RPSBLAST alignment for GI: 254780911 and conserved domain: PLN02828

>gnl|CDD|178422 PLN02828, PLN02828, formyltetrahydrofolate deformylase. Length = 268
 Score =  213 bits (545), Expect = 3e-56
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 18/273 (6%)

Query: 20  IPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCM---KLFIADFQPIVQQFSLQYS 76
           + D ++++G NIL +  F   + +  + R  F+F+           DFQ I + F    S
Sbjct: 1   LSDCIASRGGNILGVDVFVPENKNVFYSRSEFIFDPVKWPRAQMDEDFQEISKHFKALKS 60

Query: 77  IRNTKEAT---KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH----TTH-KKLVE 128
           +          K  +L S+ DHCL DLL+RW  G L ++I  V+SNH     TH  + +E
Sbjct: 61  VVRVPGLDPKYKIAVLASKQDHCLIDLLHRWQDGRLPVDITCVISNHERGPNTHVMRFLE 120

Query: 129 NYQLPFYYLPMTEQNKIESEQKLINIIE-KNNVELMILARYMQILSDHLCHKMTGRIINI 187
            + +P++YLP T++NK E E     I+E     + ++LARYMQILS +        IINI
Sbjct: 121 RHGIPYHYLPTTKENKREDE-----ILELVKGTDFLVLARYMQILSGNFLKGYGKDIINI 175

Query: 188 HHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIA 247
           HH  LPSFKG NP KQA++ GVK+IGAT+H+   ELDAGPIIEQ V RV+H   +  ++ 
Sbjct: 176 HHGLLPSFKGGNPSKQAFDAGVKLIGATSHFVTEELDAGPIIEQMVERVSHRDNLRSFVQ 235

Query: 248 IGKNIEAKVLTKAVNAHIQQRVFINKR-KTIVF 279
             +N+E + L KA+ ++ + RV      KT+VF
Sbjct: 236 KSENLEKQCLAKAIKSYCELRVLPYGTNKTVVF 268