RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate
deformylase [Candidatus Liberibacter asiaticus str. psy62]
         (288 letters)



>gnl|CDD|31131 COG0788, PurU, Formyltetrahydrofolate hydrolase [Nucleotide
           transport and metabolism].
          Length = 287

 Score =  369 bits (950), Expect = e-103
 Identities = 135/283 (47%), Positives = 194/283 (68%), Gaps = 3/283 (1%)

Query: 1   MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCM 57
             ++ILT++CP    I + I  +L+  GCNI+D  QF+D +T + FMR+ F         
Sbjct: 5   PDTFILTVSCPDQPGIVAAISGFLAEHGCNIVDSDQFDDPETGRFFMRVEFEGEGGPLDR 64

Query: 58  KLFIADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVV 117
           +   A F P+ ++F + + + +  +  +  ILVS+ DHCL DLLYRW IG L   IV V+
Sbjct: 65  EALRAAFAPLAEEFGMDWRLHDAAQRKRIAILVSKEDHCLGDLLYRWRIGELPAEIVAVI 124

Query: 118 SNHTTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLC 177
           SNH   + LVE + +PF+++P+T++NK E+E +L+ ++E+   +L++LARYMQILS    
Sbjct: 125 SNHDDLRPLVERFDIPFHHIPVTKENKAEAEARLLELLEEYGADLVVLARYMQILSPDFV 184

Query: 178 HKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
            +  G+IINIHHSFLP+F GANPY QAYE GVK+IGATAHY   +LD GPIIEQDV+RV 
Sbjct: 185 ERFPGKIINIHHSFLPAFIGANPYHQAYERGVKLIGATAHYVTADLDEGPIIEQDVIRVD 244

Query: 238 HAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFP 280
           HA ++ED +  G+++E  VL +AV AH++ RVF+N  KT+VFP
Sbjct: 245 HAYSVEDLVRAGRDVEKLVLARAVKAHLEDRVFVNGNKTVVFP 287


>gnl|CDD|30647 COG0299, PurN, Folate-dependent phosphoribosylglycinamide
           formyltransferase PurN [Nucleotide transport and
           metabolism].
          Length = 200

 Score =  128 bits (324), Expect = 1e-30
 Identities = 54/175 (30%), Positives = 84/175 (48%), Gaps = 3/175 (1%)

Query: 107 GTLALNIVGVVSNHTTHKKL--VENYQLPFYYL-PMTEQNKIESEQKLINIIEKNNVELM 163
           G L   IV V+S+      L       +P   L      ++   ++ L+  +++   +L+
Sbjct: 24  GKLDAEIVAVISDKADAYALERAAKAGIPTVVLDRKEFPSREAFDRALVEALDEYGPDLV 83

Query: 164 ILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICEL 223
           +LA YM+IL      +  GRI+NIH S LP+F G + ++QA E GVK+ G T H+    +
Sbjct: 84  VLAGYMRILGPEFLSRFEGRILNIHPSLLPAFPGLHAHEQALEAGVKVSGCTVHFVTEGV 143

Query: 224 DAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIV 278
           D GPII Q  V V    T E   A     E ++   AV    + R+ I   + I+
Sbjct: 144 DTGPIIAQAAVPVLPGDTAETLEARVLEQEHRLYPLAVKLLAEGRLKIEGGRVIL 198


>gnl|CDD|144222 pfam00551, Formyl_trans_N, Formyl transferase.  This family
           includes the following members. Glycinamide
           ribonucleotide transformylase catalyses the third step
           in de novo purine biosynthesis, the transfer of a formyl
           group to 5'-phosphoribosylglycinamide.
           Formyltetrahydrofolate deformylase produces formate from
           formyl- tetrahydrofolate. Methionyl-tRNA
           formyltransferase transfers a formyl group onto the
           amino terminus of the acyl moiety of the methionyl
           aminoacyl-tRNA. Inclusion of the following members is
           supported by PSI-blast. HOXX_BRAJA (P31907) contains a
           related domain of unknown function. PRTH_PORGI (P46071)
           contains a related domain of unknown function.
           Y09P_MYCTU (Q50721) contains a related domain of unknown
           function.
          Length = 181

 Score =  122 bits (309), Expect = 1e-28
 Identities = 55/180 (30%), Positives = 82/180 (45%), Gaps = 3/180 (1%)

Query: 85  KTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNHTT--HKKLVENYQLP-FYYLPMTE 141
           K  +L+S     L  LL     G   + IV VV+N       +  E   +P   +     
Sbjct: 2   KIAVLISGTGSNLQALLDALRKGGHEVEIVAVVTNKDKAAGLERAEQAGIPVEVFEHKNF 61

Query: 142 QNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPY 201
             + + + +L + +     +L++LA YM+IL         G+I+NIH S LP F+GA P 
Sbjct: 62  TPRSQFDSELADSLAALAPDLIVLAGYMRILPPEFLQAFPGKILNIHPSLLPRFRGAAPI 121

Query: 202 KQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAV 261
           ++A E G K  G T H    ELD GPI+ Q  V +    T E        +E K L +A+
Sbjct: 122 QRALEAGDKETGVTVHQVDEELDTGPILAQKAVPILPDDTSETLYNRVAELEHKALPEAL 181


>gnl|CDD|38286 KOG3076, KOG3076, KOG3076, 5'-phosphoribosylglycinamide
           formyltransferase [Carbohydrate transport and
           metabolism].
          Length = 206

 Score =  121 bits (305), Expect = 2e-28
 Identities = 55/160 (34%), Positives = 84/160 (52%), Gaps = 3/160 (1%)

Query: 113 IVGVVSNHTTHKKL--VENYQLPFYYLPMTE-QNKIESEQKLINIIEKNNVELMILARYM 169
           +V V+SN      L    +  +P   +P     ++ + + +L  ++ +   +L+ LA YM
Sbjct: 38  VVLVISNKKGVYGLERAADAGIPTLVIPHKRFASREKYDNELAEVLLELGTDLVCLAGYM 97

Query: 170 QILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPII 229
           +ILS     ++  RIINIH + LP+FKG +  KQA E GVK+ G T H+ I E+D GPII
Sbjct: 98  RILSGEFLSQLPKRIINIHPALLPAFKGLHAIKQALEAGVKLSGCTVHFVIEEVDTGPII 157

Query: 230 EQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVNAHIQQRV 269
            Q  V V    T+E       + E K   +A+ A  + RV
Sbjct: 158 AQMAVPVIPGDTLESLEQRVHDAEHKAFVEAIKAVCEGRV 197


>gnl|CDD|153147 cd04875, ACT_F4HF-DF, N-terminal ACT domain of
          formyltetrahydrofolate deformylase (F4HF-DF;
          formyltetrahydrofolate hydrolase).  This CD includes
          the N-terminal ACT domain of formyltetrahydrofolate
          deformylase (F4HF-DF; formyltetrahydrofolate hydrolase)
          which catalyzes the hydrolysis of
          10-formyltetrahydrofolate (formyl-FH4) to FH4 and
          formate. Formyl-FH4 hydrolase  generates the formate
          that is used by purT-encoded
          5'-phosphoribosylglycinamide transformylase for step
          three of de novo purine nucleotide synthesis.
          Formyl-FH4 hydrolase, a hexamer which is activated by
          methionine and inhibited by glycine, is proposed to
          regulate the balance FH4 and C1-FH4 in response to
          changing growth conditions. Members of this CD belong
          to the superfamily of ACT regulatory domains.
          Length = 74

 Score = 66.8 bits (164), Expect = 6e-12
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 5  ILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFV---FNTCMKLFI 61
          ILT++CP    I + +  +L+  G NI++  QF D D+ + FMR+ F    F+   +   
Sbjct: 1  ILTLSCPDRPGIVAAVSGFLAEHGGNIVESDQFVDPDSGRFFMRVEFELEGFDLSREALE 60

Query: 62 ADFQPIVQQFSLQY 75
          A F P+  +F + +
Sbjct: 61 AAFAPVAAEFDMDW 74


>gnl|CDD|30572 COG0223, Fmt, Methionyl-tRNA formyltransferase [Translation,
           ribosomal structure and biogenesis].
          Length = 307

 Score = 62.5 bits (152), Expect = 1e-10
 Identities = 32/137 (23%), Positives = 57/137 (41%), Gaps = 6/137 (4%)

Query: 124 KKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKMTGR 183
           K+L     +P +      Q +  ++ + +  +   + +L+++  Y QIL   +       
Sbjct: 50  KRLALELGIPVF------QPEKLNDPEFLEELAALDPDLIVVVAYGQILPKEILDLPPYG 103

Query: 184 IINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQTIE 243
            IN+H S LP ++GA P + A   G    G T       LDAG I+ Q  V +    T  
Sbjct: 104 CINLHPSLLPRYRGAAPIQWAILNGDTETGVTIMQMDEGLDAGDILAQREVPIEPDDTAG 163

Query: 244 DYIAIGKNIEAKVLTKA 260
                   + A++L + 
Sbjct: 164 SLHDKLAELGAELLLET 180


>gnl|CDD|38292 KOG3082, KOG3082, KOG3082, Methionyl-tRNA formyltransferase
           [Translation, ribosomal structure and biogenesis].
          Length = 338

 Score = 44.2 bits (104), Expect = 4e-05
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 1/103 (0%)

Query: 161 ELMILARYMQILSDHLCHKMTGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAI 220
           +L I A + ++L   L +++    IN+H S LP ++GA P ++A   G  + G T     
Sbjct: 83  QLAITASFGRLLPFKLLNQLPYGGINVHPSLLPKYRGAAPVQRALLNGDTLTGVTIQTID 142

Query: 221 -CELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLTKAVN 262
               D GPI+ Q+ + V   +T  +  A   ++ A +L +++ 
Sbjct: 143 PKRFDKGPILAQEYLAVNPKETAPELTASLSSLGANLLIRSLY 185


>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic
           semialdehyde dehydrogenase and related proteins.  ALDH
           subfamily which includes the NAD+-dependent,
           alpha-aminoadipic semialdehyde dehydrogenase (AASADH,
           EC=1.2.1.31), also known as Antiquitin-1, ALDH7A1,
           ALDH7B or delta-1-piperideine-6-carboxylate
           dehydrogenase (P6CDH), and other similar sequences, such
           as the uncharacterized aldehyde dehydrogenase of
           Candidatus kuenenia AldH (locus CAJ73105).
          Length = 478

 Score = 34.1 bits (79), Expect = 0.051
 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 19/81 (23%)

Query: 181 TGRII---NIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVT 237
           T R+I   +++  FL     A  YKQ     V+I G            GP+I Q  V   
Sbjct: 282 TRRLIVHESVYDEFLERLVKA--YKQ-----VRI-GDPLDEGT---LVGPLINQAAV--- 327

Query: 238 HAQTIEDYIAIGKNIEAKVLT 258
             +   + I I K+    VLT
Sbjct: 328 --EKYLNAIEIAKSQGGTVLT 346


>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia
           aldehyde dehydrogenase AldH (CAJ73105)-like.
           Uncharacterized aldehyde dehydrogenase of Candidatus
           kuenenia AldH (locus CAJ73105) and similar sequences
           with similarity to alpha-aminoadipic semialdehyde
           dehydrogenase (AASADH, human ALDH7A1, EC=1.2.1.31),
           Arabidopsis ALDH7B4, and Streptomyces clavuligerus
           delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH)
           are included in this CD.
          Length = 478

 Score = 33.1 bits (76), Expect = 0.100
 Identities = 11/37 (29%), Positives = 17/37 (45%), Gaps = 5/37 (13%)

Query: 222 ELDAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLT 258
           E D GP+I +        + + +Y  IGK   A +L 
Sbjct: 314 ETDMGPLINE-----AQLEKVLNYNEIGKEEGATLLL 345


>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
           PuuC-like.  NADP+-dependent,
           gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase
           (GABALDH) PuuC of  Escherichia coli which catalyzes the
           conversion of putrescine to 4-aminobutanoate and other
           similar sequences are present in this CD.
          Length = 462

 Score = 29.5 bits (67), Expect = 1.1
 Identities = 7/33 (21%), Positives = 14/33 (42%), Gaps = 5/33 (15%)

Query: 226 GPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLT 258
           G ++ +      H   +  YI  GK   A+++ 
Sbjct: 309 GALVSEA-----HFDKVLGYIESGKAEGARLVA 336


>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate
           (PLP) dependent enzyme that catalyses the last reaction
           in the synthesis of  threonine from aspartate. It
           proceeds by converting O-phospho-L-homoserine (OPH) into
           threonine and inorganic phosphate. In plants, OPH is an
           intermediate between the methionine and
           threonine/isoleucine pathways. Thus threonine synthase
           competes for OPH with cystathionine-gamma-synthase, the
           first enzyme in the methionine pathway. These enzymes
           are in general dimers. Members of this CD, Thr-synth_1,
           are widely distributed in bacteria, archaea and higher
           plants..
          Length = 324

 Score = 29.1 bits (66), Expect = 1.6
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 201 YKQAYEYGV-----KIIGATAHYA--ICELDAGPIIEQDVVRVTHAQTIEDYIAIGK 250
           +K+  E G+     +++G  A  A  I    A    + D+  V + +TI   I IG 
Sbjct: 192 FKELKELGLIDRLPRMVGVQAEGAAPIVR--AFKEGKDDIEPVENPETIATAIRIGN 246


>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid
           dehydrogenase-like and related proteins.  The
           6-oxolauric acid dehydrogenase (CddD) from Rhodococcus
           ruber SC1 which converts 6-oxolauric acid to
           dodecanedioic acid; and the aldehyde dehydrogenase
           (locus SSP0762) from Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305 and also, the Mycobacterium
           tuberculosis H37Rv ALDH AldA (locus Rv0768) sequence;
           and other similar sequences, are included in this CD.
          Length = 459

 Score = 28.4 bits (64), Expect = 2.5
 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 5/33 (15%)

Query: 226 GPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLT 258
           GP+I            +E YIA G++  A+++T
Sbjct: 306 GPLI-----SAAQRDRVEGYIARGRDEGARLVT 333


>gnl|CDD|31295 COG1098, VacB, Predicted RNA binding protein (contains ribosomal
           protein S1 domain) [Translation, ribosomal structure and
           biogenesis].
          Length = 129

 Score = 28.3 bits (63), Expect = 2.5
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 210 KIIGATAHYAICELDAGPIIEQDVVRVTHAQT-----IEDYIAIGKNIEAKVL 257
           KI G T + A  EL+ G   +  +V ++         I D++ +G+ ++ KVL
Sbjct: 12  KITGITPYGAFVELEGG---KTGLVHISEIADGFVKDIHDHLKVGQEVKVKVL 61


>gnl|CDD|33623 COG3830, COG3830, ACT domain-containing protein [Signal
          transduction mechanisms].
          Length = 90

 Score = 27.8 bits (62), Expect = 3.9
 Identities = 11/36 (30%), Positives = 17/36 (47%)

Query: 1  MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQ 36
              ++T+       I + +   L+  G NILDISQ
Sbjct: 1  KMRAVITVIGKDRVGIVAAVSRVLAEHGVNILDISQ 36


>gnl|CDD|143938 pfam00171, Aldedh, Aldehyde dehydrogenase family.  This family of
           dehydrogenases act on aldehyde substrates. Members use
           NADP as a cofactor. The family includes the following
           members: The prototypical members are the aldehyde
           dehydrogenases EC:1.2.1.3. Succinate-semialdehyde
           dehydrogenase EC:1.2.1.16. Lactaldehyde dehydrogenase
           EC:1.2.1.22. Benzaldehyde dehydrogenase EC:1.2.1.28.
           Methylmalonate-semialdehyde dehydrogenase EC:1.2.1.27.
           Glyceraldehyde-3-phosphate dehydrogenase EC:1.2.1.9.
           Delta-1-pyrroline-5-carboxylate dehydrogenase EC:
           1.5.1.12. Acetaldehyde dehydrogenase EC:1.2.1.10.
           Glutamate-5-semialdehyde dehydrogenase EC:1.2.1.41. This
           family also includes omega crystallin, an eye lens
           protein from squid and octopus that has little aldehyde
           dehydrogenase activity.
          Length = 459

 Score = 27.5 bits (62), Expect = 4.3
 Identities = 9/33 (27%), Positives = 14/33 (42%), Gaps = 5/33 (15%)

Query: 226 GPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLT 258
           GP+I +        + +  YI   K   AK+L 
Sbjct: 309 GPLISKK-----QRERVLSYIEDAKEEGAKLLC 336


>gnl|CDD|37661 KOG2450, KOG2450, KOG2450, Aldehyde dehydrogenase [Energy
           production and conversion].
          Length = 501

 Score = 27.1 bits (60), Expect = 5.1
 Identities = 8/26 (30%), Positives = 11/26 (42%)

Query: 233 VVRVTHAQTIEDYIAIGKNIEAKVLT 258
            +  T  + I  YI  GK   A +L 
Sbjct: 345 QISKTQYEKILGYIESGKKEGATLLC 370


>gnl|CDD|37663 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehydrogenase
           [Nucleotide transport and metabolism].
          Length = 881

 Score = 26.9 bits (59), Expect = 6.0
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 182 GRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQT 241
           G II  H S LP  +GA+       +G K  G +  +A   LD G ++ Q    V    T
Sbjct: 101 GSII-YHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDT 159

Query: 242 I 242
           +
Sbjct: 160 V 160


>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family.
           The aldehyde dehydrogenase family (ALDH) of NAD(P)+
           dependent enzymes, in general, oxidize a wide range of
           endogenous and exogenous aliphatic and aromatic
           aldehydes to their corresponding carboxylic acids and
           play an  important role in detoxification. Besides
           aldehyde detoxification, many ALDH isozymes possess
           multiple additional catalytic and non-catalytic
           functions such as participating in  metabolic pathways,
           or as  binding proteins, or as osmoregulants, to mention
           a few. The enzyme has three domains, a NAD(P)+
           cofactor-binding domain, a catalytic domain, and a
           bridging domain; and the active enzyme  is generally
           either homodimeric or homotetrameric. The catalytic
           mechanism is proposed to involve cofactor binding,
           resulting in a conformational change and activation of
           an invariant catalytic cysteine nucleophile. The
           cysteine and aldehyde substrate form an oxyanion
           thiohemiacetal intermediate resulting in hydride
           transfer to the cofactor and formation of a
           thioacylenzyme intermediate. Hydrolysis of the
           thioacylenzyme and release of the carboxylic acid
           product occurs, and in most cases, the reduced cofactor
           dissociates from the enzyme. The evolutionary
           phylogenetic tree of ALDHs appears to have an initial
           bifurcation between what has been characterized as the
           classical aldehyde dehydrogenases, the ALDH family
           (ALDH) and extended family members or aldehyde
           dehydrogenase-like (ALDH-like) proteins. The ALDH
           proteins are represented by enzymes which share a number
           of highly conserved residues necessary for catalysis and
           cofactor binding and they include such proteins as
           retinal dehydrogenase, 10-formyltetrahydrofolate
           dehydrogenase, non-phosphorylating glyceraldehyde
           3-phosphate dehydrogenase,
           delta(1)-pyrroline-5-carboxylate dehydrogenases,
           alpha-ketoglutaric semialdehyde dehydrogenase,
           alpha-aminoadipic semialdehyde dehydrogenase, coniferyl
           aldehyde dehydrogenase and succinate-semialdehyde
           dehydrogenase.  Included in this larger group are all
           human, Arabidopsis, Tortula, fungal, protozoan, and
           Drosophila ALDHs identified in families ALDH1 through
           ALDH22 with the exception of families ALDH18, ALDH19,
           and ALDH20 which are present in the ALDH-like group.
          Length = 432

 Score = 26.8 bits (60), Expect = 6.6
 Identities = 10/35 (28%), Positives = 13/35 (37%), Gaps = 5/35 (14%)

Query: 224 DAGPIIEQDVVRVTHAQTIEDYIAIGKNIEAKVLT 258
           D GP+I            +  YI   K   AK+L 
Sbjct: 277 DMGPLISA-----AQLDRVLAYIEDAKAEGAKLLC 306


>gnl|CDD|38994 KOG3790, KOG3790, KOG3790, Uncharacterized conserved protein
           [Function unknown].
          Length = 529

 Score = 26.6 bits (58), Expect = 7.8
 Identities = 14/70 (20%), Positives = 28/70 (40%), Gaps = 8/70 (11%)

Query: 124 KKLVEN--YQLPFYYLPMTEQNKIESEQKLINIIEKNNV-----ELMILARYMQILSDHL 176
             L+ +    +P     M+E +K  +  K I+    N++     E   L  +  +L+   
Sbjct: 368 GVLIPDLEETIPEELRSMSEGDKFIARFKEISFTNCNHIDETTRERPALKLFDFVLNIPC 427

Query: 177 C-HKMTGRII 185
           C H  +G + 
Sbjct: 428 CVHGWSGEVP 437


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.323    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0726    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 3,393,566
Number of extensions: 173373
Number of successful extensions: 424
Number of sequences better than 10.0: 1
Number of HSP's gapped: 421
Number of HSP's successfully gapped: 24
Length of query: 288
Length of database: 6,263,737
Length adjustment: 93
Effective length of query: 195
Effective length of database: 4,254,100
Effective search space: 829549500
Effective search space used: 829549500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 57 (25.7 bits)