEHRILQNGTKTVVF 292


>gi|323345497|ref|ZP_08085720.1| formyltetrahydrofolate deformylase [Prevotella oralis ATCC 33269]
 gi|323093611|gb|EFZ36189.1| formyltetrahydrofolate deformylase [Prevotella oralis ATCC 33269]
          Length = 287

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 168/284 (59%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           S+ IL + CP    I S I  +++    NI+ + Q+ D +  + FMRI +    F     
Sbjct: 3   STAILLLHCPDESGIISEITKFITDNKGNIVYLDQYVDHEDERFFMRIEWELADFQIPRG 62

Query: 59  LFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 + +  Q++ + +S+    E  +  I VS+  HCL DLL R+  G   ++I  +V
Sbjct: 63  KINEYIETLYAQRYRMTFSLYFNDERPRMAIFVSKKSHCLYDLLARYKAGEWNVDIPCIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSDH 175
           SNH   +++ E + +P+Y   + + +  + E E+  + +++K  V  ++LARYMQI++D 
Sbjct: 123 SNHENLREVAEQFGIPYYVWSVNKDHSNREEVEKAEMELLKKEKVTFVVLARYMQIITDD 182

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +       IINIHHSFLP+F G+ PY QA+E GVKIIGAT+HY   ELDAGPIIEQDVVR
Sbjct: 183 MIKVYPHHIINIHHSFLPAFVGSRPYHQAWERGVKIIGATSHYVTAELDAGPIIEQDVVR 242

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++H  T E  I  G+++E  VL++AV  HI++++     KTI+F
Sbjct: 243 ISHKDTPESLILKGRDLEKIVLSRAVTKHIERKILTYHNKTIIF 286


>gi|90420705|ref|ZP_01228611.1| formyltetrahydrofolate deformylase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334996|gb|EAS48757.1| formyltetrahydrofolate deformylase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 300

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 187/283 (66%), Gaps = 4/283 (1%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--C 56
           M+   +ILT++C     I + +   L+  G NI + +QF D  T + F+RI+F       
Sbjct: 17  MTEHAFILTLSCSDQPGIVAAVTTELADAGANIAESAQFWDRQTGRFFLRIAFTAPAAAS 76

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                    P+  +F ++ +I +     K +++VS+ DH L  LLY+  +G L   +V +
Sbjct: 77  RDALERQLAPVAARFDMKLAITDEARVPKIILMVSKFDHALLHLLYQIRVGWLRAEVVAI 136

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   ++  ++  +PF++ P+T + K E E++++ ++  ++ +L++LARYMQ+LSD+L
Sbjct: 137 VSNHEDSRRTADHEGVPFHHWPVTRETKAEQEERVLKLVRDSDADLVVLARYMQVLSDNL 196

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +++G++INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RV
Sbjct: 197 SRRLSGKVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQETERV 256

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +HA + +D++A+G+++E++VL +AV  H+++RV IN  +T+VF
Sbjct: 257 SHAMSPDDFVAVGRDVESRVLARAVKMHLERRVIINDHRTVVF 299


>gi|119356527|ref|YP_911171.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides DSM
           266]
 gi|119353876|gb|ABL64747.1| formyltetrahydrofolate deformylase [Chlorobium phaeobacteroides DSM
           266]
          Length = 288

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 107/280 (38%), Positives = 173/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
             IL ++CP    + S I  ++  +G NIL++++  D      F+RI++   +    +  
Sbjct: 8   EIILLLSCPDRPGLVSRITGFICDRGGNILNLNEHVDTGDKTFFIRIAWSIESSPLSLDE 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F P+  +    + IR + + T+  I VS+ DHCL ++L+R ++G  A++I  +VSN
Sbjct: 68  LERAFMPLALELGAAWKIRESGKKTRMAIFVSKYDHCLQEILWRHSMGEFAIDIALIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L ++Y + ++      ++K + E+  + ++E+  ++ ++LARYMQILS H   +
Sbjct: 128 HPDLKPLADHYGIDYHLFETDRKSKADVERDELALLEQYGIDTVVLARYMQILSPHFVER 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
              RIINIHHSFLP+F G NPY+QAYE GVKIIGAT+HY   +LD GPIIEQD++R+TH 
Sbjct: 188 YPSRIINIHHSFLPAFVGGNPYRQAYERGVKIIGATSHYVTEDLDEGPIIEQDIIRITHK 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + D I  G+++E  VL +A+  H + R+ +N +KT+VF
Sbjct: 248 DRLADLIRKGRDLERMVLARAIRFHAEHRILVNGKKTVVF 287


>gi|167835398|ref|ZP_02462281.1| formyltetrahydrofolate deformylase [Burkholderia thailandensis
           MSMB43]
          Length = 293

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 119/292 (40%), Positives = 183/292 (62%), Gaps = 13/292 (4%)

Query: 1   MSS---YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM 57
           MS+   +IL ++CP    I   +  +L  +G NILD +QF D  T + FMR+        
Sbjct: 1   MSTDHSFILKLSCPDRRGIVHAVSGFLLERGSNILDSAQFGDSRTGEFFMRVHAGQAGGA 60

Query: 58  KLF------IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLAL 111
                     A+F P+ +QF++++ + +     + +ILVS+  HCLNDLL+R+  G L +
Sbjct: 61  DAAAALDGLRAEFAPLAEQFAMRWELHDASVKPRVVILVSKIGHCLNDLLFRYRTGQLPI 120

Query: 112 NIVGVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILAR 167
            I  +VSNH    +L  +Y +PF++ P     +   K   E +++ +I+++  +L++LAR
Sbjct: 121 EIPAIVSNHKDFYQLAASYDIPFHHFPLAAGASADAKAAQEARVLEVIDEHAADLVVLAR 180

Query: 168 YMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGP 227
           YMQILS ++C ++ GR INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GP
Sbjct: 181 YMQILSPNMCERLAGRAINIHHSFLPSFKGAKPYYQAFDRGVKLIGATAHYVTTDLDEGP 240

Query: 228 IIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           IIEQ+V RV H+ T ++  A+G+++E   L +AV  H++ R+ +N  KT+VF
Sbjct: 241 IIEQEVERVDHSMTPDELTAVGRDVECVTLARAVKWHVEHRIVLNGTKTVVF 292


>gi|256421055|ref|YP_003121708.1| formyltetrahydrofolate deformylase [Chitinophaga pinensis DSM 2588]
 gi|256035963|gb|ACU59507.1| formyltetrahydrofolate deformylase [Chitinophaga pinensis DSM 2588]
          Length = 287

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 126/287 (43%), Positives = 173/287 (60%), Gaps = 8/287 (2%)

Query: 1   MSSYI---LTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTC 56
           M + I   L I CP    I + +  +L   G NILD SQ   D      FMR+ F     
Sbjct: 1   MQTDITGRLLICCPDRPGIVAGVSQFLFNCGANILDASQHSTDPKEGLFFMRMVFHLENT 60

Query: 57  M----KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
           +    +L     + +     +++ I  T    K  I+VS+ DHCL +LL+RW  G L ++
Sbjct: 61  LVTMEELERQFQEKVATPLKMEWRIDYTSHRKKMAIMVSRYDHCLMELLWRWRSGELPVD 120

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           I  V+SNH   +KL E++ +PFYYLP+   NK E E++ I +I+    +  +LARYMQIL
Sbjct: 121 IPLVISNHEDLRKLTEDFGIPFYYLPVNAGNKGEKEKEAIQLIQDAKADFTVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S        G+IINIHHSFLP+F GANPYK AY  GVK+IGATAHY   +LD GPII+QD
Sbjct: 181 SPSFVSTFPGKIINIHHSFLPAFAGANPYKNAYTRGVKLIGATAHYVTDDLDEGPIIDQD 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV+H   + D + +G++IE +VLT+AV AH++ RV ++  KTIVF
Sbjct: 241 VARVSHRHAVNDLVMLGRDIERQVLTRAVVAHVEDRVIVHGNKTIVF 287


>gi|212639266|ref|YP_002315786.1| formyltetrahydrofolate deformylase [Anoxybacillus flavithermus WK1]
 gi|212560746|gb|ACJ33801.1| Formyltetrahydrofolate hydrolase [Anoxybacillus flavithermus WK1]
          Length = 325

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 120/287 (41%), Positives = 180/287 (62%), Gaps = 8/287 (2%)

Query: 1   MSSY----ILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF-- 53
           M+ Y     L I+CP    I + +  +L  +G NI++ SQ+  D +    F+RI F    
Sbjct: 38  MNKYKDRARLLISCPDQPGIVAAVTTFLYEKGANIVESSQYSTDPEGGTFFLRIEFDAPN 97

Query: 54  -NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
            +   K    +F  I QQF +++ +       K  I VS+ +HCL +LL+ W  G L  +
Sbjct: 98  ISEREKAIEKEFATIAQQFEMKWRLSLHTHVKKVAIFVSKEEHCLLELLWEWQAGELLAD 157

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
              V+SNH   ++ VE++ +P+Y++P+T++ K E+E+K I ++++++V++++LARYMQIL
Sbjct: 158 FALVISNHEQMRETVESFGIPYYHIPVTKETKEEAEEKQIQLLKEHDVDVIVLARYMQIL 217

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           S H       +IINIHHSFLP+F GA PY+QAY  GVK+IGAT+HY   +LD GPIIEQD
Sbjct: 218 SPHFVATFPAQIINIHHSFLPAFVGARPYEQAYRRGVKLIGATSHYVTDDLDEGPIIEQD 277

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H   +ED   IG+ IE  VL +A+  H++ RV I++ KTIVF
Sbjct: 278 VERVDHKHHVEDLKRIGRMIEKTVLVRALKWHLEDRVIIHENKTIVF 324


>gi|88800711|ref|ZP_01116270.1| formyltetrahydrofolate deformylase [Reinekea sp. MED297]
 gi|88776575|gb|EAR07791.1| formyltetrahydrofolate deformylase [Reinekea sp. MED297]
          Length = 276

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 106/276 (38%), Positives = 165/276 (59%), Gaps = 3/276 (1%)

Query: 8   ITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKLFIADF 64
           ++CP    I + +  +L+    +IL+ +   DL+    FMR                  F
Sbjct: 1   MSCPDQVGIVARVSGFLAQYNGSILEANHHADLEQGWFFMRNEIKASSLPFGADKLAETF 60

Query: 65  QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHK 124
            PI +  ++ + + +T    + +++ S+  HCL D+L RW+ G LA +I  V+SNH   +
Sbjct: 61  APIAKDLNMSFQVTDTGAPKRIVLMCSKDSHCLADILNRWHSGDLACDIPCVISNHEDLR 120

Query: 125 KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRI 184
            LVE + +PF+++P+   NK     ++  +++  + E ++LARYMQIL + LC +   RI
Sbjct: 121 SLVEWHGIPFHHVPVDPNNKQVHFDEVERLVDAADAETVVLARYMQILPESLCQRYRHRI 180

Query: 185 INIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIED 244
           INIHHSFLPSF GA PY QA++ GVK+IGAT HY   +LDAGPII+QDVVR+TH   +ED
Sbjct: 181 INIHHSFLPSFIGARPYHQAHDRGVKLIGATCHYVTADLDAGPIIDQDVVRITHRDVVED 240

Query: 245 YIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
            + +GK+ E  VL + +  H++ RV ++  KT+VF 
Sbjct: 241 MVRLGKDCEKTVLARGLRWHLEDRVLVHGNKTVVFN 276


>gi|289209711|ref|YP_003461777.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. K90mix]
 gi|288945342|gb|ADC73041.1| formyltetrahydrofolate deformylase [Thioalkalivibrio sp. K90mix]
          Length = 284

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 104/279 (37%), Positives = 153/279 (54%), Gaps = 1/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-LFI 61
            + L+I CP    I S I   ++     I + +Q  D +    FMR  F      + L  
Sbjct: 6   RFRLSIRCPDQHGIVSRIAAAIADTEGWITEAAQHTDEEAGWFFMRWVFSLPADGEALLE 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                +  +  + + + N     + ++L S+  HCL+DLL RW+ G LA+ I  ++SNH 
Sbjct: 66  QRLASLAPELRMDWWLNNADTRPRVVLLASREPHCLSDLLARWSAGELAMEIPAILSNHR 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             + L   + +PF ++P+ +  +  +   L   +     E ++LARYMQIL   LC +  
Sbjct: 126 DLEPLAACHGIPFEHIPVPKDGRESAFATLQERLAHLEPETIVLARYMQILPPGLCAEYP 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
            RI+NIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV R+ H   
Sbjct: 186 ERILNIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTDELDAGPIIEQDVTRIRHDDG 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           ++D I  G+++E  VL + +  H++ RV  +  KTIVF 
Sbjct: 246 VQDLIRKGRDVERWVLARGLRYHLEGRVLTHGNKTIVFD 284


>gi|119475832|ref|ZP_01616184.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2143]
 gi|119450459|gb|EAW31693.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2143]
          Length = 289

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 112/282 (39%), Positives = 180/282 (63%), Gaps = 3/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            +Y L I+CP    I + +  +++    ++++ +   D+D+   FMR      +    + 
Sbjct: 8   RTYRLIISCPDKVGIVARVTQFIAEYDGSLMEANNHTDMDSQWFFMRCVISAESLKCSLL 67

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F P+  ++S+++ IR++    K ++L S   HCL DLLYRW+ G L  +I  V+S
Sbjct: 68  EFEEYFSPVADEYSMKWYIRDSMVKQKVVLLASHASHCLADLLYRWHSGELDCDIPCVIS 127

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE + +PF+++ + + N+  S QK+ +IIE++  + ++LARYMQI+   LC 
Sbjct: 128 NHENLRSMVEWHGIPFHHVIVDKNNRDASFQKVEDIIERHEADTVVLARYMQIIPPSLCK 187

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K  GR+INIHHSFLPSF GANPY++A+E GVK+IGAT+HY   +LD GPII+QDVVRV H
Sbjct: 188 KYEGRLINIHHSFLPSFIGANPYQKAFERGVKLIGATSHYVTPDLDEGPIIDQDVVRVNH 247

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
               ++ + +GK++E  VL++A+  H+  RV ++  KT+VF 
Sbjct: 248 RHNKDELVRLGKDVEKSVLSRALRNHLDDRVIVSGNKTVVFD 289


>gi|319901708|ref|YP_004161436.1| formyltetrahydrofolate deformylase [Bacteroides helcogenes P
           36-108]
 gi|319416739|gb|ADV43850.1| formyltetrahydrofolate deformylase [Bacteroides helcogenes P
           36-108]
          Length = 285

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 169/284 (59%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MKTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELTYFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F  +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFATLYAQKYEMVFRLYFSDVKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K+  E++ + ++ K+ V  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKEAKVGQEERELELLAKHKVNFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 IDAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           TH  T+ D +  GK++E  VL++AV  HI+++V   K KT++F 
Sbjct: 242 THKDTVTDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN 285


>gi|284991317|ref|YP_003409871.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
 gi|284064562|gb|ADB75500.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
          Length = 282

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 118/282 (41%), Positives = 177/282 (62%), Gaps = 4/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           MS  + LT++C     I   +  +L   GC+I++  QF+D    +LF+R +FV   +T  
Sbjct: 1   MSHPFTLTLSCQERPGIVHAVSSFLFEHGCDIVEHQQFDDALRGQLFLRTAFVCAEDTDC 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   ADFQ +  +F + Y +   +   + +++VS+  HCLNDL++RW  G L   +V VV
Sbjct: 61  ERLSADFQAVADEFGMTYQVT-GERPPRVVVMVSKLGHCLNDLIFRWRAGNLGGELVAVV 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   LPF ++P+T   K E+E +L+ ++++   +L++LARYMQILSD  C
Sbjct: 120 SNHEDLRPMAEAAGLPFVHVPVTPATKREAEARLLELVDEYRADLVVLARYMQILSDETC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLP FKGA PY QA++ GVK++GATAHY   +LD GPIIEQ+V+R+ 
Sbjct: 180 AALYGRAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTPDLDEGPIIEQEVIRID 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H         +G++ EA  L++AV  H +QRV +N   T+VF
Sbjct: 240 HTFDPRALATVGQDAEALALSRAVRWHSEQRVLLNGHSTVVF 281


>gi|150397295|ref|YP_001327762.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
 gi|150028810|gb|ABR60927.1| formyltetrahydrofolate deformylase [Sinorhizobium medicae WSM419]
          Length = 298

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 143/287 (49%), Positives = 207/287 (72%), Gaps = 2/287 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKL 59
           + Y L + CPS   +T+ I  YLS  GCNI D +QF+D  T + FMR+SF       ++L
Sbjct: 6   NRYALRVACPSIRGVTAAIATYLSNNGCNISDSAQFDDKSTGRYFMRVSFQPEEGHTLEL 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  I  ++     + +     K +++VS+  HCLNDLLYRW IG L ++IVGV+SN
Sbjct: 66  LREGFADIAAEYEADAELFDETAKRKVILMVSRFGHCLNDLLYRWRIGALPIDIVGVISN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  ++K+V N+ +PF+++ +T +NK+ +E + + I+++   EL++LARYMQ+LSD +C K
Sbjct: 126 HFDYQKIVVNHDIPFHHIKVTRENKLAAEAEQMRIVDETGAELIVLARYMQVLSDGMCRK 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           M+GRIINIHHSFLPSFKGANPYKQA+E GVK+IGAT+HY   +LD GPIIEQ+ VRVTHA
Sbjct: 186 MSGRIINIHHSFLPSFKGANPYKQAFERGVKLIGATSHYVTADLDEGPIIEQETVRVTHA 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           Q+ +DY+++G+++E++VL +A++AHI  RVF+N  KTIVFP  P ++
Sbjct: 246 QSADDYVSLGRDVESQVLARAIHAHIHGRVFLNGNKTIVFPPSPGSF 292


>gi|239834741|ref|ZP_04683069.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
 gi|239822804|gb|EEQ94373.1| formyltetrahydrofolate deformylase [Ochrobactrum intermedium LMG
           3301]
          Length = 297

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 115/278 (41%), Positives = 184/278 (66%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFI 61
           ++LT+ C     I + I   L+  G NI++ +QF D  T++ FMRI+F        +   
Sbjct: 19  FVLTLDCDDKPGIVAAITTELAAIGGNIVESNQFRDRVTNRFFMRIAFSAPLGMPREAVE 78

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +P  ++F +++++ +     K +++VS+ DH +  LLY+  +G L   +V +VSNH 
Sbjct: 79  HSLKPAGERFGMKFAVADASRKPKIVLMVSKFDHAMLHLLYQIRVGWLNAEVVAIVSNHE 138

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++  E+  +P++   + + NK E E +LI+++ +   +L++LARYMQ+LSD+L +++ 
Sbjct: 139 DSRETAESAGIPYHCWGVNKDNKAEQEARLIDLVRETQADLVVLARYMQVLSDNLSNRLF 198

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RVTH+ +
Sbjct: 199 GKIINIHHSFLPSFKGAKPYHQAFERGVKLIGATAHYVTPDLDEGPIIEQETERVTHSMS 258

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 259 AEDFVATGRDIESRVLARAVKMHLEHRVMLNGHKTVVF 296


>gi|189188610|ref|XP_001930644.1| formyltetrahydrofolate deformylase hydrolase [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187972250|gb|EDU39749.1| formyltetrahydrofolate deformylase hydrolase [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 282

 Score =  282 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 119/275 (43%), Positives = 179/275 (65%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT++CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F     +    +  +
Sbjct: 8   LTLSCPDKAGIVYAVTGLLAKENLTILDLQQFSDPVSKTFFMRVHFGHAADVSALQSSME 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +  + S+ Y I+      + LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLAAEMSMTYQIQRVDAKPRVLIMVSKIGHCLNDLLFRVKSGQLKIAVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           L +N  + F++LP+T+  K   E +++++I+++N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 LAKNNGIEFHHLPVTKDTKEHQETQILDLIKQHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +  G N+E++VL  AV    ++RVF+N +KT+VF 
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGQKTVVFN 282


>gi|319654307|ref|ZP_08008395.1| formyltetrahydrofolate deformylase [Bacillus sp. 2_A_57_CT2]
 gi|317394007|gb|EFV74757.1| formyltetrahydrofolate deformylase [Bacillus sp. 2_A_57_CT2]
          Length = 288

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 170/282 (60%), Gaps = 5/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFV---FNTCM 57
           +   L I+CP    I S + ++L     NI+   Q   D      FMRI F    F+   
Sbjct: 8   NRATLLISCPERPGIISTVSNFLLEHKANIVHFDQHTTDPLAGIFFMRIEFDMNHFDESF 67

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                D   + +++S+++ +    E  +  I VS+ DHCL +LL+RW    L ++I  V+
Sbjct: 68  SKLKGDLPEMAREYSMEWKLSGKGERKRMAIFVSKMDHCLLELLWRWKSKELEVDIPLVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +++VE + +P++++P+T   K E+EQK + ++E   V+ ++LARYMQILS    
Sbjct: 128 SNHPDMREVVEGFGIPYHHIPITPDTKAEAEQKSVELLEG-KVDFIVLARYMQILSPSFI 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K   RIINIHHSFLP+F GANPY +A+  GVK+IGATAHY   +LD GPIIEQDV RV 
Sbjct: 187 SKYPNRIINIHHSFLPAFVGANPYARAFNRGVKLIGATAHYVTNDLDEGPIIEQDVQRVN 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T +D    G+++E +VL +AV  H++ +V ++  KTIVF
Sbjct: 247 HRHTAQDLKIAGRHVERQVLAQAVAWHVEDKVIVHGNKTIVF 288


>gi|237712068|ref|ZP_04542549.1| formyltetrahydrofolate deformylase [Bacteroides sp. 9_1_42FAA]
 gi|229453389|gb|EEO59110.1| formyltetrahydrofolate deformylase [Bacteroides sp. 9_1_42FAA]
          Length = 285

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++  L + CP    I + + ++++    NI+ + Q+ D   +  FMRI +    F     
Sbjct: 3   TTAKLLLHCPDQPGILAEVTNFITINRGNIVYLDQYVDHVENIFFMRIEWEIKDFFIPKD 62

Query: 59  LFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F+ +  Q++ +++ +  +    +  I VS+  HCL D+L R+  G   + I  ++
Sbjct: 63  KIEDYFETLYAQKYEMKFRLYFSDVKPQMAIFVSKLSHCLFDMLARYTAGEWNVEIPLII 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E + +PFY  P+T++NK+E E+  + ++E++N+  ++LARYMQ++S+ + 
Sbjct: 123 SNHPDLQHVAERFGIPFYLFPITKENKMEQEKAEMELLEQHNINFIVLARYMQVISEQMI 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+T
Sbjct: 183 EAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTSELDAGPIIEQDVVRIT 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T++D ++ GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 243 HKDTVQDLVSKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|22297727|ref|NP_680974.1| formyltetrahydrofolate deformylase [Thermosynechococcus elongatus
           BP-1]
 gi|22293904|dbj|BAC07736.1| formyltetrahydrofolate deformylase [Thermosynechococcus elongatus
           BP-1]
          Length = 291

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 158/289 (54%), Gaps = 11/289 (3%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M +  L+I+CP    + + +  ++     NI+      D        R+ +    F    
Sbjct: 3   MPTMTLSISCPDQRGLVAKLAQFVYRYNGNIVHADHHTDAVAGIFLSRLEWELEGFEIPR 62

Query: 58  KLFIADFQPIVQQFSL-------QYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLA 110
                 F    Q+  +       ++ +R +    +  I VS+ DHCL DLL R   G L 
Sbjct: 63  DQIATTFINYAQREKIFTSWQGVRWQLRASDIPYRLAIWVSRQDHCLWDLLLRQRAGDLF 122

Query: 111 LNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQ 170
             I  ++SNH   + + E + + F+Y+P+T + K  +E K + +++   ++L++LA+YMQ
Sbjct: 123 AEIPLIISNHEHLRPIAEQFGIDFHYIPVTPETKPLAEAKQLQLLKDYRIDLVVLAKYMQ 182

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           +LS         ++INIHHSFLP+F GANPY +AYE GVKIIGATAHYA  +LD GPIIE
Sbjct: 183 VLSPEFIEAFP-QVINIHHSFLPAFAGANPYHRAYERGVKIIGATAHYATVDLDEGPIIE 241

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           Q VV V+H  T+ D I  GK++E  VL +AV  H+Q R+ +   +T VF
Sbjct: 242 QAVVPVSHRDTVADLIRKGKDLERVVLARAVRLHLQNRILVYGNRTAVF 290


>gi|94496991|ref|ZP_01303565.1| Formyltetrahydrofolate deformylase [Sphingomonas sp. SKA58]
 gi|94423667|gb|EAT08694.1| Formyltetrahydrofolate deformylase [Sphingomonas sp. SKA58]
          Length = 279

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 121/278 (43%), Positives = 172/278 (61%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM----KLFI 61
           LT+ C     I + +  +L+ +G  I D  Q+ D D    FMR++F          +   
Sbjct: 2   LTLVCADRVGIVAAVSQFLAERGGFITDSQQYADRDADLFFMRVAFEATDDRMRDTQTLR 61

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
           ADF  I  +F++ +S+   +   + LI VS+  HCL DLL+RW  G LA++I+GVVSNH 
Sbjct: 62  ADFATIGTRFAMDWSLEEARHRPRMLIAVSKGSHCLADLLHRWQAGMLAVDIMGVVSNHP 121

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++ E + +P++ LP     K   E  L++I E+   + +ILARYMQ+LS+ L  ++ 
Sbjct: 122 DMRRITEWHGIPYHELPPNGD-KAAQEAALLDIFERGRSDYLILARYMQVLSEQLVDRLA 180

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV H  T
Sbjct: 181 GRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERVDHRAT 240

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED I IG++IEA+VL +AV+    +RV  N  KT+VF
Sbjct: 241 PEDLIRIGRDIEAQVLARAVSWIADRRVLRNGGKTVVF 278


>gi|332521783|ref|ZP_08398234.1| formyltetrahydrofolate deformylase [Lacinutrix algicola 5H-3-7-4]
 gi|332042613|gb|EGI78814.1| formyltetrahydrofolate deformylase [Lacinutrix algicola 5H-3-7-4]
          Length = 282

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 110/281 (39%), Positives = 177/281 (62%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKL 59
           M+   L I C     I + + ++++    NI+ I Q  D +     MR+   F    M+ 
Sbjct: 1   MNKITLQIHCKDQTGIIASVTNFIANNNGNIVYIDQHVDREQDIFCMRLESEFKAFSMES 60

Query: 60  FIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
           F ++F  +  ++F++++ I + ++  K  + VS+ DHCL DLL R+N G L ++I  ++S
Sbjct: 61  FKSNFTNVLAERFNMKWRIYDVEDKPKMALFVSKYDHCLYDLLGRYNSGELFVDIPFIIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K + E++ +PFYY+P+T+  K E+E + + + +++ +  ++LARYMQI+++ L +
Sbjct: 121 NHNNLKPIAESFNIPFYYIPVTKDTKAEAEAQQLKLCKEHGINFIVLARYMQIVTNTLIN 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +   +IINIHHSFLP+F GA PY  AY+ GVKIIGAT+HY   +LDAGPII QDV  V+H
Sbjct: 181 EYPNKIINIHHSFLPAFVGAKPYHSAYKRGVKIIGATSHYVTTDLDAGPIIAQDVASVSH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +IED I  G+++E  VL  A+  HI ++V +   KTI+F
Sbjct: 241 THSIEDLITKGRDLEKIVLATAIKYHINRKVMVFNNKTIIF 281


>gi|145611995|ref|XP_362425.2| hypothetical protein MGG_08008 [Magnaporthe oryzae 70-15]
 gi|145019242|gb|EDK03470.1| hypothetical protein MGG_08008 [Magnaporthe oryzae 70-15]
          Length = 284

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 125/278 (44%), Positives = 179/278 (64%), Gaps = 1/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           +ILT++CP    I   +    +++  NILD+ QF+D  + K FMR+ F          AD
Sbjct: 7   HILTLSCPDKPGIVHAVTGIFASRSVNILDLKQFSDTGSQKFFMRVHFGPVAETADLSAD 66

Query: 64  FQPIV-QQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
           F  +  Q   + + IR   + T+ LI+VS+  HCLNDLL+R   G LA+++  +VSNH  
Sbjct: 67  FSALASQYDPMTWDIRPVAQKTRVLIMVSKIGHCLNDLLFRAQSGRLAVDVALIVSNHPD 126

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
              L  ++ + F +LP+T++ K + E++++ + ++ +VEL++LARYMQ+LS  LC  M+G
Sbjct: 127 FAPLAASHGVEFRHLPVTKETKTQQEEEILKLAKERDVELIVLARYMQVLSPTLCEAMSG 186

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           RIINIHHSFLPSFKGA PY QAY+ GVKIIGATAH+   +LD GPIIEQ + RV H  T 
Sbjct: 187 RIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTADLDEGPIIEQRISRVDHGMTP 246

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +  +  G +IEA VL  AV    ++RVF+N  KT+VF 
Sbjct: 247 KQLVDEGSSIEALVLGAAVQWFAERRVFLNNSKTVVFN 284


>gi|260777456|ref|ZP_05886350.1| formyltetrahydrofolate deformylase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260607122|gb|EEX33396.1| formyltetrahydrofolate deformylase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 310

 Score =  282 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 172/286 (60%), Gaps = 4/286 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M +YILT +CPS      ++  +L    C I +++ F+D    + F+R  F      +L 
Sbjct: 25  MKTYILTASCPSRAGTVDVVTRFLLEFECYIKELNSFDDTLNERFFIRAVFSVQNGQELN 84

Query: 61  IADFQPI----VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A F+        +F + + +  +    K +I+VS+ DHCLNDLLYR+  G L ++I  V
Sbjct: 85  RASFEAAFSARASEFDMDWELTPSDYRPKVVIMVSKYDHCLNDLLYRYRTGNLKVDIKAV 144

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + LVE + +P+++ P++ + K + E  + +++++ + EL++LARYMQ+LS  +
Sbjct: 145 ISNHPDLQSLVEWHDIPYHHFPISAETKPQQEALVQSVLDETDCELLVLARYMQVLSHDM 204

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C + +GR INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q +  V
Sbjct: 205 CSRWSGRAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYVSDDLDEGPIITQGLETV 264

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAY 282
            H    ED    G ++E+  L +A+  H+++RVF+   KTIVF   
Sbjct: 265 DHTYYPEDLARKGLDVESLTLGRAIQYHVEKRVFMYNDKTIVFERS 310


>gi|328542210|ref|YP_004302319.1| formyltetrahydrofolate deformylase [polymorphum gilvum SL003B-26A1]
 gi|326411960|gb|ADZ69023.1| Formyltetrahydrofolate deformylase [Polymorphum gilvum SL003B-26A1]
          Length = 285

 Score =  281 bits (720), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 121/280 (43%), Positives = 180/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKL 59
            S++LT++C     I + +   L+  G NI +  QF D  T++ FMRI+F+       + 
Sbjct: 4   KSFVLTLSCEDRPGIVAAVTTELADLGANIAESDQFWDQVTNRFFMRIAFIAPEGVGREA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P + +F ++ ++ +     K +I+VS+ DH L  LLY+  +G L   +V +VSN
Sbjct: 64  IEKALSPAIARFDMKTTLVDRSVRPKMIIMVSKFDHALLHLLYQIRVGWLEAEVVAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   ++  +   +PF++ P+T+ NK E E+KL+ +++    +L++LARYMQILSD L  +
Sbjct: 124 HEDSRRTADYEDVPFHHWPVTKANKAEQEEKLLTLVKDTGADLVVLARYMQILSDSLSKR 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G++INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV RV H+
Sbjct: 184 LFGKVINIHHSFLPSFKGARPYHQAHERGVKMIGATAHYVTADLDEGPIIEQDVERVNHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  D+ A G++IEA+VL +AV  H++ RV I   KTIVF
Sbjct: 244 LSAADFAARGRDIEARVLARAVKYHLESRVMIVGTKTIVF 283


>gi|71275363|ref|ZP_00651649.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Dixon]
 gi|170730340|ref|YP_001775773.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M12]
 gi|71163663|gb|EAO13379.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Dixon]
 gi|167965133|gb|ACA12143.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M12]
          Length = 283

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 181/282 (64%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           M   YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F    ++ +
Sbjct: 1   MRHDYILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDLADSSSL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                    + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VV
Sbjct: 61  AELQNQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y +PF +LP+  +N+ E E +++ I+E+  ++L+ILARYMQILS  LC
Sbjct: 121 SNHNEFAPLTASYGVPFQHLPVNGENRTEQEARILQIVEREQIDLVILARYMQILSPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 EALLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 241 HSMTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|126731705|ref|ZP_01747510.1| formyltetrahydrofolate deformylase [Sagittula stellata E-37]
 gi|126707871|gb|EBA06932.1| formyltetrahydrofolate deformylase [Sagittula stellata E-37]
          Length = 294

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 138/288 (47%), Positives = 202/288 (70%), Gaps = 2/288 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M+ + LT++C S   I + I  +L+  GCNI D SQF+D++T + FMR SF   T   + 
Sbjct: 1   MTKFCLTVSCASKRGIVAGIATFLADHGCNITDSSQFDDVETGRFFMRTSFTSETGADLA 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  + +   L ++  +     K +++VS+  HCLNDLLYR  IG L + IV V+S
Sbjct: 61  TLEQAFVSVAEGMDLDFTFHDEAAKMKVVVMVSRFGHCLNDLLYRCRIGALPIEIVAVIS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH  ++K V N  +PF+ + +T++NK ++E  ++ ++E    +L++LARYMQILSD +C 
Sbjct: 121 NHMDYQKTVVNQDIPFHCIRVTKENKPQAEAAIMQVVEDAGADLIVLARYMQILSDEMCR 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           KM+GRIINIHHSFLPSFKGANPYKQA+  GVK+IGAT+HY   +LD GPIIEQD +RVTH
Sbjct: 181 KMSGRIINIHHSFLPSFKGANPYKQAFARGVKLIGATSHYVTADLDEGPIIEQDTIRVTH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNY 286
           AQ+ +DY+++G+++EA+VL +A++AH   RVF+N  KT+VFP+ P ++
Sbjct: 241 AQSPDDYVSLGRDVEAQVLARAIHAHAHHRVFLNGNKTVVFPSSPGSH 288


>gi|116672259|ref|YP_833192.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
 gi|116612368|gb|ABK05092.1| formyltetrahydrofolate deformylase [Arthrobacter sp. FB24]
          Length = 309

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 180/280 (64%), Gaps = 4/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F         + 
Sbjct: 30  QYVLTLACPERPGIVRAITAFLADRGFDIVEHQQFDDHISGKLYLRTAFTPGDKEVSAEG 89

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A+F  I ++F ++++I + +   + L++VS+  HCLNDL++RW  G+L   I  VVSN
Sbjct: 90  LSAEFAAIAEEFDMEFAIHDGRPQ-RLLVMVSKFGHCLNDLIFRWRAGSLGAEIAVVVSN 148

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   L F ++P+T   K E+E +L+ ++ + N +L++LARYMQ+LS+ LC  
Sbjct: 149 HEDLRPMAEAAGLQFIHVPVTAATKPEAEARLLELVAEYNADLVVLARYMQVLSNDLCAS 208

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV H+
Sbjct: 209 LRGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTADLDEGPIIEQEVFRVDHS 268

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                 + +G++ E++ L++AV  H Q RV +N  +T+VF
Sbjct: 269 LDPNALVTVGRDAESQALSRAVKWHCQHRVLLNNTRTVVF 308


>gi|86748270|ref|YP_484766.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
 gi|86571298|gb|ABD05855.1| formyltetrahydrofolate deformylase [Rhodopseudomonas palustris
           HaA2]
          Length = 287

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 184/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++ +L+++C     I + +   L   GCN+++  QFND +T   FMR+ F     +  + 
Sbjct: 4   TNVVLSLSCRDQPGIVAAVSKLLFDAGCNVVEAHQFNDAETHLFFMRMRFAMLKPDASIA 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F+P+  +F + +++R+  E  + +ILVS+ DHCL DLLYRW  G LA+++ G+++
Sbjct: 64  ALEAAFEPVANEFGITWTMRSLSEKQRVMILVSKFDHCLADLLYRWRTGELAMDVAGIIA 123

Query: 119 NHTTHKKLV-ENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH        +   +PF+YLP+T+  K+E E ++  +I   N +L++LARYMQ+LSD LC
Sbjct: 124 NHPRETYAHLDLDGIPFHYLPVTKPTKMEQEAQVWELIRAANTDLVVLARYMQVLSDGLC 183

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ GR INIHHSFLP FKGA PY QA+E GVK+IGATAHY   +LD GPIIEQDV R++
Sbjct: 184 AKLAGRCINIHHSFLPGFKGARPYHQAFERGVKLIGATAHYVTPDLDEGPIIEQDVERIS 243

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +ED +  G+ IE +VL +A+  HI  RV +N  KT+VF
Sbjct: 244 HHNCVEDLVRKGREIERRVLARAITWHIDGRVIVNGTKTVVF 285


>gi|152980435|ref|YP_001352820.1| formyltetrahydrofolate deformylase [Janthinobacterium sp.
           Marseille]
 gi|151280512|gb|ABR88922.1| formyltetrahydrofolate deformylase [Janthinobacterium sp.
           Marseille]
          Length = 288

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 119/284 (41%), Positives = 177/284 (62%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            YIL ++C     I   +  +L+  GCNI++ +QF D  +   FMR+ F         ++
Sbjct: 4   EYILNLSCLDQRGIVQRVSGFLAGHGCNIIESAQFGDAQSQLFFMRVYFAAEDSSVNDEV 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             ADF  + +   + + + + ++  + +++VS+  HCLNDLL+R+  G L + I  +VSN
Sbjct: 64  LRADFSEMAKTMQMTWQLHDAQKKPRVMLMVSKIGHCLNDLLFRYKSGLLPVEIPAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           HT   +L  +Y +PF++LP     +E+ K   E +++ I +   ++L++LARYMQILS H
Sbjct: 124 HTDFYQLAASYNIPFHHLPLAPGASEEAKRAQEDRVLEIAKSAEIDLVVLARYMQILSPH 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +C  + GR INIHHSFLPSFKGA PY QA+E GVK+IGATAH+   +LD GPIIEQDV R
Sbjct: 184 MCQALQGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHFVTGDLDEGPIIEQDVER 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V HA       AIG+++E  VL +AV   I+ R+ +N  KT+VF
Sbjct: 244 VDHAMNPATLTAIGRDVECVVLARAVKYFIEHRILLNGHKTVVF 287


>gi|305664885|ref|YP_003861172.1| formyltetrahydrofolate deformylase [Maribacter sp. HTCC2170]
 gi|88707715|gb|EAQ99955.1| formyltetrahydrofolate deformylase [Maribacter sp. HTCC2170]
          Length = 290

 Score =  281 bits (719), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 108/279 (38%), Positives = 173/279 (62%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMKLF 60
            + I CP    I S +  ++ ++G NI  + Q  D      FMR+   F       +   
Sbjct: 11  TILIHCPDQSGIISAVTTFIHSRGGNITYLDQHVDQQADVFFMRLESDFKKNAFQPIDFK 70

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                 +   + +++S+   +   K  I VS+ +HCL D+L R+N G L + I  ++SNH
Sbjct: 71  NEFNSTLADHYQMEWSLDLDETLPKMAIFVSKYNHCLYDILSRFNSGELNVEIPFIISNH 130

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
                +   +++PFY++P+T+ +K E+E+K + +++++ V+ ++LARYMQI+S  L ++ 
Sbjct: 131 EDLGYIANQFKIPFYHIPVTKDSKQEAEKKQLRLLKEHKVDFVVLARYMQIISSGLINEF 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDV  V+H+ 
Sbjct: 191 PNKIINIHHSFLPAFAGAKPYHAAFERGVKIIGATSHYVTEELDAGPIIEQDVTTVSHSH 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TI+D+IA G+++E  VL++AV  HI+++  +   KT++F
Sbjct: 251 TIKDFIAKGRDLEKIVLSRAVAQHIERKTMVYNNKTVIF 289


>gi|88811138|ref|ZP_01126394.1| formyltetrahydrofolate deformylase [Nitrococcus mobilis Nb-231]
 gi|88791677|gb|EAR22788.1| formyltetrahydrofolate deformylase [Nitrococcus mobilis Nb-231]
          Length = 290

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 169/283 (59%), Gaps = 4/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
            + IL + C   + + + I ++++    NI+ + Q  D      FMR+ +    F   ++
Sbjct: 8   RTAILLMHCADQQGLVAAISEFIARNEGNIVYLDQHVDERRGIFFMRVEWELARFRVAVE 67

Query: 59  LFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F + I Q+F + +++  + E  +  I+VS+  HCL DLL RW  G   + I  ++
Sbjct: 68  AIDKAFDEAIGQRFGMHWTLSFSDEVPRIAIMVSRLPHCLYDLLSRWQSGEWRVEIPVLI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     + E + LP++ LP+T +NK   EQ+L+ ++    V+L++LARYMQIL   L 
Sbjct: 128 SNHEDLGDVAEQFGLPYHVLPVTPENKAHQEQRLLELLRAQRVDLIVLARYMQILGPQLI 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GA PY  A+  GVKIIGAT+HYA  ELDAGPII QDVV +T
Sbjct: 188 ANYPNRIINIHHSFLPAFPGARPYHNAHARGVKIIGATSHYATAELDAGPIIAQDVVHIT 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H   +E+ I  G+++E  VL +AV AHIQ++V   + +T++F 
Sbjct: 248 HRDPVEELIRKGRDLEKLVLARAVWAHIQRKVLCYENRTVIFD 290


>gi|89095286|ref|ZP_01168206.1| Formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
 gi|89080449|gb|EAR59701.1| Formyltetrahydrofolate deformylase [Oceanospirillum sp. MED92]
          Length = 285

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 123/280 (43%), Positives = 172/280 (61%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKL 59
           +++ILT  C S       +  YL   G  I ++  F+D  + + F+R  F        + 
Sbjct: 4   NTWILTAHCASELGTVDAVTGYLYHNGHYIEELHSFDDKISQRFFIRACFRTDGGFDEEK 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F   F+    +F +Q+ ++      K +I+VS+ DHCLNDLLY+  IG L + I  ++SN
Sbjct: 64  FRTLFELRADKFDMQWELQPQNHTPKVVIMVSKFDHCLNDLLYKNKIGQLNIEIPAIISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + YQ+P+Y+LP++   K E E KL  II++ + EL++LARYMQ+LSD LC K
Sbjct: 124 HPDLKPLADWYQIPYYHLPISADTKPEQESKLWQIIQETDAELVVLARYMQVLSDDLCKK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G  INIHHS LP FKGA PY QAYE GVK +GATAHY   +LD GPII Q +  V H 
Sbjct: 184 LEGWAINIHHSLLPGFKGAKPYHQAYEKGVKTVGATAHYINSDLDEGPIIAQGIEPVDHT 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED IA G++IE   L++AV  HI++RVF+N  +T+VF
Sbjct: 244 YYPEDLIAKGRDIERITLSRAVKYHIEKRVFLNDNRTVVF 283


>gi|148554079|ref|YP_001261661.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
 gi|148499269|gb|ABQ67523.1| formyltetrahydrofolate deformylase [Sphingomonas wittichii RW1]
          Length = 284

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 126/280 (45%), Positives = 173/280 (61%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMKLF 60
           ++ILT++C  +  I + +   L+  G NIL+  QF+DL T + FMR+ F  V    +   
Sbjct: 4   THILTLSCVDHPGIVAAVSTSLARHGANILEAQQFDDLLTGRFFMRVEFALVGGATIGQL 63

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A F P+     L +  R + E  K L+L S+ DHCL DLLYRW IG LA+  VG+ SNH
Sbjct: 64  AAGFAPVAADHGLDHRFRASAERKKVLLLASKFDHCLADLLYRWKIGELAMEPVGIASNH 123

Query: 121 TTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                   ++  +PF++LP+   +K   E  +  I+E+   EL++LARYMQILSD L   
Sbjct: 124 PRETYAHLDFGDIPFHFLPVGRDSKAAQEASIKAIVEETGAELVVLARYMQILSDDLAAF 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQD  RV+H 
Sbjct: 184 LAGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTADLDEGPIIEQDTERVSHR 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D +  G++IE +VL  AV A ++ RV +N   T+VF
Sbjct: 244 DTPDDLVRKGRDIERRVLASAVRAVLEDRVLMNGATTVVF 283


>gi|310791431|gb|EFQ26958.1| formyltetrahydrofolate deformylase [Glomerella graminicola M1.001]
          Length = 287

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 127/280 (45%), Positives = 179/280 (63%), Gaps = 3/280 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFI 61
           +ILT++CP    I   +    + Q  NILD+ QF+D  + K FMR+ F        +   
Sbjct: 8   HILTLSCPDKSGIVHAVTGVFAAQKLNILDLQQFSDPVSEKFFMRVHFGPTETESTEHLK 67

Query: 62  ADFQPIVQQFSLQYSI-RNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           A F  +     L +   R      +TLI+VS+  HCLNDLL+R   G L ++I  +VSNH
Sbjct: 68  APFDALAADLQLDWYRIRPVARKLRTLIMVSKIGHCLNDLLFRAKSGQLPIDIPLIVSNH 127

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + L  NY + F++LP+T+  K + E++++ ++++N++EL++LARYMQ+LS  LC  M
Sbjct: 128 NEFQGLAGNYGIDFHHLPVTKDTKTQQEEEILRLVKENDIELIVLARYMQVLSPKLCEAM 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +G+IINIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ + RV H  
Sbjct: 188 SGKIINIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRIARVDHGM 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           + +D +  G NIE++VL  AV    + RVF+NK KT+VF 
Sbjct: 248 SPKDLVEEGSNIESQVLAAAVKWTAEGRVFLNKTKTVVFN 287


>gi|332186772|ref|ZP_08388514.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
 gi|332013105|gb|EGI55168.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
          Length = 287

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 122/281 (43%), Positives = 175/281 (62%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV-----FNTCMK 58
           YILT+ C     I + +   L+     ILD  Q+ DL+T + F+RI F      F T ++
Sbjct: 6   YILTLACQDRVGIVAAVSGALAGIDGFILDSQQYADLETGRFFLRIVFTGQGPRFPTSVE 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A       +F   + +    E  + LI VS+  HCLNDLL+RW   TL + IVGVVS
Sbjct: 66  GVRAALTEPAARFGFDWHVAPAAERPRMLIAVSKGSHCLNDLLHRWRTNTLPVEIVGVVS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + LVE + LP+++LP+ + N+ E E  ++ ++++   + ++LARYMQ+L + L  
Sbjct: 126 NHDGLRPLVEWHGLPWHHLPVGDANRAEQETAMLALMDETRADYLVLARYMQVLGERLVA 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + GR INIHHSFLP FKGA PY +A+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 186 ALPGRCINIHHSFLPGFKGAQPYHRAHARGVKLIGATAHFVTADLDEGPIIEQAVERVDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +I+D I IG++IEA+VL +AV    ++RVF+N  +T+VF
Sbjct: 246 RASIDDLIRIGRDIEAQVLARAVAWVGERRVFLNDNRTVVF 286


>gi|330917643|ref|XP_003297896.1| hypothetical protein PTT_08452 [Pyrenophora teres f. teres 0-1]
 gi|311329197|gb|EFQ94027.1| hypothetical protein PTT_08452 [Pyrenophora teres f. teres 0-1]
          Length = 282

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 118/275 (42%), Positives = 179/275 (65%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT+ CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F     +    +  +
Sbjct: 8   LTLCCPDKAGIVYAVTGLLAKENLTILDLQQFSDPVSKTFFMRVHFGHAADVSALQSSME 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +  + ++ Y I+      + LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLASEMNMTYQIQRVDAKPRVLIMVSKIGHCLNDLLFRVKSGQLKVAVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           L +N  + F++LP+T+  K + E +++++I+++N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 LAKNNGIEFHHLPVTKDTKEQQETQILDLIKQHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +  G N+E++VL  AV    ++RVF+N +KT+VF 
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGQKTVVFN 282


>gi|294673244|ref|YP_003573860.1| formyltetrahydrofolate deformylase [Prevotella ruminicola 23]
 gi|294471671|gb|ADE81060.1| formyltetrahydrofolate deformylase [Prevotella ruminicola 23]
          Length = 287

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 111/284 (39%), Positives = 170/284 (59%), Gaps = 6/284 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           ++ IL + CP  + I S +  +++    NI+ + Q+ D      FMRI +     M    
Sbjct: 3   TTAILLLHCPDQQGIISEVTKFITDNKGNIVYLDQYVDKVDGMFFMRIEWELEGFMIPRD 62

Query: 62  ADFQPI----VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             ++ I     Q++ +++S+  + +  +  I VS+  HCL DLL RW  G    +I  +V
Sbjct: 63  KIYEYITTLYAQRYQMKFSLYFSDKRPRMAIFVSKMSHCLYDLLARWKAGEFNCDIPCIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSDH 175
           SNH   + + + + +P+Y   + + +  K E E+  + +++K ++  ++LARYMQI+SD 
Sbjct: 123 SNHEDLRYVADQFGIPYYVWSIKKDHSNKEEVEKAEMELLKKEDISFIVLARYMQIISDE 182

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +  +    IINIHHSFLP+F GA PY QAYE GVKIIGAT+HY   ELDAGPIIEQDV R
Sbjct: 183 MIAEYPHHIINIHHSFLPAFIGAKPYHQAYERGVKIIGATSHYVTAELDAGPIIEQDVTR 242

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +TH  T E  +  GK++E  VL+ AV+ HIQ+++   K KTI+F
Sbjct: 243 ITHKDTPESLVLKGKDLEKIVLSHAVSKHIQRKILTYKNKTIIF 286


>gi|257055905|ref|YP_003133737.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
 gi|256585777|gb|ACU96910.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
          Length = 282

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCM 57
           MS + ILT++CP+   I   +  YL  QGC+I++  QF+D    ++FMR        T +
Sbjct: 1   MSDTVILTLSCPNRTGIVRAVSGYLFEQGCDIVEHRQFDDAARDRVFMRTQVSAPGGTDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   ADF P+  +F + Y   N+    + LI+VS+  HCLNDL++RW  G+L  +IV VV
Sbjct: 61  ERLSADFAPVATEFRMTYE-FNSDRKARILIMVSKLGHCLNDLIFRWREGSLNADIVAVV 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E+  LPF+++P+T + K  +E +L+ +++   VEL++LARYMQILS+  C
Sbjct: 120 SNHEDLRPMAESAGLPFFHIPVTPKKKETAEARLLRLVDDYEVELVVLARYMQILSEKTC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR+INIHHSFLP FKGA PY QAY+ GVK++GATAHY   ELD GPIIEQ+V+R+ 
Sbjct: 180 KALHGRVINIHHSFLPGFKGAKPYHQAYQRGVKLVGATAHYVTPELDEGPIIEQEVIRID 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H          G++ EA  L +AV  H ++RV +N   T+VF
Sbjct: 240 HTYDPRALQIAGRDAEALALYRAVRWHCERRVLLNGDSTVVF 281


>gi|256397828|ref|YP_003119392.1| formyltetrahydrofolate deformylase [Catenulispora acidiphila DSM
           44928]
 gi|256364054|gb|ACU77551.1| formyltetrahydrofolate deformylase [Catenulispora acidiphila DSM
           44928]
          Length = 294

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/285 (41%), Positives = 177/285 (62%), Gaps = 6/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
             ++LT++CP    +   + +YL   GC ILD  Q+ D D+   FMR+SF        ++
Sbjct: 10  QQWVLTLSCPDTPGVVHGVANYLLMTGCTILDSQQYGDPDSGLFFMRVSFERVHDAVTLE 69

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F+ +   F + + I +  E    +++VS+  HCLNDLL+R + G L + I  VVS
Sbjct: 70  QLNSSFEAVGATFRMAWRIHDANELMPVVLMVSKFGHCLNDLLFRASTGALPVRIAAVVS 129

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEK---NNVELMILARYMQILSDH 175
           NH+  ++L  +Y + F +LP+   +     +    ++E      VEL++LARYMQ+L+D 
Sbjct: 130 NHSDFEELTRSYGVDFVHLPVAAGDAEGKAKAEAALLEVVESRGVELVVLARYMQVLTDE 189

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +C  + GR+INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V R
Sbjct: 190 VCKALEGRMINIHHSFLPSFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVAR 249

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V H  T E  +A+G+++E +VL +AV  H + RV +N ++T+VFP
Sbjct: 250 VGHGVTPEQLVAVGRDVECQVLARAVKWHAEHRVLLNGKRTVVFP 294


>gi|86132260|ref|ZP_01050855.1| formyltetrahydrofolate deformylase [Dokdonia donghaensis MED134]
 gi|85817179|gb|EAQ38362.1| formyltetrahydrofolate deformylase [Dokdonia donghaensis MED134]
          Length = 284

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M+   L I C   + I + + +++     N   I Q  D   +  FMR+  VF   +   
Sbjct: 1   MAHLTLLIHCKDQKGIIASVTNFILENEGNTTYIDQHVDAVANVFFMRLECVFTNASFNT 60

Query: 58  KLFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F A F + +   F +Q+ +    +  +  I VS+ DHCL D+L R+N G L ++I  +
Sbjct: 61  AQFKAAFKEKLATPFEMQWQLYPATQKLRMAIFVSKYDHCLYDILGRYNAGELNIDIPFI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH+    +  N+ +PFY++P+T+  K  +EQ+ + +++ + V+ ++LARYMQI++  +
Sbjct: 121 ISNHSDLAHIASNFDIPFYHIPVTKDTKAAAEQEQLKLLKAHQVDFIVLARYMQIVTPTV 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            ++   RIINIHHSFLP+F GA PY  A+  GVKIIG T+HY   ELDAGPIIEQD +RV
Sbjct: 181 INEFPHRIINIHHSFLPAFVGAKPYHAAFARGVKIIGTTSHYVTEELDAGPIIEQDTIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH+ TI D IA G+++E  VL++A+  H Q + F+   KTI+F
Sbjct: 241 THSHTIPDLIAKGRDLEKIVLSRAIKLHAQHKCFVYGNKTIIF 283


>gi|329115224|ref|ZP_08243979.1| Formyltetrahydrofolate deformylase [Acetobacter pomorum DM001]
 gi|326695667|gb|EGE47353.1| Formyltetrahydrofolate deformylase [Acetobacter pomorum DM001]
          Length = 281

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 123/279 (44%), Positives = 181/279 (64%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLF 60
            +ILT +CP    I + +   L+ +G +I +  QF++  +  LFMR++F       +   
Sbjct: 2   QFILTFSCPDQPGIVAAVTSVLAERGADITETHQFSNRKSGTLFMRLAFNAPAPGNLAEI 61

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P+ Q+F ++  + +     + +I+VS+ DH L +LLY+  +G L  +IV +VSNH
Sbjct: 62  NTILAPVAQRFDMKMRLHDAAMLPRIIIMVSRFDHALLNLLYQVRVGWLKADIVAIVSNH 121

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T      E   +P+Y  P+T+QNK E E KL  +I++   +L++LARYMQ+LSD L  ++
Sbjct: 122 TDSAATAEQAGIPYYCWPVTKQNKAEQEDKLRALIKETKADLVVLARYMQVLSDSLSAEL 181

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
           +GR+INIHHSFLPSFKGA PY QAY  GVK+IGATAHY   +LD GPIIEQ+  RVTH  
Sbjct: 182 SGRVINIHHSFLPSFKGAKPYHQAYARGVKLIGATAHYVTADLDEGPIIEQETARVTHNL 241

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++EDYIA G+ +E++VL +AV  H++ RV IN  +T+VF
Sbjct: 242 SVEDYIATGRGVESQVLARAVKMHVEHRVMINGHRTVVF 280


>gi|82408427|gb|ABB73053.1| putative 10-formyltetrahydrofolate deformylase [Arthrobacter
           globiformis]
          Length = 312

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 119/285 (41%), Positives = 185/285 (64%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + ++LT+ CP    I   I  +L+ +G +I++  QF+D  + KL++R +F F+  ++   
Sbjct: 28  AEFVLTLACPERPGIVRAITTFLADRGFDIVEHQQFDDHVSGKLYLRTAFGFDQLIERDQ 87

Query: 62  -------ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                  A+F  +  +F + +SI + +   + L++VS+  HCLNDL++RW  G+L   I 
Sbjct: 88  QTAESLTAEFAAVAGEFGMDFSIHDGRPQ-RLLVMVSKFGHCLNDLIFRWRAGSLGAEIA 146

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            VVSNH   + + E   LPF ++P+T   K E+E +L+ ++ + + +L++LARYMQ+LSD
Sbjct: 147 VVVSNHEDLRPMAEAAGLPFIHVPVTAATKPEAEARLLELVAEYDADLVVLARYMQVLSD 206

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC ++ GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V 
Sbjct: 207 DLCRQLRGRAINIHHSFLPGFKGAKPYHQAYDRGVKMVGATAHYVTADLDEGPIIEQEVF 266

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV HA   +  + +G++ E + L++AV  H Q RV +NK +T+VF
Sbjct: 267 RVDHALDPDALVTVGRDAETQALSRAVKWHCQHRVLLNKTRTVVF 311


>gi|134094227|ref|YP_001099302.1| formyltetrahydrofolate deformylase [Herminiimonas arsenicoxydans]
 gi|133738130|emb|CAL61175.1| Formyltetrahydrofolate deformylase (Formyl-FH(4) hydrolase)
           [Herminiimonas arsenicoxydans]
          Length = 288

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/284 (41%), Positives = 174/284 (61%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            YIL ++C     I   +  YL+  GCNILD +QF D  +   FMR+ F         ++
Sbjct: 4   QYILNLSCLDQRGIVQRVSAYLAGHGCNILDSAQFGDAQSKLFFMRVHFAVEEETLTDEV 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             + F  +     + + + +  +  + L++VS   HCLNDLL+R+  G L ++I  ++SN
Sbjct: 64  LRSTFATLADTMQMDWQLHDAHKKPRMLLMVSSIGHCLNDLLFRYKSGLLPVDIPAIISN 123

Query: 120 HTTHKKLVENYQLPFYYLPMT----EQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           HT   +L  +Y +PF++LP+     E  K   EQ+++ I++  +++L++LARYMQILS  
Sbjct: 124 HTDFYQLAASYNIPFHHLPLATGAPESAKRMQEQRILEIVKAADIDLIVLARYMQILSPE 183

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +C  + GR INIHHSFLPSFKGA PY QA++ GVK+IGATAH+    LD GPIIEQDV R
Sbjct: 184 MCAALEGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHFVTGHLDEGPIIEQDVAR 243

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V HA       AIG+++E  VL +AV   ++ R+ +N  KT+VF
Sbjct: 244 VDHAMDPATLTAIGRDVECVVLARAVKYFVEHRILLNGHKTVVF 287


>gi|15838429|ref|NP_299117.1| formyltetrahydrofolate deformylase [Xylella fastidiosa 9a5c]
 gi|9106913|gb|AAF84637.1|AE004004_8 formyltetrahydrofolate deformylase [Xylella fastidiosa 9a5c]
          Length = 283

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           M   YILT++CP    +   I   L   GCNILD  QF D ++   F+R+ F    ++ +
Sbjct: 1   MRHDYILTLSCPDCTGLVYRISGELFRAGCNILDAQQFGDKESHLFFLRVHFDVADSSSL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                    + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VV
Sbjct: 61  AQLQDQINILAEAYAMQWQLHDARRGSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y +PF +LP+   N+ E E +++ ++E+  ++L+ILARYMQILS  LC
Sbjct: 121 SNHNDFAPLTASYGVPFQHLPVNADNRTEQEARILQMVEREQIDLVILARYMQILSPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 EALLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 241 HSMTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|312881989|ref|ZP_07741743.1| formyltetrahydrofolate deformylase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370284|gb|EFP97782.1| formyltetrahydrofolate deformylase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 290

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 115/285 (40%), Positives = 168/285 (58%), Gaps = 4/285 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF----VFNTCM 57
           +SY+LT +CPS      ++  +L   G  I +++ F+D    + F+R  F          
Sbjct: 6   ASYVLTASCPSRSGTVDVVTRFLRESGGYINELNSFDDELNQRFFIRTVFRLEADSEFDR 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            +F   F    + F +++ +       K +I+VS+ DHCLNDLLYR+  G L++ I  V+
Sbjct: 66  DVFCQQFSERSKAFEMEWELTPLDYKPKVVIMVSKYDHCLNDLLYRYRTGNLSVEICAVI 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNHT  + L E + +PFY+ P+T   K + E ++ +I+++   EL++LARYMQ+LS  +C
Sbjct: 126 SNHTDLQSLTEWHDIPFYHCPITPSTKAQQESQVQSILDQYQCELLVLARYMQVLSHEMC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
               G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q +  V 
Sbjct: 186 EVWAGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYVSDDLDEGPIITQGMETVN 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAY 282
           H    ED    GK+IEA+ L +AV  H ++R+F+   KTIVF   
Sbjct: 246 HTYYPEDLTRKGKDIEAQTLARAVQYHAEKRIFLFNDKTIVFERS 290


>gi|257095434|ref|YP_003169075.1| formyltetrahydrofolate deformylase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047958|gb|ACV37146.1| formyltetrahydrofolate deformylase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 289

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 168/282 (59%), Gaps = 6/282 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD---TSKLFMRISFVFN---TCM 57
           Y L+ +CP    I + +  +++     IL+ S   D       + FMR+    +     +
Sbjct: 7   YTLSGSCPDQVGIIARVSGFIAQHQGWILESSYHADDGGGNDGRYFMRMEVRADSLPFHL 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F+P+ +  S+ + I ++    + +++VS+ +HCL DLL RW    L + I  V+
Sbjct: 67  AEFRERFRPLAESLSMDWRITDSAVKRRVVVMVSKQEHCLYDLLSRWQSKELDIEIPCVI 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   K LVE + +PF+++P+   N+  +  ++  I E+   + M+LARYMQIL   LC
Sbjct: 127 SNHDAFKALVEWHGIPFHHVPVNPDNRQAAYDEIRRIYEEVKGDTMVLARYMQILPPDLC 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
               G++INIHHSFLPSF GA PY QA++ GVK+IGAT HY   +LD GPIIEQDV+R+ 
Sbjct: 187 DCYPGQMINIHHSFLPSFVGARPYHQAHQRGVKLIGATCHYVTKDLDQGPIIEQDVIRID 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ TI+D +  GK+IE  VL + +  H++ RV ++  KT++F
Sbjct: 247 HSDTIDDMVRYGKDIEKAVLARGLRYHLEDRVLVHANKTVIF 288


>gi|72162755|ref|YP_290412.1| formyltetrahydrofolate deformylase [Thermobifida fusca YX]
 gi|71916487|gb|AAZ56389.1| formyltetrahydrofolate deformylase [Thermobifida fusca YX]
          Length = 285

 Score =  280 bits (717), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 177/281 (62%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             ++LT++CP +  I + + + L+   CNI +  QF D  T + FMR+ F   +      
Sbjct: 4   REFVLTLSCPDSRGIVAAVANLLAAHQCNIEESQQFGDHYTGRFFMRVQFTAESPQVDED 63

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   +  ++++ + +       + L++VS+  HCLNDLLYR   GTL  +I  VVS
Sbjct: 64  ALRGALAALASEYAMDWDLWRRDVRMRVLVMVSKYGHCLNDLLYRQRSGTLKADIAAVVS 123

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L ++Y + F++LP+T Q K E E +++ +I+   ++L++LARYMQ+LS+ LC 
Sbjct: 124 NHPDLEFLAKSYGVDFHHLPVTPQTKPEQEARVLELIQSYQIDLVVLARYMQVLSEDLCQ 183

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GRIINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQ+V RV H
Sbjct: 184 KLAGRIINIHHSFLPSFKGARPYHQAHARGVKLIGATAHYVTADLDEGPIIEQEVARVDH 243

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + E    +G+++E+  L +AVN H + R+ +N  KT+VF
Sbjct: 244 TFSPEQLTEVGRDLESMALARAVNWHAEHRILLNGSKTVVF 284


>gi|261879436|ref|ZP_06005863.1| formyltetrahydrofolate deformylase [Prevotella bergensis DSM 17361]
 gi|270334005|gb|EFA44791.1| formyltetrahydrofolate deformylase [Prevotella bergensis DSM 17361]
          Length = 287

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 166/286 (58%), Gaps = 7/286 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M  + +L + C     I S +  +++    NI+ + Q+ D +    FMRI +V    M  
Sbjct: 1   MKPTAVLLLHCQDKPGIISEVTKFITDNKGNIVYLDQYVDHEDGMFFMRIEWVLENFMIP 60

Query: 60  FIADFQPI----VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                + I     Q++ + +++   ++  +  I VS+  HCL DLL R+  G   + I  
Sbjct: 61  KEKIHEYIETLYSQRYQMTFNLYFNEDKPRMAIFVSKMSHCLYDLLARYKAGEWNVEIPC 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILS 173
           ++SNH   + + E + +P+Y   + + +  K E E   + ++E+  V  ++LARYMQI+S
Sbjct: 121 IISNHEDLRYVAEQFDIPYYVWSIKKDHSNKAEVEAAEMELLEREKVTFIVLARYMQIIS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +  K    IINIHHSFLP+F GA PY QA+E GVKIIGAT+HY   +LDAGPIIEQDV
Sbjct: 181 DEMIAKYPHHIINIHHSFLPAFIGAKPYHQAWERGVKIIGATSHYVTQDLDAGPIIEQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +RV+H  T E  +  G+++E  VL++AV  HIQ+++     KTI+F
Sbjct: 241 MRVSHKDTPETLVLKGRDLEKIVLSRAVTKHIQRKILTYNNKTIIF 286


>gi|257054337|ref|YP_003132169.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
 gi|256584209|gb|ACU95342.1| formyltetrahydrofolate deformylase [Saccharomonospora viridis DSM
           43017]
          Length = 292

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 102/283 (36%), Positives = 161/283 (56%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
             Y++T  CP  + I S I  +L+  G  I++ +   D DT   F R +   +     + 
Sbjct: 11  RQYVITFGCPDRKGIVSRISSFLAEIGGWIVEAAYHTDPDTGWFFTRQAVKADSVPFDID 70

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
              A F  + +       +S+ +T +  + +ILVS+  HCL DLL R   G L  ++  V
Sbjct: 71  ELRARFAGVARSLGSETDWSVDDTGQRPRVVILVSKEGHCLYDLLGRVASGELDADVRAV 130

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           + NH     + + + +PF+++P    +    E ++  ++++++   ++LAR+M+IL   L
Sbjct: 131 IGNHDVLADITQAHGIPFHHVPFDGDDAKSFE-QIAKLVDEHDPHAVVLARFMRILPPEL 189

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C    GR INIHHSFLPSF GA PY QAY  GVK++GAT HY   ELDAGPIIEQDV+RV
Sbjct: 190 CEAWAGRAINIHHSFLPSFVGARPYHQAYARGVKLVGATCHYVTPELDAGPIIEQDVIRV 249

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T+ D +  G++IE   L + +  H+++RV ++  +T+VF
Sbjct: 250 DHRDTVSDMVRKGRDIEKVTLARGLRWHLERRVLVHGNRTVVF 292


>gi|262374145|ref|ZP_06067422.1| formyltetrahydrofolate deformylase [Acinetobacter junii SH205]
 gi|262311156|gb|EEY92243.1| formyltetrahydrofolate deformylase [Acinetobacter junii SH205]
          Length = 288

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 169/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 67  EALMQTFAANVAERYEMQWKLTFVNELKKVGILVSKVDHALLELLWRHARGSLPCEITQV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   +  VEN+ +PF+ +P+ + NK+E+  ++ +       +L+ILARYMQILS+  
Sbjct: 127 ISNHPDLRDAVENFGIPFHVVPVNKDNKVEAYAQIND--MMQGNDLLILARYMQILSEDF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VAQWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|310819480|ref|YP_003951838.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|309392552|gb|ADO70011.1| Formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
          Length = 303

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 110/283 (38%), Positives = 167/283 (59%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
           ++  L ITCP    I S +  +L   G N+ ++ Q+  D    + FMR+ F     +   
Sbjct: 21  TTARLLITCPDRPGIVSAVTTFLYHHGANVTELDQYSTDPSGGRFFMRLEFQTPHLDVSR 80

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                 F  +  Q+F + + +    +  +  +LVS+ DH L DLL+RW  G L +++  V
Sbjct: 81  ATLKQSFGDVVGQRFEMDWRLSFAADKPRMGVLVSKHDHALMDLLWRWQRGELRVDLPLV 140

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VE + + F ++P+      ESE +++ ++E   V+ ++LARYM+ILS   
Sbjct: 141 ISNHPDLREAVERFGVRFEHVPVEAATHAESEARMLALLEGQ-VDFVVLARYMRILSAGF 199

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA+PYKQAYE GVK+IGATAHY   ELD GPIIEQD  RV
Sbjct: 200 VSHYPQRIINIHHSFLPAFVGADPYKQAYERGVKLIGATAHYVTSELDQGPIIEQDTARV 259

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   + +   +G+++E +VL +AV  H + R+ ++  KTIVF
Sbjct: 260 SHRHAVPELRHLGRDLERQVLARAVRWHAEDRIIVDGNKTIVF 302


>gi|294011332|ref|YP_003544792.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
 gi|292674662|dbj|BAI96180.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
          Length = 279

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 117/278 (42%), Positives = 169/278 (60%), Gaps = 5/278 (1%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC----MKLFI 61
           LT+ C     I + +  +L+ +G  I D  Q+ D    + FMR++F              
Sbjct: 2   LTLACADRVGIVAAVSQFLAERGGFITDSQQYADRKAGRFFMRVAFEATDDGMGDTDRLR 61

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
            +F  +  +F++ + +    E  + LI VS+  HCL DLL+RW  GTLA++I+GV SNH 
Sbjct: 62  GEFGDVGARFAMDWRLTAADEKPRMLIAVSKGSHCLADLLHRWQTGTLAVDIMGVASNHP 121

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++ E + +P++ LP     K   E+ L ++ E+   E +ILARYMQ+LS+ L  ++ 
Sbjct: 122 DMRRITEWHGIPYHELPPNGD-KAAQEEALFSLFERTRSEYLILARYMQVLSEGLVERLA 180

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR +NIHHSFLP FKGA PY +A+E GVK+IGATAH+   +LD GPIIEQ V RV H  T
Sbjct: 181 GRCVNIHHSFLPGFKGARPYHRAHERGVKLIGATAHFVTADLDEGPIIEQAVERVDHRAT 240

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED I IG++IEA+VL +AV+    +RV  N  KT+VF
Sbjct: 241 AEDMIRIGRDIEAQVLARAVSWLADRRVLQNGGKTVVF 278


>gi|298242306|ref|ZP_06966113.1| formyltetrahydrofolate deformylase [Ktedonobacter racemifer DSM
           44963]
 gi|297555360|gb|EFH89224.1| formyltetrahydrofolate deformylase [Ktedonobacter racemifer DSM
           44963]
          Length = 287

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 109/282 (38%), Positives = 168/282 (59%), Gaps = 5/282 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTS-KLFMRISFV---FNTCMK 58
           +  L I+CP    I + + +++     NI++ +Q +      + FMR+SF    F     
Sbjct: 7   TITLLISCPDRPGIVATVSNFIFEHQGNIVESAQHSSNQQECRFFMRVSFAAEGFKLSPT 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A F P+ ++F +Q+S+  +++  +  I VS+ DHCL DLL+RW  G L ++I  ++S
Sbjct: 67  ELRAAFAPLAEKFQMQWSVAYSEQRKRVGIFVSKLDHCLIDLLWRWKHGELQMDIPFIIS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L + Y +PFY+ P+ ++ +   E++++  ++   V+ +ILARYMQIL      
Sbjct: 127 NHHLLEPLAKMYDVPFYHFPVAKETRTADEKRILEFLDG-KVDFLILARYMQILEPFFVA 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
               RIINIHHSFLP+F GANPY++A+E GVK+IGATAHY    LD GPII QDV+   H
Sbjct: 186 AYPHRIINIHHSFLPAFVGANPYQRAFERGVKLIGATAHYVTDNLDEGPIIAQDVIHCDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
               ED +  G ++E +VL +AV  H + RV I + KT+ F 
Sbjct: 246 RDNTEDLVRKGSDVERRVLAEAVRLHTENRVLIYENKTLTFD 287


>gi|308178984|ref|YP_003918390.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307746447|emb|CBT77419.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 290

 Score =  279 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/283 (40%), Positives = 173/283 (61%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF- 60
           + Y+LT+TC     I   +   L     +I ++ Q +D  +  LFMRI F          
Sbjct: 6   NKYVLTLTCAERPGIVHAVTGLLLKHHGDIRELKQHDDQRSGTLFMRIEFDVAEARDAPA 65

Query: 61  -----IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                 +    +  +    + +R + +  + +++VS+  HCL+DLL+R  +G L + I  
Sbjct: 66  EIAELESSLGKLADEHQATWGLRPSGKKKRVVVMVSKFGHCLHDLLFRARMGELPVEIAA 125

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           VVSNH  H++ VE   +PF+++P+T Q+K E+E KL++++++  V+L++LARYMQ+LSD 
Sbjct: 126 VVSNHPDHRQQVEWNGIPFFHVPVTAQSKPEAEAKLMDLVDRFEVDLVVLARYMQVLSDD 185

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           L  K+TGR INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q V  
Sbjct: 186 LTRKLTGRAINIHHSFLPSFKGAKPYHQAFERGVKTVGATAHYVNSELDEGPIITQRVQE 245

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           V H+   E  +A G++ E K L+ AV  H + RVF++  +T+V
Sbjct: 246 VDHSYEPEHLVAAGRDTECKALSDAVRWHCEDRVFLSGSRTVV 288


>gi|115379250|ref|ZP_01466365.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
 gi|115363749|gb|EAU62869.1| formyltetrahydrofolate deformylase [Stigmatella aurantiaca DW4/3-1]
          Length = 304

 Score =  279 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 110/283 (38%), Positives = 167/283 (59%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
           ++  L ITCP    I S +  +L   G N+ ++ Q+  D    + FMR+ F     +   
Sbjct: 22  TTARLLITCPDRPGIVSAVTTFLYHHGANVTELDQYSTDPSGGRFFMRLEFQTPHLDVSR 81

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                 F  +  Q+F + + +    +  +  +LVS+ DH L DLL+RW  G L +++  V
Sbjct: 82  ATLKQSFGDVVGQRFEMDWRLSFAADKPRMGVLVSKHDHALMDLLWRWQRGELRVDLPLV 141

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VE + + F ++P+      ESE +++ ++E   V+ ++LARYM+ILS   
Sbjct: 142 ISNHPDLREAVERFGVRFEHVPVEAATHAESEARMLALLEGQ-VDFVVLARYMRILSAGF 200

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA+PYKQAYE GVK+IGATAHY   ELD GPIIEQD  RV
Sbjct: 201 VSHYPQRIINIHHSFLPAFVGADPYKQAYERGVKLIGATAHYVTSELDQGPIIEQDTARV 260

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   + +   +G+++E +VL +AV  H + R+ ++  KTIVF
Sbjct: 261 SHRHAVPELRHLGRDLERQVLARAVRWHAEDRIIVDGNKTIVF 303


>gi|87121790|ref|ZP_01077677.1| Formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
 gi|86163041|gb|EAQ64319.1| Formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
          Length = 290

 Score =  279 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 111/281 (39%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMK 58
           + ++L  +C +   I + +  Y+++QGC I +++Q+ D D+ + FMR           + 
Sbjct: 9   NEFVLKASCTAKSGIVAAVTSYIASQGCYISELNQYVDEDSEQFFMRAVCRIETGEKTVD 68

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F  +   F +++ +       + L++VS+ DHCL++LLYR   G L + I  +VS
Sbjct: 69  EIRDGFSAVADPFDIKWELHAKATLMRVLLMVSKFDHCLDNLLYRHRKGELPMEITAIVS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F +LP+T++NK E E  L++I+ +   +L++LARYMQILSD LC 
Sbjct: 129 NHKDLRPMAEREGIRFVHLPVTKENKREQELALMDIVNETETDLVVLARYMQILSDSLCK 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLP FKGA PY QA++ GVK+IGATAHY   +LD GPII Q V  V H
Sbjct: 189 ELNGRAINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTPDLDEGPIIAQSVQPVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               E  +++G++ E   L +A+  HI+ RVF++  KT+VF
Sbjct: 249 TYNPEMLVSVGRDTETVALARALQLHIEHRVFLDGNKTVVF 289


>gi|63002616|dbj|BAD97821.1| 10-formyltetrahydrofolate hydrolase [Corynebacterium sp. U-96]
          Length = 281

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 116/276 (42%), Positives = 174/276 (63%), Gaps = 3/276 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT+ CP    I   +  +L      I+++ QF+D+  S+ FMR+ F        ++ 
Sbjct: 6   RHVLTLQCPEGLGIVHAVSKFLLDHERTIVELKQFDDMPASRFFMRVEFAGAEEPGLLEK 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI   + + + +   ++ TK LI+VS+ DHCLNDLL+R   G L + +V VVSN
Sbjct: 66  LRTGFEPIAASYQMDWKLHPREKRTKVLIMVSKFDHCLNDLLFRARTGELPIEVVAVVSN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + LVE + + ++++P++++ K ++E +L+ +IE    EL++LARYMQ+LSD L  +
Sbjct: 126 HPDSRSLVEWHGIDYHHVPISKETKPQAEAELLRLIESTGAELVVLARYMQVLSDGLSRE 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 186 LTGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRK 275
              +D +A G++ E K L+ AV  H + RVF+   +
Sbjct: 246 YGPQDLVAAGRDTECKALSNAVRWHCEGRVFLYGNR 281


>gi|300088126|ref|YP_003758648.1| formyltetrahydrofolate deformylase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527859|gb|ADJ26327.1| formyltetrahydrofolate deformylase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 100/283 (35%), Positives = 164/283 (57%), Gaps = 5/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M++ IL ++C     I + +  ++S    NI+ + +F D  +   FMR+ +    F    
Sbjct: 1   MTTAILKVSCQDRPGIIAAVSGFISGHHGNIITLDEFVDRRSGTFFMRVEWDISAFTIDR 60

Query: 58  KLFIADFQPIVQQFSL--QYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  + + +  S    + +  T    +  I+VS+ DHCL DLL R   G L+  I  
Sbjct: 61  DNITPALKKLAEADSFGGTWEVFFTDNLPRMGIMVSRFDHCLWDLLLRHRAGELSCRIPV 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           ++SNH   + + + + + F ++P T   K  +E++ + ++   +V+ +++ARYMQ+LS  
Sbjct: 121 IISNHDDLRYIADFFDIDFRHIPKTAATKTAAEKQEMELLASLDVDFVVMARYMQVLSPD 180

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
             ++   RIINIHHSFLP+F+GA PY QA+E GVKIIGATAH+A  ELD GPII Q  + 
Sbjct: 181 FLNRYPNRIINIHHSFLPAFEGARPYHQAFERGVKIIGATAHFATQELDKGPIIHQATLP 240

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           ++H  T++D I  G++IE +VL+  V  +I  RVF++  +TI+
Sbjct: 241 ISHQDTVDDLITKGRDIEKRVLSDGVKLYIANRVFVHGNRTII 283


>gi|311744951|ref|ZP_07718736.1| formyltetrahydrofolate deformylase [Algoriphagus sp. PR1]
 gi|126577458|gb|EAZ81678.1| formyltetrahydrofolate deformylase [Algoriphagus sp. PR1]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 117/283 (41%), Positives = 175/283 (61%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M+  IL I CP  + I + +  +L +   NIL+I Q  D   S  FMR ++  ++     
Sbjct: 1   MNKAILLIQCPDQKGIVAEVSRFLYSYQGNILEIDQHVDKGLSLFFMRAAWELDSFSLEK 60

Query: 58  KLFIADFQ-PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+  +  +F + + +       K  I VS+  HCL D+L R + G L ++I  V
Sbjct: 61  EKIAQQFEKEVGAKFKMDFKLHFNFPKPKMAIFVSKLSHCLFDILARHHSGQLEVDIPLV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + +VE + +PF+++P+T++NK  SE K + +++++ V+ ++LARYMQILS   
Sbjct: 121 ISNHKDLQSVVEAFNIPFHHIPVTKENKSASEAKQLELMQEHQVDFVVLARYMQILSGDF 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    RIINIHHSFLP+F GA PY  AYE GVKIIGATAHY   ELDAGPIIEQ+V RV
Sbjct: 181 INHFPNRIINIHHSFLPAFVGAKPYHAAYERGVKIIGATAHYVTEELDAGPIIEQEVARV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  TI D + IG+++E  VL+KA+  H+ ++V   + KT++F
Sbjct: 241 RHHNTIPDLVQIGQDVEKVVLSKAIQYHLDRKVLAFRNKTVIF 283


>gi|304311140|ref|YP_003810738.1| Formyltetrahydrofolate deformylase [gamma proteobacterium HdN1]
 gi|301796873|emb|CBL45085.1| Formyltetrahydrofolate deformylase [gamma proteobacterium HdN1]
          Length = 284

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 112/280 (40%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            +Y L I+CP    I + +   ++  G  + + S  +D      FMR      +    ++
Sbjct: 3   QTYRLVISCPDQVGIVARVSQIVAEYGGWLTEASYHSDSHEGWFFMRNEIRAESLRLSLR 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F+P+ +++ +++ + ++ E  +  IL S   HCL D+L+RW+ G L  NI  V+S
Sbjct: 63  QFRDVFRPLAEEYRMKWHVSDSMEKHQVGILASHASHCLADILHRWHSGDLYCNIPCVIS 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +K+VE Y +PFY+LP+  +NK E+ Q+++ +++++  + ++LARYMQIL    C 
Sbjct: 123 NHDNLRKMVEWYDIPFYHLPIDRENKEEAHQEMMRLLQQHRADTVVLARYMQILPSWFCK 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            M  ++INIHHSFLPSF GANPY+QAYE GVK+IGAT HY    LD GPIIEQDV RV H
Sbjct: 183 AMPNQVINIHHSFLPSFIGANPYQQAYERGVKLIGATCHYVTENLDQGPIIEQDVARVNH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
             + +D + +GK+IE  VL++ + AH++ RV ++  KT++
Sbjct: 243 RHSRDDMVRLGKDIEMNVLSRGLRAHVEDRVIVHGNKTVI 282


>gi|239905843|ref|YP_002952582.1| formyltetrahydrofolate deformylase [Desulfovibrio magneticus RS-1]
 gi|239795707|dbj|BAH74696.1| formyltetrahydrofolate deformylase [Desulfovibrio magneticus RS-1]
          Length = 285

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 168/285 (58%), Gaps = 7/285 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NT 55
           MS +  L ITCP    I S +  +L T G NI+D+ Q   D +    FMR+ F     + 
Sbjct: 1   MSATARLRITCPDRPGIVSAVTTFLYTHGANIIDLDQHSTDPEGGTFFMRLEFYTPYIDV 60

Query: 56  CMKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                 A F  +   +F + + +  +    +  +LVS+ DHCL +LL+R+    L  +I 
Sbjct: 61  SRAALEAAFGEVVGNRFDMDWRLSYSDVPKRVAVLVSRHDHCLMELLWRYARKELPCDIA 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            V+ NH   ++ VE + +P++ +P+ +    E+E ++  ++    V+L++LARYM+++S 
Sbjct: 121 MVIGNHEDPREAVEGFGVPYHCVPVGDGGMPEAEARMAELL-GTGVDLLVLARYMRVVSG 179

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
                   R+INIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELDAGPIIEQD  
Sbjct: 180 DFLRPYDNRVINIHHSFLPAFVGADPYRQAHEKGVKLIGATAHYVTAELDAGPIIEQDTA 239

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RVTH  ++ D  A+G  +E  VL +AV  H++ RV +   KT+VF
Sbjct: 240 RVTHRHSVADLKAMGSELERTVLARAVTWHLEDRVIVFGNKTVVF 284


>gi|288926144|ref|ZP_06420071.1| formyltetrahydrofolate deformylase [Prevotella buccae D17]
 gi|288337036|gb|EFC75395.1| formyltetrahydrofolate deformylase [Prevotella buccae D17]
          Length = 287

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 165/286 (57%), Gaps = 7/286 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTC 56
           M  + IL + CP  + I S +  +++    NI+ + Q+ D +    FMRI +    F   
Sbjct: 1   MKPTAILLLHCPDEQGIISEMTKFITDNQGNIVYLDQYVDREDGIFFMRIEWALEKFTIP 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +        +  Q++ +++++       +  I VS+  HCL DLL R+  G   + I  
Sbjct: 61  REKIREYIDTLYAQRYKMEFNLYFNDVKPRMAIFVSKMSHCLYDLLARYKAGEWNVEIPC 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILS 173
           +VSNH   + + E + +P+Y   + + +  K E E + + +++K  V  ++LARYMQI+S
Sbjct: 121 IVSNHEDLRYVAEQFDIPYYVWSIKKDHSNKAEVEAEEMELLKKEKVTFIVLARYMQIIS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +       IINIHHSFLP+F GA PY QA+E GVKIIGAT+HY   ELDAGPIIEQDV
Sbjct: 181 DDMIKAYPNHIINIHHSFLPAFVGAKPYHQAWERGVKIIGATSHYVTAELDAGPIIEQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R+TH  T E  +  GK++E  VL++AV  HIQ+++     KTI+F
Sbjct: 241 TRITHKDTPESLVLKGKDLEKIVLSRAVTKHIQRKILTYHNKTIIF 286


>gi|312220683|emb|CBY00624.1| similar to formyltetrahydrofolate deformylase [Leptosphaeria
           maculans]
          Length = 282

 Score =  279 bits (714), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 121/275 (44%), Positives = 175/275 (63%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT+ CP    I   +   L+ +   ILD+ QF+D D+   FMR+ F     +       Q
Sbjct: 8   LTLQCPDKAGIVYAVTGLLAKENLTILDLQQFSDPDSKTFFMRVHFGHAADLSALETSMQ 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +  +  + Y IR      + LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  QLGAEMQMDYQIRRVDAKPRVLIMVSKIGHCLNDLLFRVKSGLLKIEVPVIVSNHPDFAQ 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           +  N  + F++LP+T+  K E E +++++I ++N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 VARNNGIEFHHLPVTKDTKTEQESQILDLIAQHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +  G N+E++VL  AV    ++RVF+N  KT+VF 
Sbjct: 248 VEEGSNVESQVLAHAVKWWSEKRVFLNGVKTVVFN 282


>gi|315608899|ref|ZP_07883872.1| formyltetrahydrofolate deformylase [Prevotella buccae ATCC 33574]
 gi|315249426|gb|EFU29442.1| formyltetrahydrofolate deformylase [Prevotella buccae ATCC 33574]
          Length = 287

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 165/286 (57%), Gaps = 7/286 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTC 56
           M  + IL + CP  + I S +  +++    NI+ + Q+ D +    FMRI +    F   
Sbjct: 1   MKPTAILLLHCPDEQGIISEMTKFITDNQGNIVYLDQYVDREDGIFFMRIEWALEKFTIP 60

Query: 57  MKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +        +  Q++ +++++       +  I VS+  HCL DLL R+  G   + I  
Sbjct: 61  REKIREYIDTLYAQRYKMEFNLYFNDVKPRMAIFVSKMSHCLYDLLARYKAGEWNVEIPC 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILS 173
           +VSNH   + + E + +P+Y   + + +  K E E+  + +++K  V  ++LARYMQI+S
Sbjct: 121 IVSNHEDLRYVAEQFDIPYYVWSIKKDHSNKAEVERAEMELLKKEKVTFIVLARYMQIIS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +       IINIHHSFLP+F GA PY QA+E GVKIIGAT+HY   ELDAGPIIEQDV
Sbjct: 181 DDMIKAYPNHIINIHHSFLPAFVGAKPYHQAWERGVKIIGATSHYVTAELDAGPIIEQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R+TH  T E  +  GK++E  VL++AV  HIQ+++     KTI+F
Sbjct: 241 TRITHKDTPESLVLKGKDLEKIVLSRAVTKHIQRKILTYHNKTIIF 286


>gi|2500006|sp|Q46339|PURU_CORS1 RecName: Full=Formyltetrahydrofolate deformylase; AltName:
           Full=Formyl-FH(4) hydrolase
 gi|927593|gb|AAC43463.1| 10-formyltetrahydrofolate hydrolase [Corynebacterium sp.]
          Length = 286

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 117/279 (41%), Positives = 179/279 (64%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT+ CP    I   +  +L      I+++ Q++D+   +LF+R+ F  ++    +  
Sbjct: 6   RHVLTLQCPEGIGIVHAVTGFLVRHQRTIVELKQYDDMSAGRLFLRVDFAGDSAPDLLDA 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             ++F  +  +F + + +R   + TK LI+VS+ +HCL DLL+R + G L + +VGV SN
Sbjct: 66  LRSEFSEVAAKFDMDWQLRERGQKTKVLIMVSKFEHCLQDLLFRMHSGDLPIEVVGVASN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H  H+ LVE Y + F+++P+++  K  +E  L+ +I++   EL++LARYMQ+LSDHL  +
Sbjct: 126 HPDHRSLVEWYGIGFHHIPISKDTKPRAEAALLELIDQTGAELVVLARYMQVLSDHLASE 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 186 LTGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
              +D +A G++ E K L+ AV  H + RVF+   +T+V
Sbjct: 246 YGPQDLVAAGRDSECKALSNAVRWHCEGRVFLYGNRTVV 284


>gi|260907102|ref|ZP_05915424.1| formyltetrahydrofolate deformylase [Brevibacterium linens BL2]
          Length = 283

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 121/283 (42%), Positives = 185/283 (65%), Gaps = 3/283 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           MS  +IL +TCP    I   +   L++ G NI +  QF+  D+ + F+R+ FV   ++  
Sbjct: 1   MSREWILRVTCPDATGIVHAVTGVLASLGANITESQQFSSPDSLQFFLRVQFVTNNDSDA 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   +       +F++  S++  ++ T+TL+LVS+  HCLN LL++ + G L ++IVGV 
Sbjct: 61  ETLQSSLAEAAHRFTMTVSLQPVEKKTRTLVLVSKAAHCLNTLLFQQSSGQLPIDIVGVA 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
            NH + + L E +   F+++P++ + K  +E +L  +++  +VEL++LARYMQILS  LC
Sbjct: 121 GNHDSLRSLAEFHGHDFHHIPISPETKDAAEARLSALVDDLDVELIVLARYMQILSPDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR+INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 ARLEGRVINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTPDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           H + I D++  G+++EA VL +AV  H + RV ++  +T+VF 
Sbjct: 241 HNRNIADFVQRGQDVEAAVLARAVAWHAEGRVLMDGHRTVVFN 283


>gi|50955477|ref|YP_062765.1| formyletrahydrofolate deformylase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951959|gb|AAT89660.1| formyletrahydrofolate deformylase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 290

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 119/279 (42%), Positives = 173/279 (62%), Gaps = 1/279 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + ++LT +C     I   +   +     NI +  QF   DT + FMR+        + F 
Sbjct: 11  NHWVLTFSCADRPGIVHAVSGAIVAARGNITESQQFASTDTGRFFMRLQVESAADREEFE 70

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               PIV QF + + + N     +TL+LVS   HCLNDLL+R   G L + I  V+SNH 
Sbjct: 71  RALAPIVTQFGMSHRVDNVGRPLRTLVLVSTAAHCLNDLLFRQRAGHLPVEIPLVLSNHG 130

Query: 122 THKKLVENYQLPFYYLPMTEQ-NKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
           T + L   Y +PF   P+T+  +K   E++ +  +E++ +EL++LARYMQILS  LC ++
Sbjct: 131 TLRDLAGFYGVPFESAPVTDPASKAAFEERTLAAVEEHGIELVVLARYMQILSPELCERL 190

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGANPY+QA+  GVK+IGATAH+   +LD GPIIEQ+VVRV HA 
Sbjct: 191 AGRAINIHHSFLPGFKGANPYRQAHARGVKLIGATAHFVTSDLDEGPIIEQNVVRVDHAS 250

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           ++ + +AIG++ E++ LT+AV    + RV ++  +TI+F
Sbjct: 251 SVPELVAIGQDEESRTLTQAVKWFAEDRVLLDGARTIIF 289


>gi|28198933|ref|NP_779247.1| formyltetrahydrofolate deformylase [Xylella fastidiosa Temecula1]
 gi|182681642|ref|YP_001829802.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M23]
 gi|28057031|gb|AAO28896.1| formyltetrahydrofolate deformylase [Xylella fastidiosa Temecula1]
 gi|182631752|gb|ACB92528.1| formyltetrahydrofolate deformylase [Xylella fastidiosa M23]
 gi|307580079|gb|ADN64048.1| formyltetrahydrofolate deformylase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 283

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 180/282 (63%), Gaps = 3/282 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           M   YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F    ++ +
Sbjct: 1   MRHDYILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDVADSSSL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                    + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VV
Sbjct: 61  AELQNQISILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     L  +Y +PF +LP+   N+ E E ++I ++E+  ++L+ILARYMQILS  LC
Sbjct: 121 SNHNEFAPLTASYGVPFQHLPVNADNRTEQEARIIQMVEREQIDLVILARYMQILSPALC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV 
Sbjct: 181 EALLGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ T  D + IG +IE+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 241 HSMTAHDLVRIGSDIESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|226951955|ref|ZP_03822419.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ATCC 27244]
 gi|294649217|ref|ZP_06726655.1| formyltetrahydrofolate deformylase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837293|gb|EEH69676.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ATCC 27244]
 gi|292824884|gb|EFF83649.1| formyltetrahydrofolate deformylase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 288

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 169/282 (59%), Gaps = 7/282 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLFI 61
           +  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +       
Sbjct: 8   TARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRKE 67

Query: 62  ADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           A  Q     + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+LA  I  V+
Sbjct: 68  ALMQTFAANVAERYGMQWKLNFVGELKKVGILVSKVDHALLELLWRHARGSLACEITQVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++ VEN+ +PF+ +P+ + NK E+  ++ +       +L+ILARYMQILS+   
Sbjct: 128 SNHPDLREAVENFGIPFHVVPVNKDNKAEAYAQIND--MMQGNDLLILARYMQILSEDFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV+
Sbjct: 186 SQWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERVS 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H   +E    +G+++E  VL +AV  H++ RV ++  KT+VF
Sbjct: 246 HDYNVEQLRELGEDVERNVLARAVKWHLEDRVIVDGNKTVVF 287


>gi|262375010|ref|ZP_06068244.1| formyltetrahydrofolate deformylase [Acinetobacter lwoffii SH145]
 gi|262310023|gb|EEY91152.1| formyltetrahydrofolate deformylase [Acinetobacter lwoffii SH145]
          Length = 288

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 168/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
           ++  L ITC     I   +  +L  QG NI  + Q+       + FMR+ F  +   +  
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATAAQGGRYFMRVEFELDNLQSRK 66

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F   + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G L   I  V
Sbjct: 67  ESITQTFAANVAERYGMQWRLALVSDVKKVGILVSKVDHALLELLWRHARGGLPCEITKV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH T ++ VEN+ +PF  +P+T+ NK E+  ++  +      +L++LARYMQIL +  
Sbjct: 127 VSNHETLREAVENFGIPFEVVPVTKDNKPEAYAEIDQL--MQGNDLLVLARYMQILDEEF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   ++INIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VSKWEMKVINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T+E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 NHDFTVEQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|284045801|ref|YP_003396141.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
 gi|283950022|gb|ADB52766.1| formyltetrahydrofolate deformylase [Conexibacter woesei DSM 14684]
          Length = 299

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 103/281 (36%), Positives = 161/281 (57%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISFVF--NTCMK 58
           ++  L + CP    I + +  +L   G NIL   Q++ D      F+R+ F    +    
Sbjct: 19  ATMRLLVACPDKPGIVAAVSRFLFDAGANILRSDQYSSDPTGGAFFLRMEFTLRHDQRAD 78

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   + ++F + + + +     +  +LVS+ DHCL DLLYRW  G L   I  V S
Sbjct: 79  FAERFGHAVAERFDIAWRLWDADRPKRIAVLVSRYDHCLLDLLYRWKRGDLGGEIALVAS 138

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +  VE   +P++++P+   +K  +E +L+ ++   ++++++LARYMQILS     
Sbjct: 139 NHADLRTPVEAAGVPYHHVPVARDDKPAAEARLLELLGAADLDMVVLARYMQILSGTFLE 198

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++   +INIHHSFLP+F GA PY++A   GVK+IGATAHY   ELD GPIIEQDV+RVTH
Sbjct: 199 RLGVPVINIHHSFLPAFAGAGPYERAKARGVKLIGATAHYVTEELDEGPIIEQDVIRVTH 258

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             +  +   +G +IE  V ++AV  H + RV ++   T+VF
Sbjct: 259 RDSAAELTRLGADIERVVFSRAVQWHCEDRVLVHGSTTVVF 299


>gi|308448538|ref|XP_003087678.1| hypothetical protein CRE_17786 [Caenorhabditis remanei]
 gi|308253636|gb|EFO97588.1| hypothetical protein CRE_17786 [Caenorhabditis remanei]
          Length = 288

 Score =  279 bits (713), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 172/283 (60%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRR 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            +  Q     + +++S+ + +    +  K  ILVS+ DH L +LL+R + G L   I  V
Sbjct: 67  ESLIQTFATNVAERYSMHWRLALVSDIKKVGILVSKVDHALLELLWRHSRGGLPCEITQV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   ++ VEN+ +PFY +P+ ++NK E+  K+  +++ N+  L++LARYMQIL +  
Sbjct: 127 VSNHEDLRESVENFGIPFYVVPVNKENKREAYTKIDELMQGND--LLVLARYMQILDEEF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   ++INIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VQKWEMKVINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T++    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 NHDFTVDQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|317130459|ref|YP_004096741.1| formyltetrahydrofolate deformylase [Bacillus cellulosilyticus DSM
           2522]
 gi|315475407|gb|ADU32010.1| formyltetrahydrofolate deformylase [Bacillus cellulosilyticus DSM
           2522]
          Length = 299

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 109/279 (39%), Positives = 167/279 (59%), Gaps = 4/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMK---LF 60
            L ++C     I + I +   +   NI++ SQ+  + +    F+RI F   +  +     
Sbjct: 21  RLLVSCSDQPGIVAAISNMFYSFDANIIESSQYSTNPEGGTFFIRIEFECPSFKEKVKEM 80

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
              F  I  +FS+++S+       +T I VS+  HCL +LL+ W  G L  +I  VVSNH
Sbjct: 81  KESFAEIASKFSMEWSLTQVSLIKRTAIFVSKELHCLRELLWDWQSGDLLTDIALVVSNH 140

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              ++LVE+  +P+YY+   +  + E E+K + +++  +++++ILARYMQIL+     + 
Sbjct: 141 EDGRELVESMGIPYYYIKANKDIRKEVEEKQLQLLKDYDIDVIILARYMQILTPEFVKEH 200

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA PY++A++ GVK+IGAT+HY   +LD GPIIEQD+ RV H  
Sbjct: 201 ENKIINIHHSFLPAFIGAKPYERAHDRGVKLIGATSHYVTNDLDEGPIIEQDIARVDHRD 260

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +E    +G +IE  VLT+AV  HI  R+ I K KTIVF
Sbjct: 261 NVERLKKLGASIERSVLTRAVKWHIDDRIIIYKNKTIVF 299


>gi|254501684|ref|ZP_05113835.1| formyltetrahydrofolate deformylase [Labrenzia alexandrii DFL-11]
 gi|222437755|gb|EEE44434.1| formyltetrahydrofolate deformylase [Labrenzia alexandrii DFL-11]
          Length = 285

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 182/281 (64%), Gaps = 2/281 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLF 60
            Y+LT++C     I + +   L+  G NI +  QF D  T++ F+RI+ +      ++  
Sbjct: 5   HYVLTLSCADKPGIVAAVTTELADFGANIAESDQFWDRATNQFFLRIAMLAPEGVTLESV 64

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                P++ +F ++  + +T +  K +I+VS+ DH +  LLY+  +G L   +V +VSNH
Sbjct: 65  QKALDPVIARFDMKAKLVDTAKRPKVIIMVSKFDHAMLHLLYQIRVGWLDAEVVAIVSNH 124

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               +  ++  +P+++ P+T+ NK E E K++ ++++   +L++LARYMQ+LSD+L  ++
Sbjct: 125 PDSARTADHEGIPYHHWPVTKGNKAEQEDKVLKLVKETGADLVVLARYMQVLSDNLSKRL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G++INIHHSFLPSFKGA PY QA+  GVK+IGAT HY   +LD GPIIEQD  RV+HA 
Sbjct: 185 FGKVINIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTPDLDEGPIIEQDAERVSHAL 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
           + +D++A G++IE++VL +AV  H++ RV I   KTIVF  
Sbjct: 245 SADDFVARGRDIESRVLARAVKYHLENRVMIVGNKTIVFTP 285


>gi|297172770|gb|ADI23735.1| formyltetrahydrofolate hydrolase [uncultured Rhodospirillales
           bacterium HF4000_38H21]
          Length = 285

 Score =  278 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRI--SFVFNTCMKL 59
           +SYIL I C     I + +   L+++G NI++ +QF D  T++ F+R+  S         
Sbjct: 4   NSYILRIACDDQPGIVATVTSALASRGANIIESNQFWDRHTNQFFLRVGISVPAGIDKDS 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
            +    P V +F+++  +       K +I+VS+ DH +  LLY+  +G L   +  +VSN
Sbjct: 64  IVLTLNPSVDRFNMKLKVDVVSRRPKIIIMVSKFDHAMLHLLYQIKVGWLDAEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +K+ E   +PF+Y+P+ + NK E E KL ++I++ N EL++LARYMQ+L++ L  +
Sbjct: 124 HEDARKVAEQEGIPFHYMPVNKDNKTEQEAKLADLIKQTNSELVVLARYMQVLTNELSSQ 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G IINIHHSFLPSFKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+  RV HA
Sbjct: 184 FYGMIINIHHSFLPSFKGAKPYHQAYDRGVKLIGATAHYVTPDLDEGPIIEQETERVNHA 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +D++A G++IEA+VL +AV  H++ RV +N  +T+VF
Sbjct: 244 MSADDFVATGRDIEARVLARAVKYHLEGRVMLNNHRTVVF 283


>gi|254444786|ref|ZP_05058262.1| formyltetrahydrofolate deformylase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259094|gb|EDY83402.1| formyltetrahydrofolate deformylase [Verrucomicrobiae bacterium
           DG1235]
          Length = 283

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 98/278 (35%), Positives = 162/278 (58%), Gaps = 2/278 (0%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKLFIA 62
           +  ++ P  + + S +  ++   G NI+   Q  D      F R+ +  +     +   A
Sbjct: 6   VALLSGPDQKGLVSKVSGWIFENGGNIIHADQHRDAQAGVFFQRVEWSLDDGSDPRATAA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F+       ++  +  + +  K  I VS+ DHC +DL+ RW  G     I  ++SNHT 
Sbjct: 66  AFEQFGDSIGMKTKVAISGDKPKVAIFVSKFDHCFHDLILRWKAGEYPCEIALIISNHTA 125

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            K + +NY++P+ Y+ +T+  K ++E + + ++++  +EL+I+ARYMQ+LS         
Sbjct: 126 LKAVSKNYEIPYQYISVTKATKADAEAEQLALLKQEGIELVIMARYMQVLSPIFLDTFGK 185

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
            +INIHHSFLP+F GA PY QA+  GVK+IGATAHYA  +LD GPII Q+V +VTH  ++
Sbjct: 186 PVINIHHSFLPAFAGAKPYHQAHSRGVKLIGATAHYATPDLDQGPIIHQNVAQVTHRNSV 245

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           ED +  G+N+E   L +AV+ H++ R+ + + KT+VF 
Sbjct: 246 EDLVRKGRNLEKITLAQAVSWHLENRILVYENKTVVFD 283


>gi|313205366|ref|YP_004044023.1| formyltetrahydrofolate deformylase [Paludibacter propionicigenes
           WB4]
 gi|312444682|gb|ADQ81038.1| formyltetrahydrofolate deformylase [Paludibacter propionicigenes
           WB4]
          Length = 288

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 101/282 (35%), Positives = 165/282 (58%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           ++ +L + CP    I +++ ++++    NIL + Q+ + +    FMR+ +    F     
Sbjct: 6   NTAVLLMHCPDKPGILAVVTEFINQHKGNILYLDQYVNREEKVFFMRVEWDLTLFQIPKD 65

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F+  I  ++S+ + +       +  I VS+  HCL DLL R+  G   + I  ++
Sbjct: 66  KIEEYFETLIAVRYSMSFRLYFADTKPRMAIFVSKMSHCLYDLLARYAAGEWEVEIPLII 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +   + + ++ +P+T++NK E E K + +++K+ +   +LARYMQ+LS    
Sbjct: 126 SNHPDMESVANRFGIEYHVIPVTKENKAEQEAKQLELLKKHGITFCVLARYMQVLSADFI 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIINIHHSFLP+F GA PY  A+E GVK+IGAT+HY   +LDAGPIIEQDV  ++
Sbjct: 186 DHYPNRIINIHHSFLPAFAGAKPYHAAHERGVKVIGATSHYVTSDLDAGPIIEQDVTHIS 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T+E+ I  G+++E  VL+ AV  HI +++   K +TIVF
Sbjct: 246 HKDTVEELIKKGRDLEKIVLSHAVEKHIDRKILAYKNRTIVF 287


>gi|289643539|ref|ZP_06475656.1| formyltetrahydrofolate deformylase [Frankia symbiont of Datisca
           glomerata]
 gi|289506665|gb|EFD27647.1| formyltetrahydrofolate deformylase [Frankia symbiont of Datisca
           glomerata]
          Length = 313

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 106/281 (37%), Positives = 161/281 (57%), Gaps = 7/281 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQ-FNDLDTSKLFMRISFV---FNTCMKLF 60
            LT+ C     I + +  +L+  G NI++  Q   D    + F+R++F        +   
Sbjct: 33  RLTVQCADRPGIVAAVSQFLTDHGANIVESDQATTDPVDGQFFLRMTFHRPGLQAHLDDM 92

Query: 61  IADFQP--IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
             +F    + +    ++S+R+     +  I+VS+ DHCL DLL+R   G L ++I  V+S
Sbjct: 93  TKNFTKALVEKFEVTEWSLRDASTPKRVAIMVSKYDHCLLDLLWRARRGELPVDIGLVIS 152

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH      V  + +PF ++P+    K E+E + + +++  N +L++LARYMQILS     
Sbjct: 153 NHADLASEVRTFGVPFVHIPVARDTKPEAEARQLQLLQG-NFDLVVLARYMQILSADFLD 211

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            +   +INIHHSFLP+F GA PY++A E GVK+IGATAHYA  +LD GPIIEQDVVRV H
Sbjct: 212 SVGCPVINIHHSFLPAFAGAGPYERAKERGVKLIGATAHYATEDLDEGPIIEQDVVRVRH 271

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +  I      G ++E  VL++AV  H + RV  +   T+VF
Sbjct: 272 SDNIAALKRRGADVERLVLSRAVLWHCEDRVLRHGNSTVVF 312


>gi|71898535|ref|ZP_00680706.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Ann-1]
 gi|71731659|gb|EAO33719.1| Formyltetrahydrofolate deformylase [Xylella fastidiosa Ann-1]
          Length = 283

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 122/278 (43%), Positives = 178/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKLFI 61
           YILT++CP    +   I   L   GCNILD  QF D ++ + F+R+ F    ++ +    
Sbjct: 5   YILTLSCPDCTGLVYRISGELFRAGCNILDAQQFVDKESHQFFLRVHFDVADSSSLAELQ 64

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
                + + +++Q+ + + +  ++ L++VS+  HCLNDLL+R +   L   IV VVSNH 
Sbjct: 65  NQINILAKAYAMQWQLHDARRRSRLLVMVSKQGHCLNDLLFRIHSRQLQAKIVTVVSNHN 124

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
               L  +Y +PF +LP+   N+ E E +++ ++E+  ++L+ILARYMQILS  LC  + 
Sbjct: 125 EFAPLTASYGVPFQHLPVNADNRTEQEARILQMVEREQIDLVILARYMQILSPALCEALL 184

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHS LPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQDV RV H+ T
Sbjct: 185 GRAINIHHSLLPSFKGAQPYHQAHARGVKIIGATAHYVTHDLDEGPIIEQDVARVDHSMT 244

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             D + IG ++E+ VL +AV+ HI+ R+ +N  +T+VF
Sbjct: 245 AHDLVRIGSDVESLVLARAVSRHIEHRILLNGHRTVVF 282


>gi|145294501|ref|YP_001137322.1| formyltetrahydrofolate deformylase [Corynebacterium glutamicum R]
 gi|140844421|dbj|BAF53420.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 304

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 105/286 (36%), Positives = 169/286 (59%), Gaps = 7/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
             ++LT  CP +  I + +  +L+ +G  I +   F D D++  F R +      +T ++
Sbjct: 19  RQFVLTFGCPDSTGIVAKLSSFLAERGGWITEAGYFTDPDSNWFFTRQAIRAESIDTTIE 78

Query: 59  LFIADFQPIVQQFSLQ--YSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               +F P+ ++F  +  +S  +T +  K ++LVS+  HCL+DLL R       + +V V
Sbjct: 79  QLREEFAPLAEEFGPRAKWSFTDTAQVKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAV 138

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSD 174
           V NH   + + EN+ +PF+++P  +    K ++  ++  I+   + + ++LAR+MQIL  
Sbjct: 139 VGNHENLRYIAENHNVPFFHVPFPKDAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPP 198

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR++NIHHSFLPSF GA PY QAY  GVK+IGAT HYA  +LD GPIIEQDV+
Sbjct: 199 DLCEMWAGRVLNIHHSFLPSFMGARPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVI 258

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           RVTH  T  +   +G++ E +VL + +  H++ RV +   +T+VF 
Sbjct: 259 RVTHKDTPTEMQRLGRDAEKQVLARGLRFHLEDRVLVYGNRTVVFD 304


>gi|217969019|ref|YP_002354253.1| formyltetrahydrofolate deformylase [Thauera sp. MZ1T]
 gi|217506346|gb|ACK53357.1| formyltetrahydrofolate deformylase [Thauera sp. MZ1T]
          Length = 291

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 111/284 (39%), Positives = 168/284 (59%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDL-----DTSKLFMRISFVFN---T 55
           + L+ +CP    I + +  +++     IL+ S   +      +  + FMRI    +    
Sbjct: 7   FTLSASCPDRVGIVAKVSGFIAEHRGWILETSLHAEPPLEAGEVGRYFMRIEIKADSLPF 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +  F   F+P+ ++  + + I ++    + ++LVS+ +HCL DLL RW    L + I  
Sbjct: 67  HLAEFREKFRPLAEELEMDWKITDSAVKKRVVVLVSKQEHCLYDLLARWQSKELDIEIPC 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH T +  VE + +PF+++P+   NK  +  ++  I E+   + M+LARYMQILS  
Sbjct: 127 VISNHDTFRGFVEWHGIPFHHVPVGTDNKSAAYAEVRRIFEEVRGDTMVLARYMQILSPD 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GRI+NIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R
Sbjct: 187 LCAAYPGRILNIHHSFLPSFVGAKPYHQAYAKGVKLIGATCHYVTADLDQGPIIEQDVIR 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + H+  +ED +  GK+IE  VL + +  H++ RV ++  KTIVF
Sbjct: 247 IDHSDAVEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTIVF 290


>gi|301598784|pdb|3NRB|A Chain A, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598785|pdb|3NRB|B Chain B, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598786|pdb|3NRB|C Chain C, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
 gi|301598787|pdb|3NRB|D Chain D, Crystal Structure Of A Formyltetrahydrofolate Deformylase
           (Puru, Pp_1943) From Pseudomonas Putida Kt2440 At 2.05 A
           Resolution
          Length = 287

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 175/280 (62%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN-TCMKLF 60
           + Y+L++ C     I S +  +L   G NI++  QFND D+SK F R+S       +  F
Sbjct: 6   NQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFXRVSVEIPVAGVNDF 65

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            + F  +V++++ ++  R   +  K +I VS+ DHCL DLLYR  +G L   +VG++SNH
Sbjct: 66  NSAFGKVVEKYNAEWWFRPRTDRKKVVIXVSKFDHCLGDLLYRHRLGELDXEVVGIISNH 125

Query: 121 TTHK-KLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
                 +     +PF+YLP+T   K   E ++ NI+ ++  +L++LARY QILSD L   
Sbjct: 126 PREALSVSLVGDIPFHYLPVTPATKAAQESQIKNIVTQSQADLIVLARYXQILSDDLSAF 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPII QDV  V+H 
Sbjct: 186 LSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEGPIIAQDVEHVSHR 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + ED +  G++IE +VL++AV   ++ R+ +N  +T+VF
Sbjct: 246 DSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 285


>gi|56964545|ref|YP_176276.1| formyltetrahydrofolate deformylase [Bacillus clausii KSM-K16]
 gi|56910788|dbj|BAD65315.1| formyltetrahydrofolate hydrolase [Bacillus clausii KSM-K16]
          Length = 287

 Score =  278 bits (711), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 113/282 (40%), Positives = 161/282 (57%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF---VFNTCM 57
               L ++C     + + I  +L     NI+   Q+  D +    FMRI F      T  
Sbjct: 6   QRARLLVSCQDRPGVVANISSFLYNHEANIVQSDQYSTDPEGGMFFMRIEFAWQEEKTAF 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 F  +      Q+ +       +  I VS+ +HCL++LL++W  G L   I  V+
Sbjct: 66  SEIKQAFSVLADAEHYQWRMEQASRKKRMAIFVSKENHCLSELLWKWRAGELYAEIPLVI 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH  +K+ VE Y +PF+++P T+ N+ E+E K I ++ ++N+EL++LARYMQILS    
Sbjct: 126 SNHPDNKEEVEAYGIPFFHIPSTKANRREAEDKAIELLHEHNIELIVLARYMQILSPTFV 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                +IINIHHSFLP+F GANPY +A+E GVK+IGATAHY   +LD GPIIEQDV+RV 
Sbjct: 186 STFPQQIINIHHSFLPAFIGANPYAKAFERGVKLIGATAHYVTDDLDEGPIIEQDVLRVN 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T  D    G+ IE   L +AVN H+  ++ +   KTIVF
Sbjct: 246 HRHTTADLRIAGRQIERIALARAVNWHLNDQLIVYNNKTIVF 287


>gi|19551628|ref|NP_599630.1| formyltetrahydrofolate deformylase [Corynebacterium glutamicum ATCC
           13032]
 gi|62389281|ref|YP_224683.1| formyltetrahydrofolate deformylase [Corynebacterium glutamicum ATCC
           13032]
 gi|21323147|dbj|BAB97775.1| Formyltetrahydrofolate hydrolase [Corynebacterium glutamicum ATCC
           13032]
 gi|41324615|emb|CAF19097.1| PROBABLE FORMYLTETRAHYDROFOLATE DEFORMYLASE PROTEIN
           [Corynebacterium glutamicum ATCC 13032]
          Length = 304

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 105/286 (36%), Positives = 169/286 (59%), Gaps = 7/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
             ++LT  CP +  I + +  +L+ +G  I +   F D D++  F R +      +T ++
Sbjct: 19  RQFVLTFGCPDSTGIVAKLSSFLAERGGWITEAGYFTDPDSNWFFTRQAIRAESIDTTIE 78

Query: 59  LFIADFQPIVQQFSLQ--YSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               +F P+ ++F  +  +S  +T +  K ++LVS+  HCL+DLL R       + +V V
Sbjct: 79  QLREEFAPLAEEFGPRAKWSFTDTAQVKKAVLLVSKEGHCLHDLLGRVAENDYPMEVVAV 138

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSD 174
           V NH   + + EN+ +PF+++P  +    K ++  ++  I+   + + ++LAR+MQIL  
Sbjct: 139 VGNHENLRYIAENHNVPFFHVPFPKDAVGKRKAFDQVAEIVNGYDPDAIVLARFMQILPP 198

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR++NIHHSFLPSF GA PY QAY  GVK+IGAT HYA  +LD GPIIEQDV+
Sbjct: 199 DLCEMWAGRVLNIHHSFLPSFMGARPYHQAYSRGVKLIGATCHYATGDLDDGPIIEQDVI 258

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           RVTH  T  +   +G++ E +VL + +  H++ RV +   +T+VF 
Sbjct: 259 RVTHKDTPTEMQRLGRDAEKQVLARGLRFHLEDRVLVYGNRTVVFD 304


>gi|218288723|ref|ZP_03492986.1| formyltetrahydrofolate deformylase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241081|gb|EED08257.1| formyltetrahydrofolate deformylase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 287

 Score =  278 bits (711), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 109/279 (39%), Positives = 167/279 (59%), Gaps = 5/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD-TSKLFMRISFVFNT---CMKLF 60
            L I+CP    I   I  +L++ G NI + +Q +        FMR+ F         +  
Sbjct: 9   RLLISCPDRIGIVGAIGQFLASCGANIAESAQHSTAPWGGDFFMRVEFELEDLPNREEAL 68

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             DF  + +++ +++     ++  +  I VS+  HCL +LL+ W  G L  ++  V+SNH
Sbjct: 69  CRDFAKLAEEYQMRWRYHPARKKKRMAIFVSRELHCLQELLWEWQDGLLDADLKMVISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LVE+  +P++Y+P+T + K E+E K + +++   +++++LARYMQILS       
Sbjct: 129 EDARPLVESLGIPYHYIPVTPETKAEAEAKQLALMDGQ-IDVIVLARYMQILSPSFLKHY 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F G NPY++AY+ GVK+IGATAHY   ELD GPIIEQDV+RV H  
Sbjct: 188 PQRIINIHHSFLPAFIGRNPYQRAYQRGVKLIGATAHYVTEELDEGPIIEQDVMRVDHRF 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D    G+ +E  VL++AV  H++ +V ++  KTIVF
Sbjct: 248 TALDLRIAGRQVERAVLSRAVKWHLEDKVIVHGNKTIVF 286


>gi|169617319|ref|XP_001802074.1| hypothetical protein SNOG_11837 [Phaeosphaeria nodorum SN15]
 gi|111059761|gb|EAT80881.1| hypothetical protein SNOG_11837 [Phaeosphaeria nodorum SN15]
          Length = 282

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 120/275 (43%), Positives = 175/275 (63%)

Query: 6   LTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIADFQ 65
           LT+ CP    I   +   L+ +   ILD+ QF+D  +   FMR+ F  +  +       +
Sbjct: 8   LTLQCPDKAGIVYAVTGLLAKENLTILDLQQFSDPMSKTFFMRVHFGHSAELNGLQESMK 67

Query: 66  PIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTHKK 125
            +     + Y IR      K LI+VS+  HCLNDLL+R   G L + +  +VSNH    +
Sbjct: 68  KLAADMQMDYQIRRVDAKPKVLIMVSKIGHCLNDLLFRVKSGQLKVEVPIIVSNHPEFAE 127

Query: 126 LVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRII 185
           + +N  + F++LP+T+  K + E +++++I K+N++L++LARYMQ+LS  LC +M+G+II
Sbjct: 128 VSKNNGIEFHHLPVTKDTKEQQETQILDLIAKHNIDLVVLARYMQVLSPRLCTEMSGKII 187

Query: 186 NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDY 245
           NIHHSFLPSFKGA PY QAYE GVKIIGATAH+   +LD GPIIEQ V RV HA + ++ 
Sbjct: 188 NIHHSFLPSFKGAKPYHQAYERGVKIIGATAHFVTADLDEGPIIEQRVARVDHALSPKEL 247

Query: 246 IAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           +  G N+E++VL  AV    ++RVF+N  KT+VF 
Sbjct: 248 VEEGSNVESQVLAAAVKWWSEKRVFLNGAKTVVFN 282


>gi|326386838|ref|ZP_08208453.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208641|gb|EGD59443.1| formyltetrahydrofolate deformylase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 357

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 127/284 (44%), Positives = 185/284 (65%), Gaps = 5/284 (1%)

Query: 1   MSS--YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK 58
           MS   +++T++CP+   I + +   L     NIL+  Q++DL T K FMR+ F       
Sbjct: 72  MSQEKFVITLSCPNQPGIVARVCTLLYAHRGNILEAHQYDDLATGKFFMRMVFNLGEGGD 131

Query: 59  LFI--ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                 DF  + Q++++Q+ IR+  E  K L++VS+  HCL DLLYRW IG L ++IVG+
Sbjct: 132 ARELTRDFALVGQEYAMQWQIRSLSERQKVLLMVSKFHHCLADLLYRWRIGELPMDIVGI 191

Query: 117 VSNHTTHKKLVENYQ-LPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+NH        ++  +PF+YLP+T+  K + E ++  ++E+   EL++LARYMQILSD 
Sbjct: 192 VANHPLESFAGLDFGDIPFHYLPITKDTKPQQEAQIKAVVEETGAELVVLARYMQILSDD 251

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           +   ++GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV R
Sbjct: 252 MAAYLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTSDLDEGPIIEQDVER 311

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +THA+T ED +  G++IE +VL +A++ H+  R  +N   T+VF
Sbjct: 312 ITHAETPEDLVCKGRDIERRVLARAISMHLSGRALVNGSTTVVF 355


>gi|317152712|ref|YP_004120760.1| formyltetrahydrofolate deformylase [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942963|gb|ADU62014.1| formyltetrahydrofolate deformylase [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 293

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 109/286 (38%), Positives = 169/286 (59%), Gaps = 7/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISF-----VFNT 55
           S+  L ITCP    I + +  +L  +  NI+  +Q   D +  + FMR  F       + 
Sbjct: 7   STVRLLITCPDQPGIVAAVSGFLHRKNANIIHSNQHSTDPEGGRFFMRNEFYLPGLDLDG 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
             +L       +   F + +S+    E  K +IL S+ DH L +LL+RW  G L  ++  
Sbjct: 67  LKQLRAEFAGQVSNGFIMDWSLNPVWEPKKMVILCSRVDHALMELLWRWKRGDLETDVSM 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQK-LINIIEKNNVELMILARYMQILSD 174
           V+SNH   +  VE++ +PF+++P+    + +   +  +  + +   +L++LARYMQIL+ 
Sbjct: 127 VISNHPHLRGSVEHFGVPFHHVPVGPTLRDKVGAEDTMMDLMEGQADLIVLARYMQILTQ 186

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
               +   +IINIHHSFLP+F GA+PY++A++ GVK+IGATAHY   ELD GPIIEQDV+
Sbjct: 187 DFVARFNRQIINIHHSFLPAFVGADPYRKAHQRGVKLIGATAHYVTQELDEGPIIEQDVI 246

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           RVTH+  ++D   +G +IE  VL +AV  H++ RV ++  KTIVFP
Sbjct: 247 RVTHSHDLDDLKRLGADIERHVLARAVKWHLEDRVIVDGNKTIVFP 292


>gi|119900031|ref|YP_935244.1| formyltetrahydrofolate deformylase [Azoarcus sp. BH72]
 gi|119672444|emb|CAL96358.1| Official Name Formyltetrahydrofolate deformylase [Azoarcus sp.
           BH72]
          Length = 291

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 113/284 (39%), Positives = 167/284 (58%), Gaps = 8/284 (2%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-----SKLFMRISFVFN---T 55
           Y L+ +CP    I + +  +++     IL+ S   +         + FMRI    +    
Sbjct: 7   YTLSASCPDRVGIVARVSGFIAEHRGWILETSLHAEPPREGEAIGRYFMRIEIRADSLPF 66

Query: 56  CMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +  F   F+ I  +  + + I ++    + ++LVS+ +HCL DLL RW    L + I  
Sbjct: 67  HLAEFRERFRVIADELEMDWQINDSAVKRRVVLLVSKQEHCLYDLLARWQSKELDIEIPC 126

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDH 175
           V+SNH T +  VE + +PF+++P+T  NK  +  ++  I E+   + M+LARYMQILS  
Sbjct: 127 VISNHDTFRGFVEWHGIPFHHVPVTSDNKAAAYAEVRRIFEEVRGDTMVLARYMQILSPE 186

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    G+IINIHHSFLPSF GA PY QAY  GVK+IGAT HY   +LD GPIIEQDV+R
Sbjct: 187 LCAAYPGKIINIHHSFLPSFVGAKPYHQAYAKGVKLIGATCHYVTADLDQGPIIEQDVIR 246

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + H+ ++ED +  GK+IE  VL + +  H++ RV ++  KTIVF
Sbjct: 247 IDHSDSVEDMVRYGKDIEKTVLARGLRYHLEDRVLVHGNKTIVF 290


>gi|284991334|ref|YP_003409888.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
 gi|284064579|gb|ADB75517.1| formyltetrahydrofolate deformylase [Geodermatophilus obscurus DSM
           43160]
          Length = 283

 Score =  278 bits (710), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 183/281 (65%), Gaps = 4/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
             +ILT++CP    I   +  +L   GC+I++  QF+D     LF+R   V        +
Sbjct: 3   RRFILTLSCPQRPGIVHAVTSFLFGHGCDIVEHQQFDDPLRGALFLRTEVVKVTGEADAE 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              + F+ + ++F + +++ + +   + L++VS+  HCLNDL++RW  G+L   +V VVS
Sbjct: 63  HLASAFKEVAEEFGMSFTLSDDRP-QRVLVMVSRMGHCLNDLIFRWRAGSLNAELVAVVS 121

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   LPFY++P+T ++K ++EQ+++ I++++  E+++LARYMQ+LSD+LC 
Sbjct: 122 NHEDLRPMAEAAGLPFYHVPVTPESKPQAEQRMLEIVDQHRAEVVVLARYMQVLSDNLCL 181

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+ GR INIHHSFLP FKGA PY QA++ GVK++GATAHY    LD GPIIEQ+V+R+ H
Sbjct: 182 KLLGRAINIHHSFLPGFKGAKPYHQAFDRGVKLVGATAHYVTPTLDEGPIIEQEVIRIDH 241

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                    +G++ EA  L +AV  H ++RV +N+R T+VF
Sbjct: 242 TYDPRALTTVGRDAEALALARAVRWHSERRVLLNERSTVVF 282


>gi|258512381|ref|YP_003185815.1| formyltetrahydrofolate deformylase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479107|gb|ACV59426.1| formyltetrahydrofolate deformylase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 287

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 110/279 (39%), Positives = 168/279 (60%), Gaps = 5/279 (1%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD-TSKLFMRISFVFNT---CMKLF 60
            L I+CP    I   I  +L++ G NI + +Q +        FMR+ F         +  
Sbjct: 9   RLLISCPDRIGIVGAIGQFLASCGANIAESAQHSTAPWGGDFFMRVEFELEDLPNREEAL 68

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
             DF  + +++ +++     ++  +  I VS+  HCL +LL+ W  G L  ++  V+SNH
Sbjct: 69  CRDFAKLAEEYQMRWRYHPARKKKRMAIFVSRELHCLQELLWEWQDGLLDADLKMVISNH 128

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              + LVE+  +P+YY+P+T +NK E+E + + +++   +++++LARYMQILS       
Sbjct: 129 EDARPLVESLGIPYYYIPVTPENKPEAEAQALALMDGQ-IDVIVLARYMQILSPSFLEHY 187

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             RIINIHHSFLP+F G NPY++AY+ GVK+IGATAHY   ELD GPIIEQDV+RV H  
Sbjct: 188 PQRIINIHHSFLPAFIGRNPYQRAYQRGVKLIGATAHYVTEELDEGPIIEQDVMRVDHRF 247

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D    G+ +E  VL++AV  H++ +V ++  KTIVF
Sbjct: 248 TALDLRIAGRQVERAVLSRAVKWHLEDKVIVHGNKTIVF 286


>gi|124268730|ref|YP_001022734.1| formyltetrahydrofolate deformylase [Methylibium petroleiphilum PM1]
 gi|124261505|gb|ABM96499.1| formyltetrahydrofolate deformylase [Methylibium petroleiphilum PM1]
          Length = 295

 Score =  278 bits (710), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 121/289 (41%), Positives = 169/289 (58%), Gaps = 11/289 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD----TSKLFMRISFVFN--- 54
             ++LT++C   + I   +   L   GCNILD  Q+ D+     T   FMR+ F      
Sbjct: 6   REFVLTLSCRDAKGIVYAVSGLLYQAGCNILDSQQYGDVQGADSTGLFFMRVHFSAPGHL 65

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                    F  +  +F +           + L+LVS+  HCLNDLL+RW  G+L + I 
Sbjct: 66  ADEASLDKLFAHVRGEFGMTARFHALAVKPRLLLLVSKHGHCLNDLLFRWKSGSLPVEIP 125

Query: 115 GVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQ 170
            VVSNH     L ++Y LPF++LP     +   K E E ++  ++E++ ++L++LARYMQ
Sbjct: 126 AVVSNHPDFAALCDSYGLPFHHLPLATGSSAAVKREQEARIEALVEQHRIDLVVLARYMQ 185

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           ILS   C  + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIE
Sbjct: 186 ILSADFCRFLDGRAINIHHSFLPSFKGARPYDQAHARGVKLIGATAHYVTADLDEGPIIE 245

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           QDV RV H+    D+ A+G+++E  VL +AV  H + RV ++  KT+VF
Sbjct: 246 QDVQRVDHSLGATDFTAVGRDVECVVLARAVKWHTEHRVLLDGHKTVVF 294


>gi|332528036|ref|ZP_08404069.1| formyltetrahydrofolate deformylase [Rubrivivax benzoatilyticus JA2]
 gi|332112609|gb|EGJ12402.1| formyltetrahydrofolate deformylase [Rubrivivax benzoatilyticus JA2]
          Length = 294

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 125/289 (43%), Positives = 176/289 (60%), Gaps = 11/289 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLD----TSKLFMRISFVFN--- 54
           + ++LT++C   + I   +   L   GCNI+D  QF DLD    T   FMR+ F      
Sbjct: 5   NQFVLTLSCRDTKGIVFAVSGLLYQAGCNIIDSQQFGDLDGDDATGLFFMRVHFEAPQQL 64

Query: 55  TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
             ++     F    +Q  +           + L++VSQ  HCLNDLL+RW  G L + I 
Sbjct: 65  ADVQTLDRLFAHTREQHQMDVRFHAVSRRPRLLLMVSQHGHCLNDLLFRWKSGQLPVEIP 124

Query: 115 GVVSNHTTHKKLVENYQLPFYYLP----MTEQNKIESEQKLINIIEKNNVELMILARYMQ 170
            +VSNHTT   L ++Y +PF +LP     + + K   E+++  II++  ++L++LARYMQ
Sbjct: 125 AIVSNHTTFAGLADSYGIPFVHLPLVGGSSAETKRAQEREVEAIIDRERIDLVVLARYMQ 184

Query: 171 ILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIE 230
           ILS   C  + GR INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIE
Sbjct: 185 ILSPEFCEVLRGRAINIHHSFLPSFKGARPYFQAHARGVKLIGATAHYVTADLDEGPIIE 244

Query: 231 QDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           QDV RV H  + ED+ A+G++IE +VL +AV  H+++RV +N  K++VF
Sbjct: 245 QDVERVDHTLSAEDFTAVGRDIECRVLARAVRWHVERRVLLNGHKSVVF 293


>gi|50083744|ref|YP_045254.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
 gi|49529720|emb|CAG67432.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
          Length = 296

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 170/283 (60%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F         
Sbjct: 15  NTARLLITCEDRPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELEHLQSRK 74

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               Q     + +++++Q+ +    E  K  ILVS+ DH L +LL+R + G L   I  V
Sbjct: 75  DTLIQTFSANVAERYNMQWRLAFVNELKKVGILVSKVDHALLELLWRHSRGGLPCEITKV 134

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   ++ VEN+ +PF  +P+ ++NK E+  ++  +++ N+  L++LARYMQIL +  
Sbjct: 135 VSNHEDLREAVENFGIPFEVVPVNKENKREAYAQIDELMQGND--LLVLARYMQILDEAF 192

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   +IINIHHSFLP+F GANPYKQA+E GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 193 VERWEMKIINIHHSFLPAFVGANPYKQAHEKGVKLIGATAHYVTADLDQGPIIEQDVERV 252

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T+E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 253 NHDFTVEQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 295


>gi|300727742|ref|ZP_07061128.1| formyltetrahydrofolate deformylase [Prevotella bryantii B14]
 gi|299775030|gb|EFI71636.1| formyltetrahydrofolate deformylase [Prevotella bryantii B14]
          Length = 287

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 105/286 (36%), Positives = 165/286 (57%), Gaps = 7/286 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M  + IL + CP  + I S +  +++    NI+ + Q+ D + +  FMRI +     +  
Sbjct: 1   MKPTAILLLHCPDKQGIISDVTKFITDNKGNIVYLDQYVDREDAMFFMRIEWELENFLIP 60

Query: 60  FIADFQPI----VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
                  I     Q++ +++ +    E  +  I VS+  HCL DLL R+  G   ++I  
Sbjct: 61  REKIQDFINTLYAQRYKMEFQLYFNDEKPRMAIFVSKLSHCLYDLLARYKAGEWNVDIPC 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILS 173
           ++SNH   + + + +++P+Y   + + +  K E E+  + +++K  +  ++LARYMQI+S
Sbjct: 121 IISNHEDLRYIADQFKIPYYVWSIKKDHSNKAEVEKAEMELLKKEKISFIVLARYMQIIS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +       IINIHHSFLP+F GA PY +A+E GVKIIGAT+HY   ELDAGPIIEQDV
Sbjct: 181 DDMIKTYPNHIINIHHSFLPAFIGAKPYHRAWERGVKIIGATSHYVTAELDAGPIIEQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R+TH  T E  +  GK+IE  VL++AV   I+ ++     KTI+F
Sbjct: 241 TRITHKDTPESLVLKGKDIEKIVLSRAVTKQIEHKILTYHNKTIIF 286


>gi|329955682|ref|ZP_08296590.1| formyltetrahydrofolate deformylase [Bacteroides clarus YIT 12056]
 gi|328526085|gb|EGF53109.1| formyltetrahydrofolate deformylase [Bacteroides clarus YIT 12056]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 171/284 (60%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MKTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELENFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFETLYAQKYGMNFRLYFSDAKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PF+  P+T++ K E E+K + ++ K+ V  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFHLFPITKETKEEQEKKEMELLAKHKVNFIVLARYMQVISEKM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 IDAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           TH  T++D +  GK++E  VL++AV  HI+++V   K KT++F 
Sbjct: 242 THKDTVQDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN 285


>gi|239917001|ref|YP_002956559.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
 gi|281414538|ref|ZP_06246280.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
 gi|239838208|gb|ACS30005.1| formyltetrahydrofolate deformylase [Micrococcus luteus NCTC 2665]
          Length = 301

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 172/281 (61%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT+ C + + I   +   L     +I +  Q++  DT   FMR+ FV     +     
Sbjct: 20  HVLTLACTNRKGIVHAVTGALLGVEADITESQQYDSPDTGDFFMRVEFVTPATREDIEQA 79

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             P+ ++F ++  + +  +  +TL++ S+  H LNDLL++   GTL + I  VVSNH   
Sbjct: 80  LAPVREEFGMRMGLWDAAQRMRTLVMCSKDGHTLNDLLFQQRAGTLPIEIPVVVSNHLDL 139

Query: 124 KKLVENYQLPFYYLPMTEQN-----KIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           + L   Y +PF ++P+++       K  +E +L ++I + ++EL++LARYMQILSD LC 
Sbjct: 140 QPLASFYGVPFIHVPVSKDPSSRDSKEAAEGRLRDLIAQFDIELVVLARYMQILSDELCR 199

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + G  INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII Q V  VTH
Sbjct: 200 DLAGMAINIHHSFLPSFKGARPYHQAHERGVKLIGATAHYVTADLDEGPIIAQSVQPVTH 259

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           AQT  D++A G+++E   L +AV  H Q RV  + R+T+VF
Sbjct: 260 AQTAADFVARGRDVEGSTLAQAVRWHAQHRVLADGRRTVVF 300


>gi|87121292|ref|ZP_01077182.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
 gi|86163449|gb|EAQ64724.1| formyltetrahydrofolate deformylase [Marinomonas sp. MED121]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 109/281 (38%), Positives = 180/281 (64%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
           +++ L I+CP    I + + D +     +I++ S   D +    FMR           + 
Sbjct: 3   NTFRLVISCPDTVGIVAAVSDIIQENNGSIMEASHHTDPEQKWFFMRHEVDAENMAISLA 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F   F+PI ++F + + I++++E  K +++ ++  HCLND+L+RW+ G L  +IVGV++
Sbjct: 63  EFKQAFEPIAKKFQMDWYIKDSEERPKVILMATRESHCLNDILHRWHTGELYCDIVGVIA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE + +PF+++ + +++K+E+ +K+   I+++  E ++LARYMQI  ++LC 
Sbjct: 123 NHEELRSMVEWFNIPFHFIQVPKEDKMEAFEKIEKCIDESQAETIVLARYMQIFPEYLCE 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K   ++INIHHSFLPSF GA PY QA   GVK+IGAT HY   +LDAGPIIEQDV+RV H
Sbjct: 183 KYRHQVINIHHSFLPSFIGAKPYHQAAVRGVKLIGATCHYVTADLDAGPIIEQDVIRVRH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + T    + +GK+IE  VL++ +  H++ RV ++  KT+VF
Sbjct: 243 SHTAPAMVRLGKDIEKLVLSRGLRYHLEDRVLVHGNKTVVF 283


>gi|71279439|ref|YP_269198.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71281589|ref|YP_270694.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71145179|gb|AAZ25652.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71147329|gb|AAZ27802.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
          Length = 292

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF----NTCM 57
            ++I+T  CPS      ++  +L  +G  I +I  F+D   ++ F+RI F      +   
Sbjct: 9   QTHIITADCPSRPGTVDVVTRFLCEKGFYINEIHSFDDTAVNRFFIRIEFRAQTATDFSA 68

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           + F  +F+    +F +Q+ + ++   +K +I+VS+ DHCLNDLLYR+  G L + I  ++
Sbjct: 69  ETFSQEFEQRASEFEMQWQLASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLDIEIPAII 128

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   ++L + + +P+Y+LP+T+  K E E K+  II++++ +L++LARYMQ+LS  LC
Sbjct: 129 SNHPDLEELAKWHGIPYYHLPITKDTKPEQEAKVWQIIQESDADLVVLARYMQVLSSDLC 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++G+ INIHHS LP FKGA PY QAY+ G+K++GATAHY   +LD GPII Q V  V 
Sbjct: 189 QKLSGKAINIHHSLLPGFKGARPYFQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVD 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D  A G++IE   L++AV  HI+ R+F+  +KT+VF
Sbjct: 249 HGYYPKDLAAKGRDIECLTLSRAVRCHIEHRIFMYGKKTVVF 290


>gi|160891941|ref|ZP_02072944.1| hypothetical protein BACUNI_04399 [Bacteroides uniformis ATCC 8492]
 gi|270296396|ref|ZP_06202596.1| formyltetrahydrofolate deformylase [Bacteroides sp. D20]
 gi|317480411|ref|ZP_07939509.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_1_36]
 gi|156858419|gb|EDO51850.1| hypothetical protein BACUNI_04399 [Bacteroides uniformis ATCC 8492]
 gi|270273800|gb|EFA19662.1| formyltetrahydrofolate deformylase [Bacteroides sp. D20]
 gi|316903432|gb|EFV25288.1| formyltetrahydrofolate deformylase [Bacteroides sp. 4_1_36]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 108/284 (38%), Positives = 171/284 (60%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MKTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKDFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F  +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFATLYAQKYEMNFRLYFSDTKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PF+  P+T++ K E E+K + ++ K+ +  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFHLFPITKETKEEQEKKEMELLAKHKITFIVLARYMQVISEQM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           TH  T++D +  GK++E  VL++AV  HI+++V   K KT++F 
Sbjct: 242 THKDTVQDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN 285


>gi|189467091|ref|ZP_03015876.1| hypothetical protein BACINT_03474 [Bacteroides intestinalis DSM
           17393]
 gi|224535501|ref|ZP_03676040.1| hypothetical protein BACCELL_00364 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189435355|gb|EDV04340.1| hypothetical protein BACINT_03474 [Bacteroides intestinalis DSM
           17393]
 gi|224522894|gb|EEF91999.1| hypothetical protein BACCELL_00364 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 285

 Score =  277 bits (709), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 111/283 (39%), Positives = 170/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MKTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELKNFLIPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F  +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFATLYAQKYEMFFRLYFSDTKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PFY  P+T++ K E E+K + ++ K+ V  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFYLFPITKETKEEQEKKEMELLAKHKVNFIVLARYMQVISERM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 IDAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  T+ED +  GK++E  VL++AV  HI+++V   K KT++F
Sbjct: 242 THKDTVEDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIF 284


>gi|110632813|ref|YP_673021.1| formyltetrahydrofolate deformylase [Mesorhizobium sp. BNC1]
 gi|110283797|gb|ABG61856.1| formyltetrahydrofolate deformylase [Chelativorans sp. BNC1]
          Length = 286

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 180/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKL 59
            ++ + ++C     I + +   L+  G NI + +QF D  T++ FMRISF    N     
Sbjct: 4   KTFDINLSCEDRPGIVAAVTTELAALGANIAESNQFWDRQTNRFFMRISFTVPENIDRDA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P + +F+++ ++ +     K +I+VS+ DH L  LLY+  +G L   +  +VSN
Sbjct: 64  ISRALNPAIARFNMETALADRSRRPKIIIMVSKFDHALLHLLYQIRVGWLDSEVAAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   ++  E   +P+Y  P+T+ NK E E+KL+N+  +   +L+ILARYMQ+LSD L  +
Sbjct: 124 HEDSRRTAEAAGIPYYCWPVTKANKAEQEEKLLNLFRETGSDLIILARYMQVLSDQLSSR 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G+IINIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RVTHA
Sbjct: 184 LFGKIINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVSPDLDEGPIIEQETERVTHA 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            + +D++A G++IE++VL +AV  H++ RV +N  KT+VF
Sbjct: 244 MSPDDFVAAGRDIESRVLARAVKLHLESRVVLNGLKTVVF 283


>gi|148261747|ref|YP_001235874.1| formyltetrahydrofolate deformylase [Acidiphilium cryptum JF-5]
 gi|326405242|ref|YP_004285324.1| formyltetrahydrofolate deformylase [Acidiphilium multivorum AIU301]
 gi|146403428|gb|ABQ31955.1| formyltetrahydrofolate deformylase [Acidiphilium cryptum JF-5]
 gi|325052104|dbj|BAJ82442.1| formyltetrahydrofolate deformylase [Acidiphilium multivorum AIU301]
          Length = 283

 Score =  277 bits (708), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF--VFNTCMK 58
           MSS ILT++C +   I   +  +L   G +I +  QF+D  + + FMR+ F  V +    
Sbjct: 1   MSS-ILTLSCRNRPGIVGAVGHFLHAHGQDIREAQQFDDRASGRFFMRVVFAPVGDAPSS 59

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F  + ++F + + I  +    +T+ILVS+ DHCL DL+YR  IG L ++IVGV++
Sbjct: 60  GLEAEFAAVGREFGMDWEITPSGHRMRTMILVSRFDHCLVDLVYRQRIGELPMDIVGVIA 119

Query: 119 NHTT-HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           NH       ++   +PF++LP+    K+E E ++  ++ ++  EL ILARYMQ+LSD L 
Sbjct: 120 NHPRESYAHLDLDGIPFHHLPIAPDTKMEQEAEVWRLMRESGAELAILARYMQVLSDGLV 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+ GR INIHHSFLP FKGA PY QAY  GVK+IGATAHY    LD GPIIEQDV R++
Sbjct: 180 AKLAGRCINIHHSFLPGFKGAKPYHQAYARGVKLIGATAHYVTTALDEGPIIEQDVERIS 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T E  +  G++IE +VL +AV  H+++RVFI+  KT+VF
Sbjct: 240 HGDTPEALVRKGRDIERRVLARAVLGHLERRVFISGSKTVVF 281


>gi|289624011|ref|ZP_06456965.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650514|ref|ZP_06481857.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868170|gb|EGH02879.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 288

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 182/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKTGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 KQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|326384032|ref|ZP_08205715.1| formyltetrahydrofolate deformylase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197192|gb|EGD54383.1| formyltetrahydrofolate deformylase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 296

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 104/283 (36%), Positives = 160/283 (56%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             ++LT+ CP    I + +  +L+  G  I + +  +D  T   F R +   ++    ++
Sbjct: 13  RRFVLTLGCPDRTGIVAALSGFLAGVGGWITEAAYHSDQTTGWFFTRQAVRADSIGMSVE 72

Query: 59  LFIADFQPIVQQF--SLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            F + F  +   F    ++ + +T      ++LVS+  HCL DLL R   G     I  V
Sbjct: 73  EFRSRFAEVAAMFGPEAEWQVSDTGAEKSVVLLVSKDSHCLTDLLARAERGEFPARISAV 132

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           V NH   + +   + +PF+Y+P T   K E+  ++  I++  + + ++LAR+MQIL   L
Sbjct: 133 VGNHRDLESMTTRFGVPFHYVPFTPGGKDEAFGEVRRIVDGYDPDAVVLARFMQILPPEL 192

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C    G+ INIHHSFLPSF GA PY QA++ GVK+IGAT HY   +LDAGPIIEQDV R+
Sbjct: 193 CEAWAGKAINIHHSFLPSFVGARPYHQAFDRGVKLIGATCHYVTADLDAGPIIEQDVSRI 252

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  +  D +  G++IE  VL + V  H++ RV ++ RKT+VF
Sbjct: 253 NHEYSAADMVRQGRDIETLVLARGVRWHLEHRVLVHDRKTVVF 295


>gi|303246977|ref|ZP_07333253.1| formyltetrahydrofolate deformylase [Desulfovibrio fructosovorans
           JJ]
 gi|302491684|gb|EFL51567.1| formyltetrahydrofolate deformylase [Desulfovibrio fructosovorans
           JJ]
          Length = 285

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 111/285 (38%), Positives = 164/285 (57%), Gaps = 7/285 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NT 55
           M+ +  L ITCP    I S +  +L   G NI+D+ Q   D +    FMR+ F     + 
Sbjct: 1   MTHTARLRITCPDRPGIVSAVTTFLHAHGANIVDLDQHSTDPEGGTFFMRLEFYTPYMDM 60

Query: 56  CMKLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIV 114
                 + F  +    F + + +  +    + +ILVS+ DHCL +LL+R   G L   + 
Sbjct: 61  SRPALESSFGEVVGTPFCMDWRLSYSDVKKRAVILVSRHDHCLMELLWRHARGELPCEVA 120

Query: 115 GVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
            V+SNH   +  VE++ +PF  +P+ +    E+E ++  ++     +L++LARYM++LS 
Sbjct: 121 MVISNHEDARTSVESFGVPFSCVPVGDGGMPEAEARMAELLGD-ATDLVVLARYMRVLSA 179

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
                   R+INIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELDAGPIIEQD  
Sbjct: 180 DFLRPYDTRVINIHHSFLPAFVGADPYRQAHERGVKLIGATAHYVTAELDAGPIIEQDTA 239

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RVTH  ++ D  A G  +E  VL +AV  H++ RV +   KT+VF
Sbjct: 240 RVTHRFSVADLKATGSELERTVLARAVKWHLEDRVIVFGNKTVVF 284


>gi|331006342|ref|ZP_08329654.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC1989]
 gi|330419847|gb|EGG94201.1| Formyltetrahydrofolate deformylase [gamma proteobacterium IMCC1989]
          Length = 288

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 126/283 (44%), Positives = 183/283 (64%), Gaps = 4/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           +  +L ++C     I + + +  + QG NI   SQF D+  S+ FMR  F        ++
Sbjct: 5   TDIVLKLSCKDQPGIVAAVANLFALQGFNIRASSQFEDVSASRFFMRTVFESCEGGKPLE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                FQP+ +++ + + + +T+   K LI VSQ  HCL+ LL  W  G+LA++IVGVVS
Sbjct: 65  DVKVCFQPLAERYGMSWELVDTQNKPKVLIAVSQWGHCLSHLLNAWKRGSLAVDIVGVVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKN-NVELMILARYMQILSDHLC 177
           NH   + L + Y++PFY+LP+T + K + E +L+ +++     + ++LARYMQILS+ +C
Sbjct: 125 NHEVMRSLCDWYEVPFYFLPITAETKPQQEAQLLTLMDDTLGADFLVLARYMQILSNGMC 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ V RV+
Sbjct: 185 EQLAGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTTDLDEGPIIEQSVERVS 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA + E+ + IG++IEA VL +AV  H + RV IN  KT+VF 
Sbjct: 245 HANSPEELVEIGQDIEAIVLNRAVRWHAEYRVLINGEKTVVFD 287


>gi|134103408|ref|YP_001109069.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291006052|ref|ZP_06564025.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133916031|emb|CAM06144.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 290

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 99/285 (34%), Positives = 167/285 (58%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
             ++L++ CP    I + I  +L+  G  I++     D DT   F R     +     ++
Sbjct: 6   RRFVLSLGCPDRTGIVARIAGFLADWGGWIVEAGYHTDPDTGWFFTRQEVRADSVPFDLE 65

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F  +  +     ++ + +T E  + +ILVS+  HCL+DLL R   G L +++  V
Sbjct: 66  ELRTRFAAVAAELGDRTEWRVSDTAERRRVVILVSREGHCLHDLLGRIGSGELDVDLRAV 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSD 174
           + NH     + E + +PF+++P  + +  K ++  ++  +++ +  + ++LAR+MQ+L  
Sbjct: 126 IGNHPNLGPITEAHGIPFHHVPFPKDSEGKADAFAQVRELVDAHEPDAVVLARFMQVLPA 185

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC   +GR +NIHHSFLPSF GA PY QAYE GVK++GAT HY   ELDAGPI+EQDV+
Sbjct: 186 ELCEAWSGRALNIHHSFLPSFAGARPYHQAYERGVKLVGATCHYVTAELDAGPIVEQDVI 245

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H  ++ D +  G++IE  VL + + +H++ RV ++ ++T+VF
Sbjct: 246 RVDHTDSVADMVRKGRDIEKLVLARGLRSHLEGRVLMHGKRTVVF 290


>gi|111018815|ref|YP_701787.1| formyltetrahydrofolate deformylase [Rhodococcus jostii RHA1]
 gi|110818345|gb|ABG93629.1| probable formyltetrahydrofolate deformylase [Rhodococcus jostii
           RHA1]
          Length = 282

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 177/282 (62%), Gaps = 4/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           M+ ++ LT++C     I   +  +L  Q C+I +  QF+D  +   F+R SFV   +  +
Sbjct: 1   MTQTFTLTLSCAQRPGIVHAVSSFLFEQNCDIAEHQQFDDTRSDAFFLRTSFVSAEDVDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A+F  +  +F + ++  N  +  + +++VS+  HCLNDL++RW  G L   +V VV
Sbjct: 61  ERLTAEFGSVAAKFGMTFN-FNGTDLPRVIVMVSKMGHCLNDLIFRWRAGNLGAELVAVV 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   LPF ++P+T   K ++E +L+ ++E+ + +L++LARYMQ+LSD  C
Sbjct: 120 SNHEVLRPMAEAAGLPFVHVPVTPATKPQAEARLLELVEEYDADLVVLARYMQVLSDDAC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLP FKGA PY QA++ GVK +GATAHY   +LD GPIIEQ+V+R+ 
Sbjct: 180 RALRGRAINIHHSFLPGFKGAKPYHQAFDRGVKQVGATAHYVTPDLDEGPIIEQEVIRID 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+        +G++ EA  L++AV  H + RV ++  +T+VF
Sbjct: 240 HSFDPARLATVGQDAEALALSRAVRWHCENRVLLHGHRTVVF 281


>gi|302188787|ref|ZP_07265460.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae 642]
          Length = 288

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 180/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--- 58
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN   +   
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDI 65

Query: 59  -LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKAGFDAVANDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+T++ K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVTKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 QQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H     D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 246 HVYLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|218130080|ref|ZP_03458884.1| hypothetical protein BACEGG_01667 [Bacteroides eggerthii DSM 20697]
 gi|317476573|ref|ZP_07935819.1| formyltetrahydrofolate deformylase [Bacteroides eggerthii
           1_2_48FAA]
 gi|217987584|gb|EEC53912.1| hypothetical protein BACEGG_01667 [Bacteroides eggerthii DSM 20697]
 gi|316907249|gb|EFV28957.1| formyltetrahydrofolate deformylase [Bacteroides eggerthii
           1_2_48FAA]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 172/284 (60%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +         
Sbjct: 2   MKTAKLLLHCPDKPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELENFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFETLYAQKYGMSFRLYFSDAKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PF+  P+T++ K E E+K + ++ K+ V  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFHLFPITKETKEEQEKKEMELLAKHKVNFIVLARYMQVISEKM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
            +    RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 INAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           TH  T++D +  GK++E  VL++AV  HI+++V   K KT++F 
Sbjct: 242 THKDTVQDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN 285


>gi|320355302|ref|YP_004196641.1| formyltetrahydrofolate deformylase [Desulfobulbus propionicus DSM
           2032]
 gi|320123804|gb|ADW19350.1| formyltetrahydrofolate deformylase [Desulfobulbus propionicus DSM
           2032]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 100/282 (35%), Positives = 170/282 (60%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           SS IL I CP N+ I + + +++     NI  + Q  D      FMRI +  +       
Sbjct: 3   SSAILLIHCPDNKGIVATVSEFIFKNNGNITYLDQHVDSTQKTFFMRIEWELDDFIIPPN 62

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                F   I +++S+++ +  + E  +  + VS+  HCL D+L RW    + ++I  V+
Sbjct: 63  KIGEYFDTLIAKKYSMKWQLHFSNEVPRMALFVSKLPHCLYDILSRWKSQEIEVDIPLVI 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +   + + FY+  +  +NK E EQ  + ++ ++++E ++LARYMQILS+   
Sbjct: 123 SNHLELEPIARQFGIDFYHFAINTENKREQEQAQLQLLAEHDIEFIVLARYMQILSEEFI 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                +IINIHHSFLP+F GA PY  A+E GVK+IGAT+HY   ELDAGPII QD++RV+
Sbjct: 183 SHYRNKIINIHHSFLPAFPGARPYHSAFERGVKVIGATSHYVTAELDAGPIITQDIIRVS 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA +++D +  G+++E  +L +++  H+++++ + + +T+VF
Sbjct: 243 HADSVDDLMRKGRDLEKVILARSIWHHLKRQILVFQNRTVVF 284


>gi|119944785|ref|YP_942465.1| formyltetrahydrofolate deformylase [Psychromonas ingrahamii 37]
 gi|119863389|gb|ABM02866.1| formyltetrahydrofolate deformylase [Psychromonas ingrahamii 37]
          Length = 296

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 115/281 (40%), Positives = 175/281 (62%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCMK 58
           + I+T +CP        +  YL  QGC I +I+ F+D+DT + F+RI F  +       +
Sbjct: 14  TQIITASCPGGLGTVDAVTAYLYQQGCYINEINSFDDIDTQRFFIRIEFRPDRQSAFNRE 73

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            FI+ F+     F + +++    +  K +I+VS+ DHCLNDLLYR+  G L + I  ++S
Sbjct: 74  NFISGFKTKAASFDMDWTLTRKDDKAKVVIMVSKHDHCLNDLLYRYRTGDLKIEIPAIIS 133

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L + + +P+++LP+ +  K + E  +  II+  + +L++LARYMQ+LS  +C 
Sbjct: 134 NHPDLEELAKWHGIPYFHLPVNKDIKPQQEAMIWKIIQDCDADLVVLARYMQVLSSEMCQ 193

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G  INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H
Sbjct: 194 RLAGWAINIHHSLLPGFKGAKPYYQAYHKGVKLVGATAHYISDDLDEGPIITQGVETVDH 253

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +    D  A G+ IE + L++AV  HI+QRVF++  K++VF
Sbjct: 254 SHYPADLAAKGQAIECQTLSRAVRWHIEQRVFLHGEKSVVF 294


>gi|329847336|ref|ZP_08262364.1| formyltetrahydrofolate deformylase [Asticcacaulis biprosthecum C19]
 gi|328842399|gb|EGF91968.1| formyltetrahydrofolate deformylase [Asticcacaulis biprosthecum C19]
          Length = 297

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 131/287 (45%), Positives = 180/287 (62%), Gaps = 9/287 (3%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFND----LDTS-KLFMRISF----V 52
           S Y+L I CP    I + +  YL+    +I++ +QFND     D     ++R+ F     
Sbjct: 10  SHYVLIIKCPDTRGIVAAVSGYLNDNDISIVESNQFNDAHRSEDRGDMFYVRVVFKQAGP 69

Query: 53  FNTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
               M+     F+PI  +FS+ + + N     + LI VS+  HCL +LL+RW  G L + 
Sbjct: 70  KTPPMETLRDGFKPIAHRFSMDWQVFNLSHKPRVLIAVSKFGHCLYELLHRWKAGLLPVE 129

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           I GV+SNH   +  VE   +PF YLP+ +QNK E E   +++I+++  +L++LARYMQIL
Sbjct: 130 ITGVMSNHEDMRSFVEWNDIPFVYLPVNKQNKDEQESAFLSLIDRHQADLVVLARYMQIL 189

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
           SD L  ++ GR INIHHSFLPSFKGA PY QA+  GVKIIGATAHY   +LD GPIIEQD
Sbjct: 190 SDDLARRLQGRCINIHHSFLPSFKGAKPYHQAHARGVKIIGATAHYVTSDLDEGPIIEQD 249

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V RV H  T E  + IG++IE++VL +AV  H ++RV IN  KT+VF
Sbjct: 250 VQRVHHGLTPEQLVVIGRDIESRVLARAVTWHAERRVIINGGKTVVF 296


>gi|148607971|gb|ABQ95541.1| formyltetrahydrofolate deformylase [Aeromonas veronii]
          Length = 278

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 94/279 (33%), Positives = 160/279 (57%), Gaps = 2/279 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M   IL   CP  + + + I +       NI+   +F D +  + FMR         +  
Sbjct: 1   MEKKILLTDCPDAKGLIAKITNICYKHQLNIIKNDEFVDHENGRFFMRTELEGRFNDETL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +AD    +   + +  ++  K   + +ILV++  HCL D+L +   G L ++IV V+ N+
Sbjct: 61  LADLDDALPAGAQRRLVKAGK--KRIVILVTKETHCLGDILMKNYAGALDMDIVAVIGNY 118

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T  +L   + +PF+ +   + ++ E E+++  II+    + +ILA+YM++L+       
Sbjct: 119 DTLAELTGKFDIPFHTVSHEDLSRTEHEEQVRAIIDSYEPDYVILAKYMRVLTPSFVEAY 178

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +I+NIHHSFLP+F GA PY+QA++ GVK+IGATAH+   +LD GPI+EQDV+ V HA 
Sbjct: 179 PRKILNIHHSFLPAFIGARPYRQAFDRGVKLIGATAHFVTDDLDEGPIVEQDVIHVGHAF 238

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D    G+++E  VL++A+   + +RVF+   KT+VF
Sbjct: 239 SADDMAKAGRDVEKSVLSRALELVLNERVFVYGNKTVVF 277


>gi|117619271|ref|YP_855851.1| formyltetrahydrofolate deformylase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117560678|gb|ABK37626.1| formyltetrahydrofolate deformylase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 278

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 93/279 (33%), Positives = 158/279 (56%), Gaps = 2/279 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M   IL   CP  + + + I +       NI    +F D +  + FMR         +  
Sbjct: 1   MEKKILLTDCPDAKGLIAKITNICYKHQLNINKNDEFVDHENGRFFMRTELEGRFNDETL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +AD    +   + +  ++  K   + +ILV++  HCL D+L +   G L ++IV V+ N+
Sbjct: 61  LADLDDALPAGAQRRLVKAGK--KRIVILVTKETHCLGDILMKNYAGALDMDIVAVIGNY 118

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T  +L   + +PF+ +   + ++ E E+++  II+    + ++LA+YM++L+       
Sbjct: 119 DTLAELTGKFDIPFHTVSHEDLSRTEHEEQVRAIIDGYQPDYVVLAKYMRVLTPSFVEAY 178

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GA PY+QA++ GVK+IGATAH+   +LD GPI+EQDV+ V H  
Sbjct: 179 PRKIINIHHSFLPAFIGARPYRQAFDRGVKLIGATAHFVTDDLDEGPIVEQDVIHVDHTF 238

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D    G+++E  VL++A+   + +RVF+   KT+VF
Sbjct: 239 SADDMAKAGRDVEKSVLSRALELVLNERVFVYGNKTVVF 277


>gi|330888410|gb|EGH21071.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 288

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 183/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKTGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 KQLSGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPEDLVAEGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|262369952|ref|ZP_06063279.1| formyltetrahydrofolate deformylase [Acinetobacter johnsonii SH046]
 gi|262314991|gb|EEY96031.1| formyltetrahydrofolate deformylase [Acinetobacter johnsonii SH046]
          Length = 288

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 112/283 (39%), Positives = 172/283 (60%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFN---TCM 57
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +   +  
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDNLQSRK 66

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F   + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G L   I  V
Sbjct: 67  ESITQTFAANVAERYEMQWRLALVSDVKKVGILVSKVDHALLELLWRHARGGLPCEITKV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH T ++ VEN+ +PF  +P+T+ NK E+  ++  +++ N+  L++LARYMQIL +  
Sbjct: 127 ISNHETLREAVENFGIPFEVVPVTKDNKREAYAEIDELMQGND--LLVLARYMQILDEAF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   ++INIHHSFLP+F GANPYKQA+E GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VEKWEMKVINIHHSFLPAFVGANPYKQAHEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H  T++    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 NHDFTVDQLRELGQDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|332139883|ref|YP_004425621.1| formyltetrahydrofolate deformylase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327549905|gb|AEA96623.1| formyltetrahydrofolate deformylase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 284

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 100/281 (35%), Positives = 167/281 (59%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            ++ L I CP    + + +  +L+     I++ +   DL T + FMR     ++     +
Sbjct: 3   QTFRLVIDCPDQIGLVASVSQFLADHNATIVEANHHTDLQTGRFFMRHEISTDSLKLDHQ 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ +F P+  ++ + + + ++ +  +  +L S   HCL DLL+RW+ G L  +I  ++ 
Sbjct: 63  SFVKEFTPLANEYQMNWKLSDSNKKQRVALLASLESHCLVDLLHRWHTGELHCDIPVIIG 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + Y++PF+++      K  +  ++  ++E+  ++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWYKVPFHWVDFKALGKEAAFAQISTLLEEYKIDLTVLARFMQILPDSLCQ 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R++H
Sbjct: 183 QLQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAADMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|254490556|ref|ZP_05103742.1| formyltetrahydrofolate deformylase [Methylophaga thiooxidans
           DMS010]
 gi|224464300|gb|EEF80563.1| formyltetrahydrofolate deformylase [Methylophaga thiooxydans
           DMS010]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 114/281 (40%), Positives = 176/281 (62%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCMK 58
           MSS +  I C   + + + I  + + +  NIL   Q+ D++  + FMRI          +
Sbjct: 1   MSSIVFLIQCTDQKGLVAGITSFFAERQFNILHCQQYTDVEIGQYFMRIKLEDEGTLPHE 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
              A+F+   Q  +L +S+R ++   +  +LV++  HC  DLL R   G L  +I  ++ 
Sbjct: 61  QLEAEFERFAQTVNLSWSVRYSETPYRVALLVTRASHCPYDLLLREYEGELKCDIPLIIG 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   +++   +  PFY+LP++++ K+E E  +  ++ + +++L+++ARYMQILS+    
Sbjct: 121 NHKDLEQMARQFDKPFYHLPISKETKLEQEAAIKKLLTEYDIDLVVMARYMQILSEQFVQ 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +  G++INIHH FLP+F+GA PY QAYE GVKIIGATAHYA  +LD GPIIEQDV RV H
Sbjct: 181 EFAGKVINIHHGFLPAFQGARPYHQAYERGVKIIGATAHYATADLDEGPIIEQDVQRVMH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             + ED + +GK+IE  VL +AV AHI+ R+ I+ R+TIVF
Sbjct: 241 DNSPEDLVMVGKDIERMVLARAVKAHIEHRIIISGRRTIVF 281


>gi|330828998|ref|YP_004391950.1| formyltetrahydrofolate deformylase [Aeromonas veronii B565]
 gi|328804134|gb|AEB49333.1| Formyltetrahydrofolate deformylase [Aeromonas veronii B565]
          Length = 278

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 94/279 (33%), Positives = 160/279 (57%), Gaps = 2/279 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M   IL   CP  + + + I +       NI+   +F D +  + FMR         +  
Sbjct: 1   MEKKILLTDCPDAKGLIAKITNICYKHQLNIIKNDEFVDHENGRFFMRTELEGRFNDETL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +AD    +   + +  ++  K   + +ILV++  HCL D+L +   G L ++IV V+ N+
Sbjct: 61  LADLDDALPIGAQRRLVKAGK--KRIVILVTKETHCLGDILMKNYAGALDMDIVAVIGNY 118

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T  +L   + +PF+ +   + ++ E E+++  II+    + +ILA+YM++L+       
Sbjct: 119 DTLAELTGKFDIPFHTVSHEDLSRTEHEEQVRTIIDSYEPDYVILAKYMRVLTPSFVEAY 178

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +I+NIHHSFLP+F GA PY+QA++ GVK+IGATAH+   +LD GPI+EQDV+ V HA 
Sbjct: 179 PRKILNIHHSFLPAFIGARPYRQAFDRGVKLIGATAHFVTDDLDEGPIVEQDVIHVGHAF 238

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D    G+++E  VL++A+   + +RVF+   KT+VF
Sbjct: 239 SADDMAKAGRDVEKSVLSRALELVLNERVFVYGNKTVVF 277


>gi|299138183|ref|ZP_07031363.1| formyltetrahydrofolate deformylase [Acidobacterium sp. MP5ACTX8]
 gi|298600113|gb|EFI56271.1| formyltetrahydrofolate deformylase [Acidobacterium sp. MP5ACTX8]
          Length = 289

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 111/282 (39%), Positives = 162/282 (57%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQ-GCNILDISQFNDLDTSKLFMRISFVFN---TCM 57
            +  L I CP  + + + I ++L  Q   NIL+  Q  D +    FMR+ F         
Sbjct: 7   KTATLLIDCPDRKGLVAAIINFLVQQYDVNILNADQHQDAELGLFFMRVEFATEAAGFDE 66

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   FQP+ QQF + + I          + VSQ  HCL DLL+R   G    N+  +V
Sbjct: 67  LSFRTAFQPLAQQFQMNWRIELADAPQNVCLFVSQYLHCLADLLHRHQTGEFHCNLALIV 126

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH + + L E + +PFYYLP+  +NK + E++ + +++++ ++L++LARYMQILS    
Sbjct: 127 SNHESARPLAEFHHVPFYYLPVGRENKQQVERQQLALLDEHKIDLVVLARYMQILSPKFV 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIIN+HHSFLP+F GA PY  A+  GVK+IGAT+HY   ELD GPIIEQDV RV+
Sbjct: 187 DAYPRRIINVHHSFLPAFTGAKPYHAAFARGVKLIGATSHYVTAELDEGPIIEQDVARVS 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +   I  G+++E  VL++AV  H+  R+     KT++F
Sbjct: 247 QNDQLPSLIQKGRDLERLVLSRAVQWHLDHRILSYANKTVIF 288


>gi|118591547|ref|ZP_01548944.1| probable formyltetrahydrofolate deformylase [Stappia aggregata IAM
           12614]
 gi|118435875|gb|EAV42519.1| probable formyltetrahydrofolate deformylase [Stappia aggregata IAM
           12614]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 114/280 (40%), Positives = 185/280 (66%), Gaps = 2/280 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC--MKLFI 61
           Y+LT++C     I + +   L+  G NI +  QF D  T++ F+RI+ +      ++   
Sbjct: 6   YVLTLSCADKPGIVAAVTTELADFGANIAESDQFWDRVTNQFFLRIAMLAPEGVTLESVQ 65

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               P++ +F ++  + +T +  K +++VS+ DH +  LLY+  +G +   +V +VSNHT
Sbjct: 66  KALDPVISRFDMKAKLVDTAKRPKVIVMVSKFDHAMLHLLYQIRVGWMDAEVVAIVSNHT 125

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             ++  E+  + +++ P+ ++NK E E+KL+ ++++   +L++LARYMQ+LSD+L  ++ 
Sbjct: 126 DSQRTAEHEGIAYHHWPVNKENKAEQEEKLLKLVKETGADLVVLARYMQVLSDNLSKRLF 185

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G+IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD  RV+HA +
Sbjct: 186 GKIINIHHSFLPSFKGAKPYHQAHTRGVKMIGATAHYVTPDLDEGPIIEQDAERVSHALS 245

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
            +D++A G++IE++VL +AV  H++ RV I   KTIVF  
Sbjct: 246 ADDFVARGRDIESRVLARAVKYHLENRVMIVGNKTIVFTP 285


>gi|119714891|ref|YP_921856.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
 gi|119535552|gb|ABL80169.1| formyltetrahydrofolate deformylase [Nocardioides sp. JS614]
          Length = 284

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 119/283 (42%), Positives = 181/283 (63%), Gaps = 4/283 (1%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL 59
           M++  ILT++C     I + +  +L+ +G +I D  QF D D+   F+R+       ++ 
Sbjct: 1   MTNDLILTLSCKDRPGIVAAVAGFLADRGFSIRDSQQFGDEDSELFFIRVHAASEMPVEF 60

Query: 60  F--IADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               A+F   I       +++ +     + L++VS+  HCLNDLL+R   G+LA ++V +
Sbjct: 61  DTLRAEFDTTIGSVLEASWALHDPSVKHRLLLMVSRQGHCLNDLLHRVRTGSLAADVVAI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   ++LVE + +PF+++P+T ++K  +E +L  ++   + + +ILARYMQILSD L
Sbjct: 121 VSNHEDFRELVEWHGIPFHHVPVTAESKDWAEDELRKLVAAYDADSVILARYMQILSDSL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C  + GR INIHHS LPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQD +RV
Sbjct: 181 CRDLAGRAINIHHSLLPSFKGARPYYQAHARGVKVIGATAHYVTADLDEGPIIEQDFIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H+++  D  AIG+++EA  L +AV AH + RV +N  +T+VF
Sbjct: 241 DHSKSAADLTAIGRDLEALALARAVTAHTEHRVLMNGSRTVVF 283


>gi|295134981|ref|YP_003585657.1| formyltetrahydrofolate deformylase [Zunongwangia profunda SM-A87]
 gi|294982996|gb|ADF53461.1| formyltetrahydrofolate deformylase [Zunongwangia profunda SM-A87]
          Length = 283

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 107/282 (37%), Positives = 168/282 (59%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRIS--FVFNTCMK 58
           M    L I C     I + + ++   +  NI+ I Q+ D +    FMR+   F     + 
Sbjct: 1   MPKVTLLINCKDKSGIIATVTNFFHNRKGNIIYIDQYVDTEKGIFFMRLENEFSTEYDIA 60

Query: 59  LFIADF-QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               +F + I + +++ + +   +   K  + VS+ DHCL D+L R+  G L + I  ++
Sbjct: 61  DLRVEFDEEIAETYNMNWKLFAEERILKMAVFVSKYDHCLYDILGRFKAGELNVEIPFIL 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH     +   + +PFY++P+T+ NK E+E K + +++K  V+ ++LARYMQI+SD L 
Sbjct: 121 SNHKDLASIARAFDIPFYHVPVTKDNKAEAEAKQLELLKKFEVDFIVLARYMQIVSDQLI 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +    IINIHHSFLP+F GA PY  AY+ GVKIIGAT HY   ELDAGPIIEQD+ R++
Sbjct: 181 SEFPNNIINIHHSFLPAFAGAKPYHSAYKRGVKIIGATCHYVTAELDAGPIIEQDITRIS 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+ +I+D I  G+++E  V ++ +  HIQ++  +   KTI+F
Sbjct: 241 HSHSIKDLILKGRDLEKIVFSRGIKLHIQRKTMVFNNKTIIF 282


>gi|226360909|ref|YP_002778687.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
 gi|226239394|dbj|BAH49742.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
          Length = 282

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 110/282 (39%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCM 57
           M+ ++ LT++C     I   +  +L  Q C+I +  QF+D  +   F+R SFV   +  +
Sbjct: 1   MTQTFTLTLSCAQRPGIVHAVSSFLFEQNCDIAEHQQFDDTLSDAFFLRTSFVSAEDVDI 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +    +FQ +  +F + ++  N  +  + +++VS+  HCLNDL++RW  G L   +V VV
Sbjct: 61  ERLTDEFQSVATKFGMTFT-VNGSDLPRVIVMVSKMGHCLNDLIFRWRAGNLGAELVAVV 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   LPF ++P+T   K ++E +L+ ++++ + +L++LARYMQ+LSD  C
Sbjct: 120 SNHEVLRPMAEAAGLPFVHVPVTPATKPQAEARLLELVDEFDADLVVLARYMQVLSDDAC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
             + GR INIHHSFLP FKGA PY QA++ GVK +GATAHY   +LD GPIIEQ+V+R+ 
Sbjct: 180 RALRGRAINIHHSFLPGFKGAKPYHQAFDRGVKQVGATAHYVTPDLDEGPIIEQEVIRID 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H         +G++ EA  L++AV  H + RV ++  +T+VF
Sbjct: 240 HTFDPARLATVGQDAEALALSRAVRWHCENRVLLHGHRTVVF 281


>gi|167761927|ref|ZP_02434054.1| hypothetical protein BACSTE_00270 [Bacteroides stercoris ATCC
           43183]
 gi|167700159|gb|EDS16738.1| hypothetical protein BACSTE_00270 [Bacteroides stercoris ATCC
           43183]
          Length = 285

 Score =  276 bits (706), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 109/284 (38%), Positives = 172/284 (60%), Gaps = 4/284 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
           M +  L + CP    I + + D+++    NI+ + Q+ D   +  FMRI +   +     
Sbjct: 2   MKTAKLLLHCPDQPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELESFLVPQ 61

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +     F+ +  Q++ + + +  +    +  I VS+  HCL DLL R+  G   + I  +
Sbjct: 62  EKIEDYFETLYAQKYGMSFRLYFSDVKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPLI 121

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + E + +PF+  P+T++ K E E+K + ++ K+ V  ++LARYMQ++S+ +
Sbjct: 122 ISNHPDLQHVAERFGIPFHLFPITKETKEEQEKKEMELLAKHKVNFIVLARYMQVISEKM 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 RIINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   ELDAGPIIEQDVVR+
Sbjct: 182 IGAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVRI 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           TH  T++D +  GK++E  VL++AV  HI+++V   K KT++F 
Sbjct: 242 THKDTVQDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN 285


>gi|312141143|ref|YP_004008479.1| formyltetrahydrofolate deformylase puru [Rhodococcus equi 103S]
 gi|325674035|ref|ZP_08153725.1| formyltetrahydrofolate deformylase [Rhodococcus equi ATCC 33707]
 gi|311890482|emb|CBH49800.1| formyltetrahydrofolate deformylase PurU [Rhodococcus equi 103S]
 gi|325555300|gb|EGD24972.1| formyltetrahydrofolate deformylase [Rhodococcus equi ATCC 33707]
          Length = 295

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 100/285 (35%), Positives = 164/285 (57%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             Y+L++ CP    I + I  +L+  G  I++ +   D DT   F R +   ++    ++
Sbjct: 10  RRYVLSLGCPDRTGIVARISAFLAEIGGWIVEAAYHADADTGWFFTRQAVRASSISLSLE 69

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F  + ++     ++++ +T E  + ++LVS+  HCL+D+L R   G L   I  V
Sbjct: 70  EMREKFAAVAEELGPETEWTLTDTGERKRVVLLVSKEGHCLHDILGRVAAGELQCEIAAV 129

Query: 117 VSNHTTHKKLVENYQLPFYY--LPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           + NH   +++ + + + F+Y   P     +  + +++  +++ ++   ++LAR+MQ+L  
Sbjct: 130 IGNHPDLERVTKRHGVDFHYVSFPKDPAERGPAFEQVRKLVDAHDPHAVVLARFMQVLPA 189

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV+
Sbjct: 190 ELCDHWAGRAINIHHSFLPSFVGARPYHQAFTRGVKLIGATCHYVTAELDAGPIIEQDVI 249

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H   + D +  G++IE  VL + +  H++ RV ++ RKT+VF
Sbjct: 250 RVDHTDQVSDMVRQGRDIEKLVLARGLRWHLEDRVQVHGRKTVVF 294


>gi|289705989|ref|ZP_06502363.1| formyltetrahydrofolate deformylase [Micrococcus luteus SK58]
 gi|289557326|gb|EFD50643.1| formyltetrahydrofolate deformylase [Micrococcus luteus SK58]
          Length = 301

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 116/281 (41%), Positives = 170/281 (60%), Gaps = 5/281 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIAD 63
           ++LT+ C + + I   +   L     +I +  Q+   DT   FMR+ FV     +     
Sbjct: 20  HVLTLACTNRKGIVHAVTGALLGVEADITESQQYGSPDTGDFFMRVEFVTPAVREDIEQA 79

Query: 64  FQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTTH 123
             P+ ++F ++  + +     +TL++ S+  H LNDLL++   GTL + I  VVSNH   
Sbjct: 80  LAPVREEFGMRMGLWDAAHRMRTLVMCSKDGHTLNDLLFQQRAGTLPIEIPVVVSNHLDL 139

Query: 124 KKLVENYQLPFYYLPMTEQN-----KIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           + L   Y +PF ++P+++       K  +E +L ++I + ++EL++LARYMQILSD LC 
Sbjct: 140 QPLASFYGVPFIHVPVSKDPSSRDSKEAAEDRLRDLIAQFDIELVVLARYMQILSDELCR 199

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            + G  INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII Q V  VTH
Sbjct: 200 DLAGMAINIHHSFLPSFKGARPYHQAHERGVKLIGATAHYVTADLDEGPIIAQSVQPVTH 259

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           AQT  D++A G+++E   L +AV  H Q RV  + R+T+VF
Sbjct: 260 AQTAADFVARGRDVEGSTLAQAVRWHAQHRVLTDGRRTVVF 300


>gi|254428429|ref|ZP_05042136.1| formyltetrahydrofolate deformylase [Alcanivorax sp. DG881]
 gi|196194598|gb|EDX89557.1| formyltetrahydrofolate deformylase [Alcanivorax sp. DG881]
          Length = 290

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 105/282 (37%), Positives = 169/282 (59%), Gaps = 6/282 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFN-DLDTSKLFMRISF---VFNTCMK 58
           +  L +TCP    I S +  +L   G NI D  Q + D      F+R+ F     +   +
Sbjct: 8   TARLLVTCPDKPGIISAVSTFLYNHGANITDFDQHSSDAHGGTFFLRLEFQTPELDCSRE 67

Query: 59  LFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               +F   + + + +Q+ I    E  +  +LVS+ DH L DLL+R + G L   I  V+
Sbjct: 68  ALRNNFASRVAEPYGMQWQISYASEKKRMAVLVSRHDHVLMDLLWRTSRGDLPATIPMVI 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   +  VE + + ++++P+   NK E+E + +  ++   V++++LARYMQILS +  
Sbjct: 128 SNHDDLRDEVERFGIEYHHIPVNADNKAEAEAETLAKLDG-KVDVVVLARYMQILSSNFV 186

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                R+INIHHSFLP+F GANPY+QA++ GVK+IGAT+HY   +LD GPIIEQ+V RV+
Sbjct: 187 SHYPHRVINIHHSFLPAFVGANPYQQAHDKGVKLIGATSHYVTEDLDQGPIIEQNVQRVS 246

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  +  +  ++G+++E +V+ +AV  H++ RV ++  KT+VF
Sbjct: 247 HRHSAAELRSLGQDVERQVMLRAVRWHLEDRVIVDGNKTVVF 288


>gi|302523805|ref|ZP_07276147.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
 gi|302432700|gb|EFL04516.1| formyltetrahydrofolate deformylase [Streptomyces sp. AA4]
          Length = 290

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 97/285 (34%), Positives = 160/285 (56%), Gaps = 8/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
             Y+LT  CP    I + I  +L+  G  I++ +   D D+   F R     +      +
Sbjct: 5   QRYVLTFGCPDRTGIIARISGFLADHGGMIVEAAYHTDPDSGWFFTRQVVRADSLPFDAE 64

Query: 59  LFIADFQPIVQQFSLQ--YSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F  + ++ S +  + +R+T E  + ++LVS+  HCL DLL R   G L ++I  V
Sbjct: 65  GLRERFGAVARELSAESSWQVRDTGERPRAVVLVSKAGHCLYDLLGRVASGELDVDIAAV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           + NH +   +   + +PF+++P        K  +  ++  +++ ++   ++LAR+MQ+L 
Sbjct: 125 IGNHDSLADITRAHGIPFHHVPFPAGDPDGKAAAFAQVRELVDAHDPHAIVLARFMQVLP 184

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             LC    GR +NIHHSFLPSF GA PY QA+  GVK++GAT HY   +LDAGPIIEQDV
Sbjct: 185 ADLCAAWAGRALNIHHSFLPSFIGAKPYHQAHTRGVKLVGATCHYVTADLDAGPIIEQDV 244

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           +RV H  +++D +  G++IE   L + +  H++ RV ++  +T+V
Sbjct: 245 IRVDHGDSVQDMVRKGRDIEKVTLARGLRWHLEGRVLVHGNRTMV 289


>gi|238027291|ref|YP_002911522.1| putative formyltetrahydrofolate deformylase protein [Burkholderia
           glumae BGR1]
 gi|237876485|gb|ACR28818.1| Putative formyltetrahydrofolate deformylase protein [Burkholderia
           glumae BGR1]
          Length = 333

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 119/297 (40%), Positives = 172/297 (57%), Gaps = 19/297 (6%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT--------------SKLFM 47
             ++L ++CP +  +   +   L   GCNI+D  QF+D D                + FM
Sbjct: 36  REFVLRLSCPDSRGVVYAVSRALYEAGCNIVDAQQFSDFDACATPAGTDGTAAAPGRFFM 95

Query: 48  RISFVFN---TCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRW 104
           R+           +       P+ + + +Q  + +     +  ILVS+  HCLNDL++R 
Sbjct: 96  RVHLEAPGRAAGPEAIARLLDPLRRDYDMQIEVHDAGWRPRAAILVSREGHCLNDLMFRQ 155

Query: 105 NIGTLALNIVGVVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVEL 162
           ++G L + I  VVSNH   +++ E   L F++LP+      K   E +L+ ++E+  VEL
Sbjct: 156 SVGQLPVEIAAVVSNHEDLREMAERSGLAFHHLPLDAAAGGKPAQEARLLGLLERERVEL 215

Query: 163 MILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICE 222
           ++LARYMQILS  LC ++ GR INIHHSFLPSFKGA PY+QA+  GVK+IGATAHY   +
Sbjct: 216 VVLARYMQILSPELCERLRGRAINIHHSFLPSFKGAQPYRQAHARGVKLIGATAHYVTSD 275

Query: 223 LDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           LD GPIIEQDV RV HA    +  AIG++IE  VL +A+  H + RV +N  +T+VF
Sbjct: 276 LDEGPIIEQDVERVDHAAGPRELAAIGRDIECVVLARALKWHCEHRVLMNGARTVVF 332


>gi|320108729|ref|YP_004184319.1| formyltetrahydrofolate deformylase [Terriglobus saanensis SP1PR4]
 gi|319927250|gb|ADV84325.1| formyltetrahydrofolate deformylase [Terriglobus saanensis SP1PR4]
          Length = 285

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 160/282 (56%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLST-QGCNILDISQFNDLDTSKLFMRISFVFNT---CM 57
            + +L + CP  + + + I ++L      NIL+  Q  D +    FMR+ FV       +
Sbjct: 3   KTAVLLVDCPDRKGLVAAIHNFLIEAYDVNILNADQHQDAELGLFFMRVEFVTENEECTV 62

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F PI  ++++ + +          I VSQ  HCL DLLYR   G L  N+  +V
Sbjct: 63  DHFRERFMPIAAKYAMHWRMDFEDTQQNVAIFVSQYLHCLADLLYRHQTGELQCNLTMIV 122

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L E Y++PF+Y P+T   K + EQ+ + ++ +  V+L+ILARYMQI+S    
Sbjct: 123 SNHEDARPLAEFYKIPFHYTPVTAATKQQVEQRQLALLAEAKVDLVILARYMQIVSPQFV 182

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
                RIIN+HHSFLP+F GA PY  A+  GVK+IGA++HY   ELD GPIIEQDV R++
Sbjct: 183 DAYPQRIINVHHSFLPAFTGARPYHAAFARGVKLIGASSHYVTAELDEGPIIEQDVTRIS 242

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +   I  G+++E  VL++AV  H+  R+     KT++F
Sbjct: 243 QNDALPSLIQKGRDLERLVLSRAVQWHLGHRILSYANKTVIF 284


>gi|239994687|ref|ZP_04715211.1| formyltetrahydrofolate deformylase [Alteromonas macleodii ATCC
           27126]
          Length = 284

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 100/281 (35%), Positives = 167/281 (59%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            ++ L I CP    + + +  +L+     I++ S   DL T + FMR     ++     +
Sbjct: 3   QTFRLVIDCPDQIGLVASVSQFLADHNATIVEASHHTDLQTGRFFMRHEISTDSLKLDHQ 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+ +F P+  ++ + + + ++ +  +  +L S   HCL DLL+RW+ G L  +I  ++ 
Sbjct: 63  SFVKEFTPLANEYQMNWKLSDSSKKQRVALLASLESHCLVDLLHRWHTGELHCDIPVIIG 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + Y++PF+++      K  +  ++  ++++  ++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWYKVPFHWVDFKALGKEAAFAQITTLLQEYKIDLTVLARFMQILPDTLCQ 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R++H
Sbjct: 183 ELQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAADMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|134101035|ref|YP_001106696.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291009540|ref|ZP_06567513.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133913658|emb|CAM03771.1| formyltetrahydrofolate deformylase [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 282

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 118/280 (42%), Positives = 176/280 (62%), Gaps = 3/280 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKL 59
            S+ILT++CP+   I   +  YL   GC+I +  QF+D    +LF+R          +  
Sbjct: 3   RSFILTLSCPNRTGIVRAVSAYLFEHGCDIGEYQQFDDSVRDRLFLRTQVNAGREIDLDA 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F+PI   F + ++  +T    + L++VS+  HCLNDL++RW  G+L  +IV VVSN
Sbjct: 63  MARGFEPIAADFEMTFTFSDT-RNARMLVMVSKLGHCLNDLIFRWRAGSLGADIVAVVSN 121

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   LPF ++P+T + K E+E +L+ ++++ + EL++LARYMQ+LSD  C  
Sbjct: 122 HEDLRPMAEGAGLPFIHVPVTPETKPEAEARLLQLVDEYDAELVVLARYMQVLSDQACKA 181

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QAY+ GVK++GATAHY   +LD GPIIEQ+V+R+ H 
Sbjct: 182 LHGRAINIHHSFLPGFKGAKPYHQAYDRGVKLVGATAHYVTPDLDEGPIIEQEVIRIDHT 241

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
                   +G++ EA  L++AV  H ++RV +N   T+VF
Sbjct: 242 YHPTALQTVGRDAEALALSRAVRWHCERRVLLNGHSTVVF 281


>gi|71278117|ref|YP_270288.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
 gi|71143857|gb|AAZ24330.1| formyltetrahydrofolate deformylase [Colwellia psychrerythraea 34H]
          Length = 292

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 114/282 (40%), Positives = 179/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
            ++++T +CPS      ++  +L  QG  I +I  F+D D  + F+RI F  +T      
Sbjct: 9   QTHVITASCPSQPGTVDVVTRFLFEQGFYINEIHSFDDTDQDRFFIRIEFRADTATNFNR 68

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F     +F +++ + ++   +K +I+VS+ DHCLNDLLYR+  G L + I  ++
Sbjct: 69  DDFCQQFGERASEFEMKWELASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLNIEIPAII 128

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L + + +P+Y+LP+T++ K E E K+  II+ +  +L++LARYMQ+LS  +C
Sbjct: 129 SNHPDLEDLAKWHDIPYYHLPITKETKPEQEAKVFQIIQDSEADLVVLARYMQVLSSDMC 188

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K++G+ INIHHS LP FKGA PY QAY+ G+K++GATAHY   +LD GPII Q V  V 
Sbjct: 189 KKLSGKAINIHHSLLPGFKGARPYYQAYDRGIKLVGATAHYVSDDLDEGPIISQGVETVD 248

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   +D  A G++IE   L +AV  HI+ R+F++ +K++VF
Sbjct: 249 HSYYPQDLAAKGRDIECLTLARAVRCHIEHRIFLHGKKSVVF 290


>gi|227819894|ref|YP_002823865.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|36958741|gb|AAQ87209.1| Formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
 gi|227338893|gb|ACP23112.1| formyltetrahydrofolate deformylase [Sinorhizobium fredii NGR234]
          Length = 283

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 181/280 (64%), Gaps = 2/280 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMKL 59
           S++ LT++C     I + +   L+  G NI + +QF D  +++LFMRI+F          
Sbjct: 3   SNFTLTLSCEDRPGIVAAVTTELAACGANIAESNQFWDRQSNRLFMRIAFTAPEKISRDD 62

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                +P+  +F ++  + ++    K +I+VS+ DH +  LLY+  +G L   +  +VSN
Sbjct: 63  VERSLKPVTDRFDMKTKLVDSDRKPKIIIMVSKFDHAMLHLLYQIRVGWLNAEVAAIVSN 122

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H       +   +P+Y+  +T++NK E E++LI ++     +LMILARYMQ+LSD+L  +
Sbjct: 123 HEDSAATAKLEGIPYYHWKVTKENKAEQEERLIELVRDTGADLMILARYMQVLSDNLSTR 182

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + G++INIHHSFLPSFKGA PY QA++ GVK+IGAT+HY   +LD GPIIEQ+  RVTHA
Sbjct: 183 LFGKVINIHHSFLPSFKGAKPYHQAFDRGVKLIGATSHYVTPDLDEGPIIEQETERVTHA 242

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +D++A G++IE++VL +AV  H++ RV +N  KTIVF
Sbjct: 243 MTADDFVATGRDIESRVLARAVKMHLECRVMLNGHKTIVF 282


>gi|283852727|ref|ZP_06369992.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. FW1012B]
 gi|283571905|gb|EFC19900.1| formyltetrahydrofolate deformylase [Desulfovibrio sp. FW1012B]
          Length = 285

 Score =  276 bits (705), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 115/283 (40%), Positives = 168/283 (59%), Gaps = 6/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVF---NTCM 57
           ++  L ITCP    I S +  +L T G NI+D+ Q   D +    F+R+ F     +   
Sbjct: 3   ATARLCITCPDRPGIVSAVTTFLYTHGANIIDLDQHSTDPEGGTFFLRLEFYTPYMDVSR 62

Query: 58  KLFIADFQPI-VQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               A F  +   +FS+ + +  + E  +  + VS+ DHCL +LL+R+    L  +I  V
Sbjct: 63  SALEAAFGEVVGGRFSMDWRLSYSDEPKRAALFVSRHDHCLMELLWRFARKELPCDIAMV 122

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   +  VE + +PF+ +P+ +    E+E K+  ++  N  +L++LARYM+ILS   
Sbjct: 123 VSNHEDLRASVEGFGVPFHAVPVGDGGMAEAEAKMAELLGDNT-DLIVLARYMRILSGDF 181

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 R+INIHHSFLP+F GA+PY+QA+E GVK+IGATAHY   ELDAGPIIEQD  RV
Sbjct: 182 LRPYEHRVINIHHSFLPAFVGADPYRQAHEKGVKLIGATAHYVTAELDAGPIIEQDTARV 241

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH  ++ D  A G ++E  VL +AV  H++ RV +   KT+VF
Sbjct: 242 THRFSVADLKATGSDLERNVLARAVKWHLEDRVIVFGNKTVVF 284


>gi|33593497|ref|NP_881141.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33598018|ref|NP_885661.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis 12822]
 gi|33572853|emb|CAE42786.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           Tohama I]
 gi|33574447|emb|CAE38785.1| putative formyltetrahydrofolate deformylase [Bordetella
           parapertussis]
 gi|332382905|gb|AEE67752.1| putative formyltetrahydrofolate deformylase [Bordetella pertussis
           CS]
          Length = 282

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 118/281 (41%), Positives = 175/281 (62%), Gaps = 2/281 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT--CMK 58
           M  Y+L + C     I   I   L  +GCNI + +QF++  T+  +MR+ F      C++
Sbjct: 1   MKQYVLLLKCLDRPGIVHEISGGLFQEGCNIEESAQFSESGTAVFYMRVRFSAPDRACVQ 60

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                 + +        +I +  + ++ LILVS+  HCLNDLL+R   G L +++ GVVS
Sbjct: 61  KIATALKRLYNGDEAGLAIHDMDKRSRVLILVSKHGHCLNDLLFRQRSGLLNMDVAGVVS 120

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   ++L  +Y +PF++ P+T Q + E E ++++++     +L++LARYMQILSD   +
Sbjct: 121 NHPDFRELAASYDIPFHHFPVTPQTRAEQEGRILDLVASTQSDLVVLARYMQILSDRASN 180

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
            ++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   ELD GPIIEQDV RV+H
Sbjct: 181 ALSGRAINIHHSFLPGFKGARPYYQAYDRGVKLIGATAHYVTSELDEGPIIEQDVARVSH 240

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   +    +G+++E   L +AV  H + R+ +N RKTIVF
Sbjct: 241 SLEPQALTDVGRDVECMTLARAVKWHTEHRIILNGRKTIVF 281


>gi|256380748|ref|YP_003104408.1| formyltetrahydrofolate deformylase [Actinosynnema mirum DSM 43827]
 gi|255925051|gb|ACU40562.1| formyltetrahydrofolate deformylase [Actinosynnema mirum DSM 43827]
          Length = 291

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 94/286 (32%), Positives = 158/286 (55%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMK 58
             Y++T  CP    I + I  +L+  G  I++ +   D  T+  F R     +     ++
Sbjct: 6   RRYVITFGCPDRTGIVARISSFLAEHGGLIVEAAYHTDQATNWFFTRQEVRADSLPFGVE 65

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F  I ++      + + +T E  + +ILVS+  HCL DLL R     L +++  V
Sbjct: 66  ELRERFTAIARELGAQANWRVTDTGERRRVVILVSKEGHCLYDLLGRVASRELDVDVAAV 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPM---TEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
           + NH     +   + +PF+++P      + K  +  ++  +++ ++   ++LAR+MQ+L 
Sbjct: 126 IGNHPDLANITRAHGIPFHHVPFPATDPEGKTAAFAQVKQLVDAHDPHAVVLARFMQVLP 185

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             LC   +GR +NIHHSFLPSF GA PY QA   GVK++GAT HY   +LDAGPI+EQDV
Sbjct: 186 PELCAAWSGRALNIHHSFLPSFVGARPYHQARARGVKLVGATCHYVTADLDAGPIVEQDV 245

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +RV H  ++ D +  G++IE  VL + +  H++ RV ++  +T++F
Sbjct: 246 IRVNHTDSVADMVRKGRDIEKVVLARGLRWHLEDRVLVHGGQTVIF 291


>gi|330809036|ref|YP_004353498.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327377144|gb|AEA68494.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 288

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 182/281 (64%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK---- 58
            YIL ITCP+   I + I   L+ Q C I +++QF+D  T + FMR  F FNT +     
Sbjct: 7   HYILKITCPAASGIIAAISACLARQQCYISELAQFDDEFTGQFFMRAVFRFNTGVDGDIG 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   +   F +Q+ + ++++ T+ L++VS+ DHCL DLLYR   G + ++I  VVS
Sbjct: 67  TLREGLGDLAGGFDMQWQLFSSRQPTRVLLMVSKFDHCLTDLLYRHRKGEMDMHITAVVS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F YLP+T+ +K   E +L+ I+E    +L++LARYMQILSD LC 
Sbjct: 127 NHLDLRAMAEREGIRFIYLPITKDSKASQEAELMRIVEDTQTDLVVLARYMQILSDELCQ 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ++ RV H
Sbjct: 187 QLSGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTSDLDEGPIIEQEIQRVDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +  +AIG++ E   L+KA+  H++ RVFIN+ KT++F
Sbjct: 247 THLPDSLVAIGRDTETVALSKALKYHLEHRVFINQDKTVIF 287


>gi|71733652|ref|YP_275141.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257486081|ref|ZP_05640122.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|71554205|gb|AAZ33416.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323632|gb|EFW79716.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320328271|gb|EFW84275.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330878650|gb|EGH12799.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330989331|gb|EGH87434.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 288

 Score =  275 bits (704), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 182/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKTGFDVVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 KQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|260072618|gb|ACX30517.1| formyltetrahydrofolate hydrolase [uncultured SUP05 cluster
           bacterium]
          Length = 283

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 106/282 (37%), Positives = 156/282 (55%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M+ Y L I+CP    + + +  ++     NI +     D +  + FMRI       N  +
Sbjct: 1   MNVYRLLISCPDAHGLVAKVSQFIFEYDGNIKEAHHHLDDENKRFFMRIEIESSSLNCSL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F  +  ++ + + + +  +  + LI+ S+  HC+ DLL+R +   L   IVGV+
Sbjct: 61  DKFRRAFVSVADKYKMDWRMSDASQLKRILIMGSKSSHCVADLLHRHHEKELEGEIVGVL 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    KL   Y + F  + + +  K      +   +   N ++++LARYMQI+   LC
Sbjct: 121 SNHDKLSKLASWYDVHFKQVSINDSTKTADIASMTQAVSTFNPDVIVLARYMQIIPGDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K +G+IINIHHSFLPSF GANPY +A E GVK+IGAT HY    LD GPIIEQDVVRV 
Sbjct: 181 DKYSGKIINIHHSFLPSFVGANPYARAAERGVKLIGATCHYVTANLDEGPIIEQDVVRVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + +D   +G++IE   L K +  H++ RV     KT+VF
Sbjct: 241 HADSADDMKKMGQDIEKITLAKGLQYHLEDRVLTCNNKTVVF 282


>gi|298487427|ref|ZP_07005473.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298158046|gb|EFH99120.1| Formyltetrahydrofolate deformylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 288

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 121/282 (42%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +   L+  GC I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVASCLAGNGCYIGEMAQFDDEYSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKTGFDVVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP++++ K   E  L+ ++++   EL++LARYMQILSD L 
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKETKAAQEAALMKVVDETGTELVVLARYMQILSDDLY 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 KQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    ED +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HFYLPEDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|56477395|ref|YP_158984.1| formyltetrahydrofolate deformylase [Aromatoleum aromaticum EbN1]
 gi|56313438|emb|CAI08083.1| Formyltetrahydrofolate deformylase [Aromatoleum aromaticum EbN1]
          Length = 291

 Score =  275 bits (703), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 111/286 (38%), Positives = 171/286 (59%), Gaps = 8/286 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDT-----SKLFMRISF---VF 53
             + L+ +CP    I + +  +++     IL+ S   +         + FMRI       
Sbjct: 5   RHFTLSASCPDRVGIVARVSSFIAEHRGWILETSLHAEPPAEGEALGRYFMRIEIRTSSL 64

Query: 54  NTCMKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNI 113
              +  F   F+P+  +  ++++I ++    + ++LVS+ +HCL DLL RW    L + I
Sbjct: 65  PFHLAEFRERFRPLADELEMEWTITDSAVKKRVVVLVSKQEHCLYDLLARWQSKELDIEI 124

Query: 114 VGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS 173
             V+SNH T + LVE + +PF+++P+   NK ++  ++  I E+   E M+LARYMQ+LS
Sbjct: 125 PCVISNHDTFRGLVEWHGIPFHHVPVNADNKAQAYAEVARIFEEVRGETMVLARYMQVLS 184

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
             LC    GRIINIHHSFLPSF GA PY QA+  GVK+IGAT HY   +LD GPII+QDV
Sbjct: 185 PQLCAAYAGRIINIHHSFLPSFVGAKPYHQAWAKGVKLIGATCHYVTADLDQGPIIDQDV 244

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +R+ H+ ++ED +  GK+IE  VL + +  H++ RV +++ KTIVF
Sbjct: 245 IRIDHSDSVEDMVRYGKDIEKMVLARGLRYHLEGRVLVHRNKTIVF 290


>gi|308178492|ref|YP_003917898.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
 gi|307745955|emb|CBT76927.1| formyltetrahydrofolate deformylase [Arthrobacter arilaitensis
           Re117]
          Length = 286

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 115/279 (41%), Positives = 176/279 (63%), Gaps = 3/279 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTC---MKL 59
            ++LT+ CP    I + +  +L      I+++ QF+D+   +LF+R+ F        +  
Sbjct: 6   RHVLTLQCPEGMGIVNAVTGFLVKHERTIVELKQFDDVSAGRLFLRVEFSGEAEENLLAE 65

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
              +F  I  +F + + +R   + T+ LI+VS+ DHCLNDLL+R   G L + IV V SN
Sbjct: 66  LREEFTAIAAKFEMDWQLRERGQKTRVLIMVSKYDHCLNDLLFRSRTGELPIEIVAVASN 125

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + LV+ + + ++++P++++ K ++E KL+ +I +   EL++LARYMQ+LSDHL  +
Sbjct: 126 HEDSRDLVQWHGIEYHHIPISKETKPQAEAKLLELISQTGAELVVLARYMQVLSDHLATE 185

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAHY   ELD GPII Q VV V H 
Sbjct: 186 LTGKTINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHYVNSELDEGPIIAQQVVEVDHT 245

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
               + IA G++ E + L+ AV  H + RVF+   +T++
Sbjct: 246 FGPSELIAAGRDSECRALSNAVRWHCEGRVFLYGNRTVI 284


>gi|325124426|gb|ADY83949.1| formyltetrahydrofolate deformylase [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 296

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 16  NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 75

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 76  DALIQTFAANVAERYGMQWRLAFVNEIKKVGILVSKVDHALLELLWRHARGSLPCEITHV 135

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 136 ISNHEDLRESVENFGIPFTVIKVTKDNKAEAYAQIDE--MMQGNDLLVLARYMQILSEDF 193

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 194 VAKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 253

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 254 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 296


>gi|260549125|ref|ZP_05823346.1| formyltetrahydrofolate deformylase [Acinetobacter sp. RUH2624]
 gi|260407853|gb|EEX01325.1| formyltetrahydrofolate deformylase [Acinetobacter sp. RUH2624]
          Length = 296

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 16  NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 75

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 76  DALIQTFAANVAERYGMQWRLAFVNDVKKVGILVSKVDHALLELLWRHARGSLPCEITHV 135

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 136 ISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQIHE--MMQGNDLLVLARYMQILSEDF 193

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 194 VSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 253

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 254 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 296


>gi|109896815|ref|YP_660070.1| formyltetrahydrofolate deformylase [Pseudoalteromonas atlantica
           T6c]
 gi|109699096|gb|ABG39016.1| formyltetrahydrofolate deformylase [Pseudoalteromonas atlantica
           T6c]
          Length = 284

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 102/281 (36%), Positives = 167/281 (59%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            +  L I CP    + + +  +L+     I++ S   DL T + FMR     ++    ++
Sbjct: 3   QTLRLVIDCPDQVGLVASVSQFLAQHNATIVEASHHTDLQTGRFFMRHEISTDSLTMDIE 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI +++S+ + + ++ +  +  +L S   HCL DLL+RW+   L   I  +++
Sbjct: 63  QIRLGFAPIAEKYSMNWKLVDSSKKPRMALLASHESHCLMDLLHRWHSKELNCEIPCIIA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + + +PF+++      K  +  ++  +I++ +++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWHSIPFHWIDFKSLGKEAAFAQISQLIKQYDIDLTVLARFMQILPDALCK 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ+V+R++H
Sbjct: 183 ELAGRAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTSDLDEGPIIEQEVMRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + + +D +  GKN E   L   V  H++ RV I+  KT+VF
Sbjct: 243 SDSAQDMVRKGKNCEKTALANGVRYHLEDRVIIHHSKTVVF 283


>gi|289673367|ref|ZP_06494257.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae FF5]
 gi|330942954|gb|EGH45439.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 288

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 179/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--- 58
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN   +   
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDI 65

Query: 59  -LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKAGFDAVANDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+T + K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVTRETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 QQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H     D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 246 HVYLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|169797297|ref|YP_001715090.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AYE]
 gi|260556185|ref|ZP_05828404.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii ATCC
           19606]
 gi|169150224|emb|CAM88120.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AYE]
 gi|260410240|gb|EEX03539.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii ATCC
           19606]
 gi|322506673|gb|ADX02127.1| formyltetrahydrofolate hydrolase [Acinetobacter baumannii 1656-2]
 gi|323516548|gb|ADX90929.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 296

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 16  NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 75

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 76  DALIQTFAANVAERYGMQWRLAFVNDIKKVGILVSKVDHALLELLWRHARGSLPCEITHV 135

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 136 ISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQIHE--MMQGNDLLVLARYMQILSEDF 193

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 194 VSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 253

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 254 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 296


>gi|225164205|ref|ZP_03726480.1| formyltetrahydrofolate deformylase [Opitutaceae bacterium TAV2]
 gi|224801179|gb|EEG19500.1| formyltetrahydrofolate deformylase [Opitutaceae bacterium TAV2]
          Length = 290

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 100/285 (35%), Positives = 153/285 (53%), Gaps = 6/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF----NTCM 57
           SS +  +  P    + + +  ++  +G NIL   Q  D +    F R+ +V         
Sbjct: 6   SSLVALLHGPDQPGLVARVSGWIFEKGGNILHADQHQDREAGVFFQRVEWVPLAADGREA 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F    +   +   +    + ++  + VS+ DHC +D+  RW  G    + V V+
Sbjct: 66  EAERLAFAEFARGLGMNVQVVCRAQRSRVAMFVSKFDHCFHDIALRWRAGEFDCDFVAVI 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL- 176
           SNH       E Y LP+Y++P++   K E+E + + ++ +   +L+I+ARYMQ+LS    
Sbjct: 126 SNHPDLAAAAEGYGLPYYHIPVSAATKAEAEARQVALLRELRADLVIMARYMQVLSADFL 185

Query: 177 -CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
             +     +INIHHSFLP+F G  PY QA+  GVK+IGATAHYA   LD GPII QDV R
Sbjct: 186 GPNGFGRPVINIHHSFLPAFAGGKPYHQAHARGVKLIGATAHYATAVLDDGPIIHQDVTR 245

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           VTH   ++D I +G+++E  VL +AV  H+ QRV     KT+VF 
Sbjct: 246 VTHRHGVDDLIRMGRDLERLVLARAVRLHLNQRVLAYGNKTVVFD 290


>gi|196228878|ref|ZP_03127744.1| formyltetrahydrofolate deformylase [Chthoniobacter flavus Ellin428]
 gi|196227159|gb|EDY21663.1| formyltetrahydrofolate deformylase [Chthoniobacter flavus Ellin428]
          Length = 283

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 104/282 (36%), Positives = 172/282 (60%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           MS+  L ++CP    + ++I ++++  G N++++ Q+ D      F R+          +
Sbjct: 1   MSTL-LRLSCPDRVGLLALISNFIAQHGGNLIEVHQYTDAAAGWFFTRMEIDTRTLKVDL 59

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                +F P+  +   +++IR  +   K +++VS+  HCL DLL+RW+ G L + I  V+
Sbjct: 60  PKLREEFTPVATELGAEWTIRTAEAKRKVIVMVSKFGHCLADLLWRWHSGELDIEIAAVI 119

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + +VE   L F ++P+   +K  +  K+  I      +L++LARYMQIL   +C
Sbjct: 120 SNHEDFRPMVEREGLEFCHVPVDPHDKPAAFAKIAEIFRFVQPDLIVLARYMQILPAEVC 179

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            + +GR++NIHHSFLPSF GANPY++A++ GVK+IGAT HY   ELDAGPI++Q+V+RV 
Sbjct: 180 AEFSGRVLNIHHSFLPSFVGANPYQRAWQRGVKLIGATCHYVTSELDAGPIVDQEVIRVE 239

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H  T ED + +G++ E   L ++V  H+  RV ++ ++ IVF
Sbjct: 240 HFHTPEDLMRLGRDCERLALARSVRWHLDDRVLLHGQRAIVF 281


>gi|332290780|ref|YP_004429389.1| formyltetrahydrofolate deformylase [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332168866|gb|AEE18121.1| formyltetrahydrofolate deformylase [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 284

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 172/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M+   L I C   + I + + +++   G N   I Q  D   +  FMR+   F   +  +
Sbjct: 1   MAHLTLLIHCKDQKGIIASVTNFILDHGGNTTYIDQHVDAQENVFFMRLECFFEQADFNV 60

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           +LF   F   I   F +Q+ +    +  +  I VS+ DHCL D+L R+N G L ++I  +
Sbjct: 61  ELFTKTFAQDIGNPFEMQWQLYPATQKLQMAIFVSKYDHCLYDILGRYNAGELQVHIPFI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH     +  N+ +PFY++P+T+  K  +EQ+ ++++ +  V+ ++LARYMQI++  +
Sbjct: 121 VSNHKDLAHIAANFGIPFYHIPVTKDTKALAEQRQLDLLREFKVDFIVLARYMQIVTPTI 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             + T RIINIHHSFLP+F GA PY  A+  GVKIIG T+HY   ELDAGPIIEQD +RV
Sbjct: 181 ISEYTHRIINIHHSFLPAFVGAKPYHAAFARGVKIIGTTSHYVTEELDAGPIIEQDTIRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           TH+ TI D IA GK++E  VL++A+  H Q + F+   KT++F
Sbjct: 241 THSHTIPDLIAKGKDLEKIVLSRAIKLHAQHKCFVYDNKTVIF 283


>gi|330876862|gb|EGH11011.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 288

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +V
Sbjct: 66  QQLKAGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 RQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|293610247|ref|ZP_06692548.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827479|gb|EFF85843.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 296

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 166/283 (58%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 16  NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 75

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    E  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 76  DALIQTFAANVAERYGMQWRLAFVNEIKKVGILVSKVDHALLELLWRHARGSLPCEITHV 135

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + + + NK E+  ++         +L++LARYMQILS+  
Sbjct: 136 ISNHEDLRESVENFGIPFTVIKVNKDNKAEAYAQIDE--MMQGNDLLVLARYMQILSEDF 193

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 194 VAKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 253

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 254 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 296


>gi|239500816|ref|ZP_04660126.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB900]
 gi|301596905|ref|ZP_07241913.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB059]
          Length = 285

 Score =  274 bits (702), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 5   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 64

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 65  DALIQTFAANVAERYGMQWRLAFVNDIKKVGILVSKVDHALLELLWRHARGSLPCEITHV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 125 ISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQIHE--MMQGNDLLVLARYMQILSEDF 182

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 183 VSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 242

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 243 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 285


>gi|294146545|ref|YP_003559211.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
 gi|292676962|dbj|BAI98479.1| formyltetrahydrofolate deformylase [Sphingobium japonicum UT26S]
          Length = 285

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 122/279 (43%), Positives = 171/279 (61%), Gaps = 3/279 (1%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK-LFIA 62
           +IL ++CP    I + +   L + G NI D  QFND +T+K FMR+   F       F  
Sbjct: 5   HILKLSCPDRPGIVAAVSAALFSAGANITDAQQFNDPETNKFFMRVVARFPDDRTVAFEN 64

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +   F +Q+S+R   +  + + LVS+ DHCL  LLY   IG + +++V ++SNH  
Sbjct: 65  MFIDVAAGFGMQWSLRPAAQRRRVVALVSKFDHCLGHLLYGSRIGEIDMDVVAIISNHPK 124

Query: 123 HKKLVENY--QLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
               + ++   +P+++ P+   N+   E ++   I  +  EL++LARYMQILSD L   +
Sbjct: 125 EALTIRSWLEDIPYHHFPVARDNRAAQEARIKETIVASGAELVVLARYMQILSDDLAAFL 184

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR INIHHSFLP FKGA PY QA+  GVK+IGATAHY   +LD GPII QDV  V+HA 
Sbjct: 185 AGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHYVTADLDEGPIIHQDVEMVSHAD 244

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T E  +  G+NIE +VL++AV  H+Q RVFIN  KT+VF
Sbjct: 245 TPEALVGKGRNIEQRVLSRAVQYHVQDRVFINANKTVVF 283


>gi|226361181|ref|YP_002778959.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
 gi|226239666|dbj|BAH50014.1| formyltetrahydrofolate deformylase [Rhodococcus opacus B4]
          Length = 294

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 99/284 (34%), Positives = 166/284 (58%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKL 59
            Y+L++ CP    I + I  +L+  G  I++ +   D DT   F R +      +  ++ 
Sbjct: 10  RYVLSLGCPDRTGIVARISTFLADVGGWIVEAAYHADADTGWFFTRQAVRASSVDMSIEE 69

Query: 60  FIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               F  +  +     ++++ ++ +  + ++LVS+  HCL+DLL R   G L  +I  V+
Sbjct: 70  LRERFAAVAAELGPETEWTVADSGQRKRVVLLVSKEAHCLHDLLGRAAGGELPADICAVI 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSDH 175
            NH   + +   + + F+++P  +    +  + +++  +++ ++ + ++LAR+MQ+L   
Sbjct: 130 GNHRDLENVTRQHGIDFHHVPFAKDPADRGPAFEQVRKLVDAHDPDAVVLARFMQVLPSE 189

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV+R
Sbjct: 190 LCEHWAGRAINIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTAELDAGPIIEQDVIR 249

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V HA  + D +  G++IE  VL++ +  H++ RV ++ RKT+VF
Sbjct: 250 VDHADEVADMVRQGRDIEKLVLSRGLRWHLEDRVLVHGRKTVVF 293


>gi|66045466|ref|YP_235307.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63256173|gb|AAY37269.1| Formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           syringae B728a]
 gi|330974423|gb|EGH74489.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 288

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 179/282 (63%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK--- 58
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN   +   
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEYSGTFFMRAVFRFNDGHEGDI 65

Query: 59  -LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               A F  +   F++Q+ + +T+   + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQLKAGFDAVASDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+T + K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVTRETKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 QQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H     D +A G+N E   L++AV  H++ RVF+N  +T+VF
Sbjct: 246 HVYLPADLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVVF 287


>gi|332994739|gb|AEF04794.1| formyltetrahydrofolate deformylase [Alteromonas sp. SN2]
          Length = 284

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 102/281 (36%), Positives = 169/281 (60%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            ++ L I CP    + + +  +L++ G  I++ +   DL T + FMR     ++      
Sbjct: 3   QTFRLVIDCPDQIGLVASVSQFLASHGATIVEANHHTDLQTGRFFMRHEIGADSIGLDYD 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F+A+F P+  +F + + + ++ +  +  +L S   HC+ DLL+RW+ G L  +I  ++ 
Sbjct: 63  SFLAEFAPLANEFQMNWKLSDSSKKQRVALLGSVESHCMVDLLHRWHTGELDCDIPCIIG 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + Y++PF+++      K  +  ++  ++E+  ++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWYKVPFHWVDFKALGKEAAFAQISTLLEEYKIDLTVLARFMQILPDTLCQ 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ G+ INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ V R++H
Sbjct: 183 QLQGKAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTKDLDEGPIIEQSVKRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +  D +  GK+ E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAVDMVRKGKDCEVTALAHGVRYHLEDRVIIHRNKTVVF 283


>gi|159044655|ref|YP_001533449.1| formyltetrahydrofolate deformylase [Dinoroseobacter shibae DFL 12]
 gi|157912415|gb|ABV93848.1| formyltetrahydrofolate deformylase [Dinoroseobacter shibae DFL 12]
          Length = 301

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 110/279 (39%), Positives = 184/279 (65%), Gaps = 2/279 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
            ++L ++C +   I + +   L+ QG N+++ +QF D  + + F+R++F+      +   
Sbjct: 22  HFVLNLSCAAEPGIVAAVTTALAGQGANLVETAQFWDRQSDRFFLRVAFLGQPGTDVAGI 81

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
            A   P   +F +  ++ ++    + LI+VS+ DH L  LLY+  +G L+  +V +VSNH
Sbjct: 82  EAALAPTRARFGMDVTVLDSARKPRILIMVSRFDHALLHLLYQVRVGWLSAEVVAIVSNH 141

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              +++ E+  +PF+++P++   K E+E +L  ++ +   +L++LARYMQ+LSD     +
Sbjct: 142 PDARRVAEHEGVPFHHIPVSRDTKPEAEARLKALVAETGADLVVLARYMQVLSDDFSRVL 201

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  R+TH+ 
Sbjct: 202 AGRVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQEAERITHSM 261

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T +D +A+G++IE++VL +AV  H++ RV +N ++T+VF
Sbjct: 262 TPDDLVAVGRDIESRVLARAVKRHLEGRVMLNGQRTVVF 300


>gi|299771666|ref|YP_003733692.1| formyltetrahydrofolate deformylase [Acinetobacter sp. DR1]
 gi|298701754|gb|ADI92319.1| formyltetrahydrofolate deformylase [Acinetobacter sp. DR1]
          Length = 287

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 67  DALIQTFAANVAERYEMQWRLAFVNDVKKVGILVSKVDHALLELLWRHARGSLPCEITHV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 127 ISNHEDLRESVENFGIPFTVIKVTKDNKAEAYAQIDE--MMQGNDLLVLARYMQILSEDF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VAKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|184156781|ref|YP_001845120.1| formyltetrahydrofolate hydrolase [Acinetobacter baumannii ACICU]
 gi|213155893|ref|YP_002317938.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB0057]
 gi|215484734|ref|YP_002326969.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           AB307-0294]
 gi|301346582|ref|ZP_07227323.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB056]
 gi|301511043|ref|ZP_07236280.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB058]
 gi|332853004|ref|ZP_08434514.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6013150]
 gi|332866454|ref|ZP_08437023.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6013113]
 gi|332873193|ref|ZP_08441150.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6014059]
 gi|183208375|gb|ACC55773.1| Formyltetrahydrofolate hydrolase [Acinetobacter baumannii ACICU]
 gi|193076267|gb|ABO10906.2| formyltetrahydrofolate deformylase [Acinetobacter baumannii ATCC
           17978]
 gi|213055053|gb|ACJ39955.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii AB0057]
 gi|213988107|gb|ACJ58406.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           AB307-0294]
 gi|332728940|gb|EGJ60295.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6013150]
 gi|332734611|gb|EGJ65718.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6013113]
 gi|332738705|gb|EGJ69575.1| formyltetrahydrofolate deformylase [Acinetobacter baumannii
           6014059]
          Length = 287

 Score =  274 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 113/283 (39%), Positives = 167/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++ +Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 67  DALIQTFAANVAERYGMQWRLAFVNDIKKVGILVSKVDHALLELLWRHARGSLPCEITHV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK E+  ++         +L++LARYMQILS+  
Sbjct: 127 ISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQIHE--MMQGNDLLVLARYMQILSEDF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|28869649|ref|NP_792268.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971222|ref|ZP_03399339.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
 gi|301383929|ref|ZP_07232347.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302061526|ref|ZP_07253067.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           K40]
 gi|302131040|ref|ZP_07257030.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28852891|gb|AAO55963.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923975|gb|EEB57553.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv. tomato
           T1]
          Length = 288

 Score =  274 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +V
Sbjct: 66  QQLKAGFDAVAKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRAMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 RQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|70733009|ref|YP_262782.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
 gi|68347308|gb|AAY94914.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens Pf-5]
          Length = 285

 Score =  274 bits (701), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 118/278 (42%), Positives = 169/278 (60%), Gaps = 2/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKL--F 60
           ++ILT  CPS       +  +L  QGC + +   F+D  + + F+R+ F     +    F
Sbjct: 7   TWILTADCPSVLGTVDAVTRFLFEQGCYVTEHHSFDDRLSGRFFIRVEFRQPDGLNEQGF 66

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
                   + F + + +       K +I+VS+ DHCLNDLLYR  IG L +++V VVSNH
Sbjct: 67  REGLAQRAKAFEMNFELTAPHYRPKVVIMVSKADHCLNDLLYRQRIGQLPMDVVAVVSNH 126

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K L + +Q+P+++ P+   +K   E+++  +IE +  EL+ILARYMQ+LS  LC K+
Sbjct: 127 PDLKPLADWHQIPYHHFPLDPNDKPSQERQVWQVIEDSGAELVILARYMQVLSPELCRKL 186

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
            G+ INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V H+ 
Sbjct: 187 DGKAINIHHSLLPGFKGAKPYHQAYNKGVKLVGATAHYINNDLDEGPIIAQGVEVVDHSY 246

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
             ED IA G++IE   L +AV  HI++RVF+N  +T+V
Sbjct: 247 YPEDLIAKGRDIEGLTLARAVGYHIERRVFLNGNRTVV 284


>gi|255321188|ref|ZP_05362354.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SK82]
 gi|262380126|ref|ZP_06073281.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SH164]
 gi|255301742|gb|EET80993.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SK82]
 gi|262298320|gb|EEY86234.1| formyltetrahydrofolate deformylase [Acinetobacter radioresistens
           SH164]
          Length = 288

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 168/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F         
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELEHLQTRK 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               Q     + Q++ + + +    +  K  ILVS+ DH L +LL+R   G L   I  V
Sbjct: 67  ETLIQTFAVNVAQRYDMHWRLAFVSDVKKVGILVSKVDHALLELLWRHARGALPCEITKV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH T +  VEN+ +PF  +P+ ++NK E+  K+  +++ N+  L++LARYMQIL +  
Sbjct: 127 VSNHETLRSAVENFGIPFEVVPVNKENKREAYAKIDELMQGND--LLVLARYMQILDEEF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPY+QAY+ GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VSKWEMKIINIHHSFLPAFVGANPYQQAYDKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  T+E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 SHDFTVEQLRELGQDVERHVLARAVRWHLEDRIIVDGNKTVVF 287


>gi|17548286|ref|NP_521626.1| formyltetrahydrofolate deformylase [Ralstonia solanacearum GMI1000]
 gi|17430532|emb|CAD17216.1| probable formyltetrahydrofolate deformylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 290

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 121/281 (43%), Positives = 178/281 (63%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF-- 60
           S+ILT++CPS     + +   L    C I ++S F+D  + + F+R  F       L   
Sbjct: 9   SFILTLSCPSAPGQVAAVVGLLERHHCYIDELSVFDDELSQRFFVRCVFHPTDTHALHVD 68

Query: 61  --IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +F+PI Q F +Q++I + +   K LI+VS+ +HCL DLL+RW +G L ++IVG+ S
Sbjct: 69  DLRQEFEPIAQTFGMQWAIHDAQARPKVLIMVSKLEHCLTDLLFRWRMGELKMDIVGIAS 128

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L   + LPF + P+T   K + E + ++++E +  EL+ILARYMQ+LS     
Sbjct: 129 NHPDFEPLARQHGLPFRHFPITPDTKAQQEAQWLDLLESSGAELVILARYMQVLSPETSA 188

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV H
Sbjct: 189 KLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQVVERVDH 248

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +   E  +A+G+++E   L++AV A I++RVF+N  +T+VF
Sbjct: 249 SYRPEQLLAVGRDVECLTLSRAVKAFIERRVFLNGDRTVVF 289


>gi|299140574|ref|ZP_07033712.1| formyltetrahydrofolate deformylase [Prevotella oris C735]
 gi|298577540|gb|EFI49408.1| formyltetrahydrofolate deformylase [Prevotella oris C735]
          Length = 287

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 106/286 (37%), Positives = 166/286 (58%), Gaps = 7/286 (2%)

Query: 1   MS-SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTC 56
           M  + IL + CP  + I S I  +++    NI+ + Q+ D + S  FMR+ +    F   
Sbjct: 1   MKPTAILLLHCPDEQGIISEITKFITDNHGNIVYLDQYVDCEDSMFFMRLEWDLENFMIP 60

Query: 57  MKLFIADFQPIVQ-QFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVG 115
            +        + + ++++ +++    E  +  I VS+  HCL DLL R+  G   + I  
Sbjct: 61  REKIEDIINTLYKVRYNMNFNLYFNDEKPRMAIFVSKMSHCLYDLLARYKAGEWNVEIPC 120

Query: 116 VVSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILS 173
           +VSNH     + + + +P+Y   + + +  K E E   + +++K  V  ++LARYMQI+S
Sbjct: 121 IVSNHEDLSYVAKQFGIPYYVWSIKKDHSNKAEVEAAEMELLKKERVTFIVLARYMQIIS 180

Query: 174 DHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDV 233
           D +       IINIHHSFLP+F GA PY QA+E GVKIIGAT+HY   ELDAGPII+QDV
Sbjct: 181 DDMIKSYPYHIINIHHSFLPAFVGAKPYHQAWERGVKIIGATSHYVTAELDAGPIIDQDV 240

Query: 234 VRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            R++H  T E  +  GK++E  VL++AV  HI++++ +   KTI+F
Sbjct: 241 TRISHKDTPESLVLKGKDLEKIVLSRAVTKHIERKILVYHNKTIIF 286


>gi|332304939|ref|YP_004432790.1| formyltetrahydrofolate deformylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172268|gb|AEE21522.1| formyltetrahydrofolate deformylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 284

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 103/281 (36%), Positives = 167/281 (59%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            +  L I CP    + + +  +L+     I++ S   DL T + FMR     N+    ++
Sbjct: 3   QTLRLVIDCPDQVGLVASVSQFLAQHNATIVEASHHTDLQTGRFFMRHEICTNSLTMDIE 62

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                F PI  ++S+ + + ++ +  +  +L S   HCL DLL+RW+   L   I  +++
Sbjct: 63  QIRLAFTPIADKYSMNWKLVDSNKKPRMALLASHESHCLMDLLHRWHSKELNCEIPCIIA 122

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   K+  + + +PF+++      K  +  ++  ++++ N++L +LAR+MQIL D LC 
Sbjct: 123 NHPQMKQFADWHSIPFHWIDFKTLGKEAAFAQISQLLKQYNIDLTVLARFMQILPDSLCK 182

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           ++ GR INIHHSFLPSF GA PY+QAY+ GVK+IGAT HY   +LD GPIIEQ+V+R++H
Sbjct: 183 ELAGRAINIHHSFLPSFAGAKPYQQAYDRGVKLIGATCHYVTSDLDEGPIIEQEVMRISH 242

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + + +D +  GKN E   L   V  H++ RV I++ KT+VF
Sbjct: 243 SDSAQDMVRKGKNCEKTALANGVRYHLEDRVIIHRSKTVVF 283


>gi|254293265|ref|YP_003059288.1| formyltetrahydrofolate deformylase [Hirschia baltica ATCC 49814]
 gi|254041796|gb|ACT58591.1| formyltetrahydrofolate deformylase [Hirschia baltica ATCC 49814]
          Length = 289

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/280 (42%), Positives = 183/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN---TCMKL 59
           S+IL ++C  +  + S +  +LS +   I + + F D  T   F R+ F+          
Sbjct: 9   SFILRLSCKDSIGLVSEVARFLSDRRLFITESANFGDPATGLFFYRVKFIPESNAFSRSN 68

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F ++F+P+ +++ + + +R+ K     +ILVS+ DHCLNDLLYR   G L +NI  ++SN
Sbjct: 69  FSSEFEPVAKKWGMDWELRDAKVKPNVVILVSKGDHCLNDLLYRHRTGALNINISAIISN 128

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H T   L E + +P+Y++P+ + NK ++E++++++IE    +L++LARYMQ+LSD +C K
Sbjct: 129 HLTCGWLAERHDVPYYHVPVNKDNKPQAEERMLDVIEDVKADLVVLARYMQVLSDDMCRK 188

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLPSFKGA PY QA++ GVK++GATAHY   +LD GPII Q V    H 
Sbjct: 189 LEGRCINIHHSFLPSFKGAKPYHQAFDRGVKLVGATAHYVTPDLDEGPIISQAVEPADHR 248

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T ED  A+G++ EA+VL +AV  H + R+F N+ KT+VF
Sbjct: 249 LTAEDMAALGRDTEARVLARAVKLHTEGRIFSNQNKTVVF 288


>gi|269469050|gb|EEZ80611.1| ormyltetrahydrofolate hydrolase [uncultured SUP05 cluster
           bacterium]
          Length = 283

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 107/282 (37%), Positives = 156/282 (55%), Gaps = 3/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M+ Y L I+CP    + + +  ++     NI +     D +  + FMRI       N  +
Sbjct: 1   MNVYRLLISCPDAHGLVAKVSQFIFEYDGNIKEAHHHLDDENKRFFMRIEIESSSLNCSL 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
             F   F  +  ++ + + + +  +  + LI+ S+  HC+ DLL+R +   L   IVGV+
Sbjct: 61  DKFHRAFVSVADKYKMDWRMSDASQLKRILIMGSKSSHCVADLLHRHHEKELEGEIVGVL 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH    KL   Y + F  + + +  K      +   I   N ++++LARYMQI+   LC
Sbjct: 121 SNHDKLSKLASWYDVLFKQVSINDSTKTADIASMTQAISAFNPDVIVLARYMQIIPGDLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K +G+IINIHHSFLPSF GANPY +A E GVK+IGAT HY    LD GPIIEQDVVRV 
Sbjct: 181 DKYSGKIINIHHSFLPSFVGANPYARAAERGVKLIGATCHYVTANLDEGPIIEQDVVRVD 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           HA + +D   +G++IE   L K +  H++ RV     KT+VF
Sbjct: 241 HADSADDMKKMGQDIEKITLAKGLQYHLEDRVLTCNNKTVVF 282


>gi|254283107|ref|ZP_04958075.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
 gi|219679310|gb|EED35659.1| formyltetrahydrofolate deformylase [gamma proteobacterium NOR51-B]
          Length = 282

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 120/281 (42%), Positives = 179/281 (63%), Gaps = 3/281 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
           M SYIL+ +CP    + +     L+  G  I ++S + D  T + F+R  F     N  M
Sbjct: 1   MRSYILSFSCPDRLGVVARYSSLLADAGAFITEVSNYTDPVTERFFLRCVFDDRALNVTM 60

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
                 +Q +  + +  + +R + +  + ++ VS  DHCL+ LL +W  G L   IVGVV
Sbjct: 61  DTLSQRWQAVADELNATWVLRASDDLPRIVLAVSAQDHCLSALLTKWRAGALPAEIVGVV 120

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE + LPFYYLP+T++ K + EQ+++++  + + EL++LARYMQILSD LC
Sbjct: 121 SNHELSRGLVEWHGLPFYYLPVTKETKPQQEQEILSVFSELDGELLVLARYMQILSDGLC 180

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY +A+E GVK+IGATAHY   +LD GPII Q+V  + 
Sbjct: 181 QELAGRAINIHHSFLPGFKGAKPYHRAWERGVKVIGATAHYVTADLDEGPIITQEVRPID 240

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           H  T+E  I +G+++EA  L++AV  H +QRV +N ++T++
Sbjct: 241 HETTVERMIHLGQDVEANALSQAVRLHCEQRVLLNGQRTVI 281


>gi|50085631|ref|YP_047141.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
 gi|49531607|emb|CAG69319.1| formyltetrahydrofolate deformylase [Acinetobacter sp. ADP1]
          Length = 288

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 122/280 (43%), Positives = 182/280 (65%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMKL 59
            Y+L I+CP+   I + + + L+   C I +++Q++D  T + F RI F FN     ++L
Sbjct: 8   QYVLKISCPAASGIVAAVSNCLAGNDCYISEMAQYDDEITGRFFSRIVFRFNEGQGDLEL 67

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
               F  +  +F+++      K   K LI+VS+ DHCL +LLYR + G L   I  +VSN
Sbjct: 68  LKEKFADVTAKFAMKADFYEKKNPMKVLIMVSKFDHCLLNLLYRHHKGELDFQITAIVSN 127

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   + F YLP+++  K + EQ+L+ I+++   EL+ILARYMQILS++LC +
Sbjct: 128 HLDLRAIAEREGIRFIYLPVSKDTKQQQEQELLKIVDETKTELVILARYMQILSNNLCTQ 187

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           ++GR INIHHSFLP FKGA PY QA+E GVK+IGATAH+   +LD GPIIEQ+V RV HA
Sbjct: 188 LSGRAINIHHSFLPGFKGAKPYHQAFERGVKLIGATAHFVTSDLDEGPIIEQEVQRVDHA 247

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              +D +++G++ E   L+KAV   ++ RVF+N  +T+VF
Sbjct: 248 YMPDDLVSVGRDTETVALSKAVKYFVEHRVFMNDDRTVVF 287


>gi|330809024|ref|YP_004353486.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327377132|gb|AEA68482.1| formyltetrahydrofolate deformylase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 288

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 123/282 (43%), Positives = 184/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +I+ ITCP+   I + +  YL+  GC I +++QF+D  + + FMR  F FN      +
Sbjct: 6   NHFIIKITCPAVSGIVAAVTTYLADNGCYIGEMAQFDDDFSGRFFMRAVFRFNDGHQGNI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + + F + + + +T+E  + L++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQIKDGFADVARAFEMTWELHDTREPMRVLLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+T+  K   E +L+ I++    EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVTQDTKARQEAELMKIVDDTGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 KRLSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +A G++ E   L+KAV  H++ RVF+N+ +T++F
Sbjct: 246 HVYLPDDLVATGRDTETVALSKAVKYHLEHRVFLNQDRTVIF 287


>gi|262280876|ref|ZP_06058659.1| formyltetrahydrofolate deformylase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257776|gb|EEY76511.1| formyltetrahydrofolate deformylase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 287

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 169/283 (59%), Gaps = 7/283 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQF-NDLDTSKLFMRISFVFNTCMKLF 60
           ++  L ITC     I   +  +L  QG NI  + Q+  +    + FMR+ F  +      
Sbjct: 7   NTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATEAQGGRYFMRVEFELDHLQSRK 66

Query: 61  IADFQP----IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
            A  Q     + +++S+Q+ +    +  K  ILVS+ DH L +LL+R   G+L   I  V
Sbjct: 67  DALIQTFAANVAERYSMQWRLAFVGDVKKVGILVSKVDHALLELLWRHARGSLPCEITHV 126

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   ++ VEN+ +PF  + +T+ NK+E+  ++         +L++LARYMQILS+  
Sbjct: 127 ISNHEDLRESVENFGIPFSVIKVTKDNKVEAYAQIDE--MMQGNDLLVLARYMQILSEDF 184

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             K   +IINIHHSFLP+F GANPYKQAYE GVK+IGATAHY   +LD GPIIEQDV RV
Sbjct: 185 VAKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGATAHYVTADLDQGPIIEQDVERV 244

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H   +E    +G+++E  VL +AV  H++ R+ ++  KT+VF
Sbjct: 245 SHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDGNKTVVF 287


>gi|331698678|ref|YP_004334917.1| formyltetrahydrofolate deformylase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326953367|gb|AEA27064.1| formyltetrahydrofolate deformylase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 309

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 113/280 (40%), Positives = 163/280 (58%), Gaps = 6/280 (2%)

Query: 5   ILTITCPSNEEITSIIPDYLSTQGCNILDISQ-FNDLDTSKLFMRISFVFNTCMK----L 59
            L  +C     I S I  +L  +G NI    Q   D    + F R+ F      +    L
Sbjct: 31  RLLASCVDRPGIVSAITAFLHDRGANITQYDQETTDPVGGRFFQRLVFHLPGLRERLPQL 90

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                + +  +F + + +R+     +  + VS+ DHCL DLL+RW  G   ++IV VVSN
Sbjct: 91  EREFGETVAPRFGMTWRMRDVDALPRVALFVSRYDHCLLDLLWRWRRGEFPIDIVQVVSN 150

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H    + V  + +P+ ++P+T   K E+EQ  ++++    V+L++LARYMQILS  L  +
Sbjct: 151 HPDLAEAVAGFGVPYAHIPVTRATKPEAEQAQLDLLRD-RVDLVVLARYMQILSGDLLDR 209

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           +   +INIHHSFLP+F GA+PY +A E GVK+IGATAHYA  +LD GPIIEQDV+RV+H 
Sbjct: 210 IGVPVINIHHSFLPAFAGASPYDRARERGVKLIGATAHYATEDLDEGPIIEQDVIRVSHR 269

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               D + +G +IE  VL +AV  H + RV +N R TIVF
Sbjct: 270 HNAADLVRLGADIERTVLARAVRWHCEDRVMVNGRTTIVF 309


>gi|307546034|ref|YP_003898513.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
 gi|307218058|emb|CBV43328.1| formyltetrahydrofolate deformylase [Halomonas elongata DSM 2581]
          Length = 288

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 117/280 (41%), Positives = 167/280 (59%), Gaps = 3/280 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISF---VFNTCMKL 59
           ++I+T  CPS      ++  +L    C I +   F+D      F+R  F     +   + 
Sbjct: 7   TWIMTAQCPSRLGTVDVVTRFLKESRCYITEQQSFDDSLAEHFFIRTEFRPLDADFDPED 66

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
           F A F P   +F + + +         +I+VS+ DHCLNDLLYR+  G L + I  VVSN
Sbjct: 67  FHARFAPRAAEFGMAFDLTAPDSRVPVVIMVSKADHCLNDLLYRYRTGQLPIEIRAVVSN 126

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   K L + + LP+++ P+T + K E E ++  +IE+   EL+ILARYMQ+LS  LC +
Sbjct: 127 HPDLKPLADWHGLPYHHFPVTAETKAEQEARVWGVIEETGAELVILARYMQVLSSELCER 186

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHS LP FKGA PY QAY  GVK++GATAHY   +LD GPII Q V  V+H 
Sbjct: 187 LAGRAINIHHSLLPGFKGAKPYHQAYAKGVKLVGATAHYINDDLDEGPIITQGVESVSHV 246

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
              ED +  G++IE   L +AV  H+++RVF+N ++T+VF
Sbjct: 247 DYPEDLVEKGRDIERLTLARAVAYHVERRVFLNDQRTVVF 286


>gi|111019089|ref|YP_702061.1| formyltetrahydrofolate deformylase [Rhodococcus jostii RHA1]
 gi|110818619|gb|ABG93903.1| probable formyltetrahydrofolate deformylase [Rhodococcus jostii
           RHA1]
          Length = 294

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 101/284 (35%), Positives = 166/284 (58%), Gaps = 7/284 (2%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMKL 59
            Y+L++ CP    I + I  +L+  G  I++ +   D DT   F R +      +  ++ 
Sbjct: 10  RYVLSLGCPDRTGIVARISTFLAEVGGWIVEAAYHADADTGWFFTRQAVRASSVDMSIEE 69

Query: 60  FIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
               F  +  +     ++++ +T E  + ++LVS+  HCL+DLL R   G L  +I  V+
Sbjct: 70  LRERFAAVAAELGPETEWTVSDTGERKRVVLLVSKEAHCLHDLLGRAAGGELPADICAVI 129

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSDH 175
            NH   + +   + + F+++P  +    +  + +++  +++ ++ + ++LAR+MQ+L   
Sbjct: 130 GNHRDLETVTRQHGIDFHHVPFPKDPAERGPAFEQVRELVDAHDPDAVVLARFMQVLPSA 189

Query: 176 LCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVR 235
           LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV+R
Sbjct: 190 LCEHWAGRAINIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTAELDAGPIIEQDVIR 249

Query: 236 VTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           V HA  + D +  G++IE  VL++ +  H++ RV ++ RKT+VF
Sbjct: 250 VDHADEVADMVRQGRDIEKLVLSRGLRWHLEDRVLVHGRKTVVF 293


>gi|260905976|ref|ZP_05914298.1| formyltetrahydrofolate deformylase [Brevibacterium linens BL2]
          Length = 284

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 123/282 (43%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----C 56
           M  Y+ T+ C     IT  +   L T G +I ++ QF+D  T +LF+RI F         
Sbjct: 1   MQDYVFTLECDERPGITHAVTGALLTHGGDIKELKQFDDQYTERLFLRIDFSLQDESQGA 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
           ++   ADF+ I   F   + +    E  + LI+VS+ +HCLNDLL+R  +G L + I  V
Sbjct: 61  IEALRADFEGIGTDFEASWKLWPEGEKRRVLIMVSKFEHCLNDLLFRAQVGELPIEIAAV 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH  H++LVE + +PF+ +P+T++ K E+E KL+ ++++  ++L++LARYMQ+LSD L
Sbjct: 121 VSNHPDHRELVEWHHIPFFRIPVTKETKPEAEAKLLELVDRFEIDLVVLARYMQVLSDDL 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             ++TG+ INIHHSFLPSFKGA PY QA+E GVK +GATAH+   ELD GPII Q +V V
Sbjct: 181 ARELTGKAINIHHSFLPSFKGAKPYHQAWERGVKTVGATAHFVDSELDEGPIIAQQLVEV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
            H+   +D +A G++ E K L+ AV  H   RVF+  ++T+V
Sbjct: 241 DHSFGPKDLVAAGRDAECKALSNAVKWHCDGRVFLAGKRTVV 282


>gi|330958762|gb|EGH59022.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 289

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 122/283 (43%), Positives = 178/283 (62%), Gaps = 5/283 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      I
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDI 65

Query: 62  ADF-----QPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                     + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +
Sbjct: 66  QQLKAGFEAAVARDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAI 125

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           VSNH   + + E   + F YLP+T+  K   E  L+ ++++   EL++LARYMQILSD L
Sbjct: 126 VSNHLDLRPMAEREGIRFIYLPVTKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDL 185

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV
Sbjct: 186 CKQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRV 245

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            H    +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 DHVYLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 288


>gi|73538637|ref|YP_299004.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
 gi|72121974|gb|AAZ64160.1| formyltetrahydrofolate deformylase [Ralstonia eutropha JMP134]
          Length = 290

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 116/282 (41%), Positives = 176/282 (62%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TCM 57
            +++LT++CPS     + +   L    C I +++ F+D  +++ F+R  F         +
Sbjct: 8   QTFVLTLSCPSAPGQVAAVVGLLERHRCYIDELTVFDDDLSNRFFLRCVFHPTHAQAPGI 67

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
            +   +F PI + F +Q++I +     K LI+VS+ +HCL DLL+RW +G L ++IVG+ 
Sbjct: 68  DVLRQEFTPIAEGFGMQWAIHDALARPKVLIMVSRLEHCLADLLFRWRMGELKMDIVGIA 127

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + L   + LPF + P+T + K + E + +++ E +  EL+ILARYMQ+LS    
Sbjct: 128 SNHPDLEPLARQHDLPFRHFPITPETKAKQEAQWLDLFESSGAELVILARYMQVLSPETS 187

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            K+  R INIHHSFLP FKGA PY QA+  GVK+IGATAH+   +LD GPIIEQ V RV 
Sbjct: 188 GKLANRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEGPIIEQAVERVD 247

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H+   E  +A+G+++E   L +AV A I +RVF+N  +T+VF
Sbjct: 248 HSYRPEQLLAVGRDVECITLARAVKAFIDRRVFLNGDRTVVF 289


>gi|254469501|ref|ZP_05082906.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
 gi|211961336|gb|EEA96531.1| formyltetrahydrofolate deformylase [Pseudovibrio sp. JE062]
          Length = 285

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/282 (42%), Positives = 181/282 (64%), Gaps = 2/282 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF--NTCMKL 59
           +++IL  TC     I S +   L+++G NI++ +QF D  T++ F+R++     N     
Sbjct: 4   TTFILRFTCVDQPGIVSTVTSALASRGANIVEANQFCDRKTNQFFLRVAVRVPENIDKAA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                 P V +F ++  + +     K +I+VS+ DH L  LLY+  +G L   +V +VSN
Sbjct: 64  LELAMSPAVDRFKMRLKVEDFSRRPKIIIMVSRFDHALLHLLYQIKVGWLDAEVVAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + ++  +PF++ P+T+QNK+E E KL  +IE  N EL++LARYMQ+L+D +  K
Sbjct: 124 HADSQGVADHEGIPFHHWPITKQNKLEQEAKLSELIESTNAELVVLARYMQVLTDEMSSK 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
             G IINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+  RV H 
Sbjct: 184 FFGMIINIHHSFLPSFKGAKPYHQAHDRGVKLIGATAHYVTPDLDEGPIIEQETERVNHG 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
            T ED++A G++IE++VL +AV  H++ RV +N   T+VF +
Sbjct: 244 MTAEDFVATGRDIESRVLARAVKYHLEGRVMLNDNSTVVFTS 285


>gi|229589807|ref|YP_002871926.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229361673|emb|CAY48554.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 288

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 187/282 (66%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +I+ +TCP+   I + +  YL+ + C I +++QF+D  + + FMR  F FN      +
Sbjct: 6   NHFIIKVTCPAVSGIVAAVTTYLADKACYIGEMAQFDDDFSGRFFMRAVFRFNDGHAGNL 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + Q F +Q+ + +T+E  + +++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QEIRDGFADVAQAFDMQWELHDTREPMRVMLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+++ NK   E +L+ I++    EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSKDNKAAQEAELMKIVDDTRTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 RQLSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +AIG++ E   L+KAV  H++ RVF+N+ +T+VF
Sbjct: 246 HVYKPDDLVAIGRDTETVALSKAVKYHLEHRVFLNQDRTVVF 287


>gi|226305081|ref|YP_002765039.1| formyltetrahydrofolate deformylase [Rhodococcus erythropolis PR4]
 gi|229490171|ref|ZP_04384018.1| formyltetrahydrofolate deformylase [Rhodococcus erythropolis SK121]
 gi|226184196|dbj|BAH32300.1| putative formyltetrahydrofolate deformylase [Rhodococcus
           erythropolis PR4]
 gi|229322919|gb|EEN88693.1| formyltetrahydrofolate deformylase [Rhodococcus erythropolis SK121]
          Length = 295

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 167/285 (58%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
             Y+L++ CP    I + I  +L+  G  I++ +   D DT   F R +   ++    + 
Sbjct: 10  RRYVLSLGCPDTTGIVARISTFLTDVGGWIVEAAYHADADTGWFFTRQAVRASSVSMSID 69

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F+ +  +     ++++ ++    K ++LVS+  HCL+DLL R   G L   I  V
Sbjct: 70  ELRERFKAVAAEIGPETEWTLHDSGAPKKIVLLVSKEGHCLHDLLGRAAGGELPAEISAV 129

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSD 174
           + NH   + + E + + F+++P  +    +  S +K+  +++ +N + ++LAR+MQ+L +
Sbjct: 130 IGNHEDLRSVTERHGIDFHHVPFAKDPAERGPSFEKVRALVDAHNPDAVVLARFMQVLPE 189

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV+
Sbjct: 190 SLCEHWAGRAINIHHSFLPSFIGARPYHQAFARGVKLIGATCHYVTAELDAGPIIEQDVI 249

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV HA  + D +  G++IE  VL++ +  H++ RV ++ RKT+VF
Sbjct: 250 RVDHADDVADMVRQGRDIEKLVLSRGLRWHLEDRVLVHGRKTVVF 294


>gi|34557815|ref|NP_907630.1| formyltetrahydrofolate deformylase [Wolinella succinogenes DSM
           1740]
 gi|34483533|emb|CAE10530.1| FORMYLTETRAHYDROFOLATE DEFORMYLASE [Wolinella succinogenes]
          Length = 277

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 101/279 (36%), Positives = 159/279 (56%), Gaps = 2/279 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M  Y+L I  P  + +   +   +  +G NI    ++ D + ++ FMR  F   T     
Sbjct: 1   MKKYVLLILSPDEKGLIYKVTSIIFKRGLNIDKNDEYVDSEENRFFMRAEFSGETDPLAL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +A+ +  + +                +IL ++ +HCL DLL R++ G L  NI  VVSN+
Sbjct: 61  LAEIRASLPER--AEVKLEEIRPKDIVILCTKENHCLGDLLLRYDSGELEANIKAVVSNY 118

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
              K L E +++PFY +     ++ E EQ+++  +     + ++LA+YM+ILS    H  
Sbjct: 119 DHLKPLSEKFEIPFYGISHEGISRQEHEQRMLECLAALKPDYLVLAKYMRILSPEFVHHY 178

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +IINIHHSFLP+F GANPYKQA+E GVKIIGATAH+    LD GPII QD++++ H+ 
Sbjct: 179 ERQIINIHHSFLPAFVGANPYKQAHERGVKIIGATAHFVNDNLDEGPIIAQDIIKIDHSY 238

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           T  D    G+++E  VL +A+N  +  R+F++  KT++F
Sbjct: 239 TWRDMQKAGRDVEKVVLARALNLALHDRIFVHGNKTVIF 277


>gi|296141328|ref|YP_003648571.1| formyltetrahydrofolate deformylase [Tsukamurella paurometabola DSM
           20162]
 gi|296029462|gb|ADG80232.1| formyltetrahydrofolate deformylase [Tsukamurella paurometabola DSM
           20162]
          Length = 290

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 159/285 (55%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
           + Y+LT+ CP    I + I  +L+  G  I++ +  +D DT   F R +   ++    ++
Sbjct: 5   TRYVLTLGCPDTTGIVARISTFLADVGGWIVEAAYHSDADTGWFFTRQAVRADSVRIPLE 64

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
              A F  +        ++ + +T E    ++LVS+  HCL+DL+ R   G L   I  V
Sbjct: 65  EMRARFAEVAADIGPETEWQLTSTAETKDIVVLVSKEGHCLHDLVGRVATGELDARIAAV 124

Query: 117 VSNHTTHKKLVENYQLPFYYLPM--TEQNKIESEQKLINIIEKNNVELMILARYMQILSD 174
           + NH      VE   +PF+++P     ++K  +  ++  +      + ++LAR+MQ+L  
Sbjct: 125 IGNHPELGDFVERLGIPFHHVPFPGAGEDKSAAFAEVARLTNALRPDAVVLARFMQVLPP 184

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   +LDAGPIIEQDV 
Sbjct: 185 DLCADWAGRAINIHHSFLPSFIGARPYHQAFARGVKLIGATCHYVTADLDAGPIIEQDVT 244

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           RV H+    D +  G++IE  VL + +  H++ RV ++ RKT+VF
Sbjct: 245 RVDHSDEASDMVLRGRDIEKVVLARGLRWHLENRVLVHGRKTVVF 289


>gi|297571827|ref|YP_003697601.1| formyltetrahydrofolate deformylase [Arcanobacterium haemolyticum
           DSM 20595]
 gi|296932174|gb|ADH92982.1| formyltetrahydrofolate deformylase [Arcanobacterium haemolyticum
           DSM 20595]
          Length = 282

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 118/277 (42%), Positives = 174/277 (62%), Gaps = 1/277 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFIA 62
           S I TI+CP    I   +   L+  G N+    Q+ D    + ++R+            A
Sbjct: 6   SLIFTISCPDQPGIVYAVTGLLTQVGANVTQSQQYRDPSQDRFYIRLQADVPGGRPTIDA 65

Query: 63  DFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT 122
            F  +  ++++ Y+I +     +T+I+ S+  HCL+DLL +   G L LN+  VVSNH T
Sbjct: 66  AFAALGARYNMDYTISDASPM-RTIIMCSKEPHCLSDLLAKQREGRLPLNVAAVVSNHET 124

Query: 123 HKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTG 182
            + L E Y++PF ++P+T+  K E+E +L+ ++E+   EL++LARYMQ+LSD +C K+ G
Sbjct: 125 LRLLAEFYEVPFTHIPVTKDTKPEAEAQLLKLVEETGAELVVLARYMQVLSDSICEKLAG 184

Query: 183 RIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTI 242
           +IINIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPIIEQDV RV+HA  +
Sbjct: 185 KIINIHHSFLPSFKGARPYAQAHARGVKLIGATAHYVTADLDEGPIIEQDVARVSHAHDV 244

Query: 243 EDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +  A+G  +E +VL++AV  H + RV     +T+VF
Sbjct: 245 TELQAMGAEVERQVLSRAVRWHAEHRVLHAGLRTVVF 281


>gi|311744674|ref|ZP_07718471.1| formyltetrahydrofolate deformylase [Aeromicrobium marinum DSM
           15272]
 gi|311311983|gb|EFQ81903.1| formyltetrahydrofolate deformylase [Aeromicrobium marinum DSM
           15272]
          Length = 288

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/288 (41%), Positives = 182/288 (63%), Gaps = 8/288 (2%)

Query: 1   MSS-YILTITCPSNEEITSIIPDYLSTQGCNILDISQFND-----LDTSKLFMRISFVFN 54
           MS+ Y+LT++CP    +   +  +++  G NILD  QF D      +  + F+R+ F F 
Sbjct: 1   MSTSYVLTLSCPDRPGLVFAVTRWIAEAGGNILDSQQFTDVSTDVDERGEFFLRVHFDFP 60

Query: 55  TCMKLF--IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALN 112
           T   L      F  +  +  +  +I   +   +TL++VS   HCLNDLL+R   G L + 
Sbjct: 61  TPQDLAGLRTAFAAVATEHRMNAAIVQAEAPVRTLVMVSTDGHCLNDLLFRQTTGGLNIV 120

Query: 113 IVGVVSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQIL 172
           +  VVSNH   ++L   Y +PF+++P++ + K ++E  L+ ++E+ +V L++LARYMQIL
Sbjct: 121 VPAVVSNHRDLEQLAGRYDVPFHHVPVSRETKAQAEAALLRLVEELDVVLVVLARYMQIL 180

Query: 173 SDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQD 232
            D +C ++TGRIINIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPII+Q 
Sbjct: 181 GDDVCRELTGRIINIHHSFLPSFKGARPYHQAHDRGVKLIGATAHYVTADLDEGPIIDQG 240

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           V+RV H     D   +G+++E++ L++AV  H + RV +N  +T+VF 
Sbjct: 241 VLRVDHRLRAADLARVGRDVESQTLSRAVQLHAESRVLMNGPRTVVFD 288


>gi|84514727|ref|ZP_01002091.1| probable formyltetrahydrofolate deformylase [Loktanella
           vestfoldensis SKA53]
 gi|84511778|gb|EAQ08231.1| probable formyltetrahydrofolate deformylase [Loktanella
           vestfoldensis SKA53]
          Length = 286

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/278 (42%), Positives = 190/278 (68%), Gaps = 1/278 (0%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI- 61
            +IL ++C +   I + +   L++QG N+++ +QF D  + + F+R++F+     +  I 
Sbjct: 8   QFILKLSCDAAPGIVAAVTSALASQGANLVETAQFWDRQSDRFFLRVAFLAEDGDETRIL 67

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
               PI  QF +  ++R+T    + LI+VS+ DH +  LLY+  +G L   +V +VSNH 
Sbjct: 68  DALAPIKVQFDMDLNLRHTARKPRLLIMVSRFDHAMLHLLYQVRVGWLDAEVVAIVSNHP 127

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +++ E+  LPFY+LP+T + K E+E +L+ ++E+ + +L++LARYMQ+LSD     ++
Sbjct: 128 DARRIAEHEGLPFYHLPVTRETKAEAEAELLTLVEETDADLVVLARYMQVLSDEFSRALS 187

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR+INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPIIEQ+  RV H+ T
Sbjct: 188 GRVINIHHSFLPSFKGAKPYHQAHERGVKLIGATAHYVTADLDEGPIIEQEAERVAHSMT 247

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            +D +A+G++IEA+VL +AV  H++ RV ++ ++T+VF
Sbjct: 248 PDDLVAVGRDIEARVLARAVKMHLEGRVMLSGQRTLVF 285


>gi|86140556|ref|ZP_01059115.1| formyltetrahydrofolate deformylase [Leeuwenhoekiella blandensis
           MED217]
 gi|85832498|gb|EAQ50947.1| formyltetrahydrofolate deformylase [Leeuwenhoekiella blandensis
           MED217]
          Length = 284

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 105/283 (37%), Positives = 170/283 (60%), Gaps = 4/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN----TC 56
           M    L I CP  + I + I  ++  +  NI+ + Q  D   S  FMR+   F+    + 
Sbjct: 1   MQKITLLINCPDRKGIVTTITQFILERQGNIVYLDQHVDRQESIFFMRVESEFDQEGFSI 60

Query: 57  MKLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
               +      V  + L Y + +     +  + VS+ DHCL DLL R+  G L + I  +
Sbjct: 61  ADFEMQFIAQFVDDYQLTYQLFDAYYKPRLALFVSKYDHCLYDLLGRYASGELPVEIPLI 120

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + + +++PF ++ +T+  K E+E + I  I+++ ++L++LARYMQI+SD  
Sbjct: 121 ISNHPDLEIVAKRFEIPFKHIAVTKATKAEAEAEQIAAIKEHKIDLIVLARYMQIISDDF 180

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
             +   +IINIHHSFLP+F GA PY  A+E GVKIIGAT+HY   +LD GPIIEQ++VRV
Sbjct: 181 VAQFKNKIINIHHSFLPAFIGAKPYHAAFERGVKIIGATSHYVTADLDEGPIIEQEIVRV 240

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  +++D+I  G+++E  VL +A+ AH++ +V +   KT++F
Sbjct: 241 SHVHSVQDFILKGRDLEKIVLARAIKAHVEHKVLVFGNKTVIF 283


>gi|88706482|ref|ZP_01104186.1| formyltetrahydrofolate deformylase [Congregibacter litoralis KT71]
 gi|88699194|gb|EAQ96309.1| formyltetrahydrofolate deformylase [Congregibacter litoralis KT71]
          Length = 286

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 116/280 (41%), Positives = 172/280 (61%), Gaps = 3/280 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT---CMK 58
            SYILT +CP +  + +         G NI +IS + D  +   F+R  F  +     ++
Sbjct: 6   QSYILTFSCPDSIGVVARYSQLFFECGINITEISNYTDPVSDTFFLRCVFDVSGMSCSLE 65

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
            F A  +P+  +  + Y +R      K ++ VS+ DHCL  LL +   G L   IV VVS
Sbjct: 66  QFEARLRPVADELQMTYLLRCVSTLPKIVVAVSRYDHCLTALLTKQRAGALPAQIVAVVS 125

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + L E + +PF+YLP+T ++K   E +++ I+ ++  +L++LARYMQILSD LC 
Sbjct: 126 NHEDCRGLSEWHGVPFHYLPVTPESKPVQEAEMLAILRESEADLLVLARYMQILSDELCS 185

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPII Q+V  + H
Sbjct: 186 QLSGRAINIHHSFLPGFKGAKPYHQAYDRGVKVIGATAHYVTADLDEGPIIAQEVRPIDH 245

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
             ++E  + +G + EA  L++AV  H +QRV +N ++T+V
Sbjct: 246 EISVEQMVHLGHDTEATALSQAVRLHCEQRVILNGQRTVV 285


>gi|326332984|ref|ZP_08199241.1| formyltetrahydrofolate deformylase [Nocardioidaceae bacterium
           Broad-1]
 gi|325949342|gb|EGD41425.1| formyltetrahydrofolate deformylase [Nocardioidaceae bacterium
           Broad-1]
          Length = 300

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 110/280 (39%), Positives = 175/280 (62%), Gaps = 3/280 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLFI 61
           ++ +LT++C     I   +  +L  +G +IL+  Q +D      F+R +F       +  
Sbjct: 21  TTNVLTLSCQERPGIMHAVTSFLYDRGFDILEHQQHDDRMGELFFLRTAFASADGADVDE 80

Query: 62  --ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
             A F PI  +F + ++  + ++  + L++VS+  HCLNDL++RW  GTL   I  V SN
Sbjct: 81  LTAAFGPIADRFGMSFTFHDERK-PRLLVMVSKFGHCLNDLIFRWRGGTLGGEIAVVASN 139

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   + + E   L F ++P+T + K ++EQ++++++++  ++L++LARYMQILSD LC +
Sbjct: 140 HEDLRPMAEAAGLDFVHIPITAETKPQAEQRMLDLVDEYEIDLVVLARYMQILSDGLCRQ 199

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR INIHHSFLP FKGA PY QA++ GVK++GATAHY   +LD GPIIEQ+V RV H 
Sbjct: 200 LEGRAINIHHSFLPGFKGAKPYHQAHDRGVKLVGATAHYVTADLDEGPIIEQEVNRVDHT 259

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            T +    +G++ E   L++AV  H + RV ++   T+VF
Sbjct: 260 YTPQALANVGQDAECLALSRAVRWHCEHRVLMHGSSTVVF 299


>gi|331019500|gb|EGH99556.1| formyltetrahydrofolate deformylase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 288

 Score =  273 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 181/282 (64%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +IL I+CP+   I + +  YL+   C I +++QF+D  +   FMR  F FN      +
Sbjct: 6   NHFILKISCPATSGIVAAVTSYLAGNSCYIGEMAQFDDEFSGTFFMRAVFRFNDGHDGDI 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F  + + F++Q+ + +T+   + L++VS+ DHCL DLLYR + G + + I  +V
Sbjct: 66  QQLKAGFDAVTKDFAMQWELHDTRRPMRVLLMVSKFDHCLTDLLYRHHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP+++  K   E  L+ ++++   EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRAMAEREGIRFIYLPVSKDTKAAQEAALMKVVDETGTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            ++ GR INIHHSFLP FKGA PY QAYE GVK+IGATAHY   +LD GPIIEQ+V RV 
Sbjct: 186 RQLAGRAINIHHSFLPGFKGAKPYHQAYERGVKLIGATAHYVTSDLDEGPIIEQEVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +A G+N E   L++AV  H++ RVF+N  +T++F
Sbjct: 246 HVYLPDDLVAAGRNNETIALSRAVKYHLEHRVFLNTDRTVIF 287


>gi|332186669|ref|ZP_08388412.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
 gi|332013321|gb|EGI55383.1| formyltetrahydrofolate deformylase [Sphingomonas sp. S17]
          Length = 285

 Score =  272 bits (695), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 115/282 (40%), Positives = 184/282 (65%), Gaps = 2/282 (0%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV--FNTCMKL 59
            +Y++ ++C     I + I   L++ G NIL+ +QF D      F+RI+     +     
Sbjct: 4   KAYVIRLSCKDQPGIVAAITTALASLGANILESNQFWDRQADHFFLRIAVTVPADVTRDA 63

Query: 60  FIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSN 119
                QP + +F+L   + +  +  + +I+VS+ DH ++ LLY+  +  L  ++V +VSN
Sbjct: 64  VERTVQPAIDRFALDLKVTDVDQRPRIIIMVSKFDHAMHHLLYQIKVRWLNADVVAIVSN 123

Query: 120 HTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHK 179
           H   +   E   +PF++ P+T++NK E EQKL++++++   EL++LARYMQ+LS+ L  +
Sbjct: 124 HDAARSAAEIEGIPFHHWPVTKENKAEQEQKLLDLVDETGAELVVLARYMQVLSNDLSER 183

Query: 180 MTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHA 239
           + GR+INIHHSFLPSFKGA PY QA++ GVK+IGATAHY   +LD GPIIEQ+  RV+H+
Sbjct: 184 LYGRVINIHHSFLPSFKGAKPYHQAHDRGVKLIGATAHYVTPDLDEGPIIEQETQRVSHS 243

Query: 240 QTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPA 281
            T ED++A G++IE++VL +AV  H++ RV +N  +T+VF  
Sbjct: 244 LTSEDFVATGRDIESRVLARAVKYHLEGRVMLNSHRTVVFAP 285


>gi|145298305|ref|YP_001141146.1| formyltetrahydrofolate deformylase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142851077|gb|ABO89398.1| formyltetrahydrofolate deformylase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 278

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 94/279 (33%), Positives = 159/279 (56%), Gaps = 2/279 (0%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF 60
           M   IL   CP  + + + I +       NI    +F D +  + FMR         +  
Sbjct: 1   MEKKILLTDCPDAKGLIAKITNICYKHQLNINMNDEFVDHENGRFFMRTELEGRFNDETL 60

Query: 61  IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH 120
           +AD    +   + +  ++  K   + +ILV++  HCL D+L +   G L ++IV V+ N+
Sbjct: 61  LADLDDALPAGAQRRLVKAGK--KRIVILVTKETHCLGDILMKNYAGALDMDIVAVIGNY 118

Query: 121 TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM 180
            T  +L   + +PF+ +   + ++ E E+++  II+    + +ILA+YM++L+       
Sbjct: 119 DTLAELTGKFDIPFHTVSHEDLSRTEHEEQVRAIIDGYQPDYVILAKYMRVLTPSFVEAY 178

Query: 181 TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ 240
             +I+NIHHSFLP+F GA PY+QA++ GVK+IGATAH+   +LD GPI+EQDV+ V HA 
Sbjct: 179 PRKILNIHHSFLPAFIGARPYRQAFDRGVKLIGATAHFVTDDLDEGPIVEQDVIHVGHAF 238

Query: 241 TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           + +D    G+++E  VL++A+   + +RVF+   KT+VF
Sbjct: 239 SADDMAKAGRDVEKSVLSRALELVLNERVFVYGNKTVVF 277


>gi|254480116|ref|ZP_05093364.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
 gi|214039678|gb|EEB80337.1| formyltetrahydrofolate deformylase [marine gamma proteobacterium
           HTCC2148]
          Length = 286

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 127/281 (45%), Positives = 179/281 (63%), Gaps = 3/281 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMK 58
           + YIL  TCP+   I + +  +L+ +GC I ++S F+D   + LFMR  F     +   +
Sbjct: 5   TEYILKATCPAARGIVAGVSGFLAERGCYISELSHFDDRQNANLFMRTRFHIDNGDATQE 64

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
               +FQ +  +FS+ + I    +  +TLI+VSQ DHCLNDLLYR   G L + I  VVS
Sbjct: 65  SNQEEFQAVADKFSMDWQIIPVSQTVRTLIMVSQYDHCLNDLLYRLRKGELNIEITAVVS 124

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + +VE   + F +LP+T+  K + E +L+ IIE+ + EL+ LARYMQILSD LC 
Sbjct: 125 NHQGLRPMVEREGIRFIHLPVTKDTKPQQEVRLLEIIEETDSELITLARYMQILSDTLCT 184

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++G++INIHHSFLPSFKGA PY QA+  GVK+IGATAHY   +LD GPI+ Q V  V H
Sbjct: 185 ELSGKVINIHHSFLPSFKGAKPYHQAFHRGVKLIGATAHYVTGDLDEGPILSQAVQEVDH 244

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
             T E  +A+G++ E + L  AV  H + R F++  KTI+F
Sbjct: 245 TYTPEMLVAVGRDTETQALATAVKLHTEHRTFLDSNKTIIF 285


>gi|312960307|ref|ZP_07774818.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
 gi|311285529|gb|EFQ64099.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens WH6]
          Length = 288

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 184/282 (65%), Gaps = 4/282 (1%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNT----CM 57
           + +I+ +TCP+   I + +  YL+   C I +++QF+D  + + FMR  F FN      +
Sbjct: 6   NHFIIKVTCPAVSGIVAAVTTYLADNACYIGEMAQFDDDFSGRFFMRAVFRFNDGHEGDL 65

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +     F  + Q F +Q+ + +T+E  + +++VS+ DHCL DLLYR++ G + + I  +V
Sbjct: 66  QQIKDGFAEVAQAFDMQWELHDTREPMRVMLMVSKFDHCLTDLLYRYHKGEMDMTITAIV 125

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + + E   + F YLP++  NK   E +L+ I++    EL++LARYMQILSD LC
Sbjct: 126 SNHLDLRPMAEREGIRFIYLPVSRDNKAAQEAELMKIVDDTRTELVVLARYMQILSDDLC 185

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ V RV 
Sbjct: 186 RQLSGRAINIHHSFLPGFKGAKPYHQAYQRGVKLIGATAHYVTRDLDEGPIIEQQVQRVD 245

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           H    +D +AIG++ E   L+KAV  H++ RVF+N+ +T+VF
Sbjct: 246 HVYKPDDLVAIGRDTETVALSKAVKYHLEHRVFLNQDRTVVF 287


>gi|148800304|gb|ABR12869.1| PurU [Mesorhizobium sp. CJ1]
          Length = 297

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 113/278 (40%), Positives = 179/278 (64%), Gaps = 2/278 (0%)

Query: 4   YILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFN--TCMKLFI 61
           ++L+++C     I + +   L+  G NI + +QF D  T++ FMRI+F            
Sbjct: 20  HVLSLSCDDRPGIVAAVTTELAAMGANIAESNQFWDRQTNRFFMRIAFAAPVGAVKDDIE 79

Query: 62  ADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHT 121
              +  V++F ++ S+ +     K +++VS+ DH L  +LY+  +G L   +  +VSNH 
Sbjct: 80  RALKSPVERFGMKASLIDQGRRLKIIVMVSKFDHALLHILYQIKVGWLNAEVAAIVSNHE 139

Query: 122 THKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMT 181
             +   E   +P++  P+++ +K + E+KL+ ++ + + EL+ILARYMQ+ SD L  ++ 
Sbjct: 140 DSRCNAELAGIPYHCWPISKNDKTKQEEKLLELVRETDAELVILARYMQVFSDALSKRLY 199

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           GR INIHHSFLPSFKGA PY QA+E GVK+IGATAHY   +LD GPII+Q+  RVTH+ +
Sbjct: 200 GRAINIHHSFLPSFKGAKPYHQAFERGVKLIGATAHYVTPDLDEGPIIDQETERVTHSMS 259

Query: 242 IEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
            ED++A+G++IE++VL +AV  H++ RV +N  KTIVF
Sbjct: 260 AEDFVAVGRDIESRVLARAVKLHLETRVMLNGHKTIVF 297


>gi|319951967|ref|YP_004163234.1| formyltetrahydrofolate deformylase [Cellulophaga algicola DSM
           14237]
 gi|319420627|gb|ADV47736.1| formyltetrahydrofolate deformylase [Cellulophaga algicola DSM
           14237]
          Length = 283

 Score =  272 bits (695), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 114/283 (40%), Positives = 176/283 (62%), Gaps = 5/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCM 57
           M + IL I CP    I   +  ++  QG NI+ + Q  D  + +LFMRI   F      +
Sbjct: 1   MKTTIL-IHCPDQSGIICTVTGFVHAQGGNIIYLDQHVDKASGELFMRIESEFLDTKLSV 59

Query: 58  KLFIADFQP-IVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
             F + F+  +  +F +++SI   +   +  + VS+ +HCL DLL R+N G LA++I  +
Sbjct: 60  HHFKSKFEEQLTAKFKIKWSIHTDETKPRMGLFVSKYNHCLYDLLSRFNSGELAVDIPFI 119

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHL 176
           +SNH   + + + + +PFY++P+T+  K E+E K + ++EK  ++ ++LARYMQI++  +
Sbjct: 120 ISNHNDLEFVAKQFDIPFYHIPVTKATKAEAENKQLELLEKYKIDFIVLARYMQIVTSKI 179

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
                 +IINIHHSFLP+F GA PY  A++ GVKIIGAT HY   ELDAGPII QD   V
Sbjct: 180 IDHYPNKIINIHHSFLPAFAGAKPYHAAFKRGVKIIGATGHYVTEELDAGPIIAQDTTTV 239

Query: 237 THAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           +H  +I+D IA G+++E  VL++AV  HIQ++  +   KTI+F
Sbjct: 240 SHTNSIDDLIAKGRDLEKIVLSRAVKLHIQRKTMVYNNKTIIF 282


>gi|229589818|ref|YP_002871937.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
 gi|229361684|emb|CAY48565.1| formyltetrahydrofolate deformylase [Pseudomonas fluorescens SBW25]
          Length = 288

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 126/281 (44%), Positives = 180/281 (64%), Gaps = 4/281 (1%)

Query: 3   SYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMK---- 58
            YIL ITCP+   I + I   L+ Q C I +++QF+D  T + FMR  F FNT +     
Sbjct: 7   HYILKITCPAASGIVAAISACLAQQQCYISELAQFDDEFTGQFFMRAVFRFNTGVSGDIG 66

Query: 59  LFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVS 118
                   +   F + + + ++++ T+ L++VS+ DHCL DLLYR   G + ++I  VVS
Sbjct: 67  ALRNGLGDLAGGFDMHWQLFSSRQPTRVLLMVSKFDHCLTDLLYRHRKGEMDMHITAVVS 126

Query: 119 NHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCH 178
           NH   + + E   + F YLP+T+  K   E +L+ I+E    +L++LARYMQILSD LC 
Sbjct: 127 NHLDLRAMAEREGIRFIYLPITQDTKARQEAELMRIVEDTQTDLVVLARYMQILSDGLCQ 186

Query: 179 KMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTH 238
           +++GR INIHHSFLP FKGA PY QAY+ GVK+IGATAHY   +LD GPIIEQ++ RV H
Sbjct: 187 QLSGRAINIHHSFLPGFKGAKPYHQAYDRGVKLIGATAHYVTSDLDEGPIIEQEIQRVDH 246

Query: 239 AQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
               +  +AIG++ E   L+KA+  H++ RVFIN+ KT++F
Sbjct: 247 THLPDSLVAIGRDTETVALSKALKYHLEHRVFINQDKTVIF 287


>gi|54027179|ref|YP_121421.1| formyltetrahydrofolate deformylase [Nocardia farcinica IFM 10152]
 gi|54018687|dbj|BAD60057.1| putative formyltetrahydrofolate deformylase [Nocardia farcinica IFM
           10152]
          Length = 296

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 98/285 (34%), Positives = 159/285 (55%), Gaps = 7/285 (2%)

Query: 2   SSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVF---NTCMK 58
             Y+LT+ CP    I + I  +++  G +I +    +D DT   F R +         + 
Sbjct: 11  RRYVLTLGCPDRPGIIARITSFIAEFGGSISEAGYHSDEDTGWFFTRQAIKAATVPFELD 70

Query: 59  LFIADFQPIVQQ--FSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGV 116
                F  +  +     ++ + ++    + ++LVS+  HCL+DLL R   G L   I  V
Sbjct: 71  ELRERFAEVAAELSPETEWQVHDSGARRRAVLLVSRDGHCLHDLLGRAASGELPATIEAV 130

Query: 117 VSNHTTHKKLVENYQLPFYYLPMTEQN--KIESEQKLINIIEKNNVELMILARYMQILSD 174
           + NH     + E + + F+++P  +    +  + +++  +++ ++   ++LAR+MQ+L  
Sbjct: 131 IGNHPDLAAMTEAHGVKFHHVPFPKDPAERGPAFEQVRELVDAHDPHAVVLARFMQVLPP 190

Query: 175 HLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVV 234
            LC    GR INIHHSFLPSF GA PY QA+  GVK+IGAT HY   ELDAGPIIEQDV+
Sbjct: 191 QLCEHWAGRAINIHHSFLPSFVGARPYHQAFARGVKLIGATCHYVTPELDAGPIIEQDVI 250

Query: 235 RVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVF 279
           R+ HA  + D +  G++IE  VL + +  H++ RV ++ R+T+VF
Sbjct: 251 RIDHADQVRDMVRQGRDIERVVLARGLRWHLEGRVLVHGRRTVVF 295


>gi|260062135|ref|YP_003195215.1| formyltetrahydrofolate deformylase [Robiginitalea biformata
           HTCC2501]
 gi|88783697|gb|EAR14868.1| formyltetrahydrofolate deformylase [Robiginitalea biformata
           HTCC2501]
          Length = 282

 Score =  271 bits (694), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 92/280 (32%), Positives = 159/280