RPSBLAST alignment for GI: 254780911 and conserved domain: PRK00005

>gnl|CDD|178787 PRK00005, fmt, methionyl-tRNA formyltransferase; Reviewed. Length = 309
 Score = 42.0 bits (100), Expect = 2e-04
 Identities = 29/128 (22%), Positives = 52/128 (40%), Gaps = 20/128 (15%)

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILS-------DHL 176
           K+L   + +P        Q +   + + +  +   N +++++  Y QIL           
Sbjct: 49  KQLALEHGIPVL------QPEKLRDPEFLAELAALNADVIVVVAYGQILPKAVLDIPRLG 102

Query: 177 CHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRV 236
           C       IN+H S LP ++GA P ++A   G    G T       LD G ++ +  V +
Sbjct: 103 C-------INLHASLLPRWRGAAPIQRAIIAGDAETGVTIMQMDEGLDTGDMLLKAEVPI 155

Query: 237 THAQTIED 244
           T   T  +
Sbjct: 156 TPTDTAGE 163